data_2MLF # _entry.id 2MLF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MLF pdb_00002mlf 10.2210/pdb2mlf/pdb RCSB RCSB103756 ? ? BMRB 19817 ? 10.13018/BMR19817 WWPDB D_1000103756 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-03-12 2 'Structure model' 1 1 2015-12-09 3 'Structure model' 1 2 2023-06-14 4 'Structure model' 1 3 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_struct_conn_angle 5 3 'Structure model' struct_conn 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond 10 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.value' 16 3 'Structure model' '_struct_conn.pdbx_dist_value' 17 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 18 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 19 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 23 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 24 3 'Structure model' '_struct_ref_seq_dif.details' 25 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 26 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 27 3 'Structure model' '_struct_site.pdbx_auth_seq_id' 28 4 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MLF _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-02-26 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 19817 BMRB unspecified . 2MLE PDB unspecified . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Baryshnikova, O.K.' 1 'Robertson, I.M.' 2 'Mercier, P.' 3 'Sykes, B.D.' 4 # _citation.id primary _citation.title 'The dilated cardiomyopathy G159D mutation in cardiac troponin C weakens the anchoring interaction with troponin I.' _citation.journal_abbrev Biochemistry _citation.journal_volume 47 _citation.page_first 10950 _citation.page_last 10960 _citation.year 2008 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18803402 _citation.pdbx_database_id_DOI 10.1021/bi801165c # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Baryshnikova, O.K.' 1 ? primary 'Robertson, I.M.' 2 ? primary 'Mercier, P.' 3 ? primary 'Sykes, B.D.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Troponin C, slow skeletal and cardiac muscles' 8427.240 1 ? ? 'UNP residues 91-161' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name TN-C # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKDVE _entity_poly.pdbx_seq_one_letter_code_can MGKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKDVE _entity_poly.pdbx_strand_id C _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 LYS n 1 4 SER n 1 5 GLU n 1 6 GLU n 1 7 GLU n 1 8 LEU n 1 9 SER n 1 10 ASP n 1 11 LEU n 1 12 PHE n 1 13 ARG n 1 14 MET n 1 15 PHE n 1 16 ASP n 1 17 LYS n 1 18 ASN n 1 19 ALA n 1 20 ASP n 1 21 GLY n 1 22 TYR n 1 23 ILE n 1 24 ASP n 1 25 LEU n 1 26 ASP n 1 27 GLU n 1 28 LEU n 1 29 LYS n 1 30 ILE n 1 31 MET n 1 32 LEU n 1 33 GLN n 1 34 ALA n 1 35 THR n 1 36 GLY n 1 37 GLU n 1 38 THR n 1 39 ILE n 1 40 THR n 1 41 GLU n 1 42 ASP n 1 43 ASP n 1 44 ILE n 1 45 GLU n 1 46 GLU n 1 47 LEU n 1 48 MET n 1 49 LYS n 1 50 ASP n 1 51 GLY n 1 52 ASP n 1 53 LYS n 1 54 ASN n 1 55 ASN n 1 56 ASP n 1 57 GLY n 1 58 ARG n 1 59 ILE n 1 60 ASP n 1 61 TYR n 1 62 ASP n 1 63 GLU n 1 64 PHE n 1 65 LEU n 1 66 GLU n 1 67 PHE n 1 68 MET n 1 69 LYS n 1 70 ASP n 1 71 VAL n 1 72 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TNNC1, TNNC' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'BL21(DE3)pLysS' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 90 90 MET MET C . n A 1 2 GLY 2 91 91 GLY GLY C . n A 1 3 LYS 3 92 92 LYS LYS C . n A 1 4 SER 4 93 93 SER SER C . n A 1 5 GLU 5 94 94 GLU GLU C . n A 1 6 GLU 6 95 95 GLU GLU C . n A 1 7 GLU 7 96 96 GLU GLU C . n A 1 8 LEU 8 97 97 LEU LEU C . n A 1 9 SER 9 98 98 SER SER C . n A 1 10 ASP 10 99 99 ASP ASP C . n A 1 11 LEU 11 100 100 LEU LEU C . n A 1 12 PHE 12 101 101 PHE PHE C . n A 1 13 ARG 13 102 102 ARG ARG C . n A 1 14 MET 14 103 103 MET MET C . n A 1 15 PHE 15 104 104 PHE PHE C . n A 1 16 ASP 16 105 105 ASP ASP C . n A 1 17 LYS 17 106 106 LYS LYS C . n A 1 18 ASN 18 107 107 ASN ASN C . n A 1 19 ALA 19 108 108 ALA ALA C . n A 1 20 ASP 20 109 109 ASP ASP C . n A 1 21 GLY 21 110 110 GLY GLY C . n A 1 22 TYR 22 111 111 TYR TYR C . n A 1 23 ILE 23 112 112 ILE ILE C . n A 1 24 ASP 24 113 113 ASP ASP C . n A 1 25 LEU 25 114 114 LEU LEU C . n A 1 26 ASP 26 115 115 ASP ASP C . n A 1 27 GLU 27 116 116 GLU GLU C . n A 1 28 LEU 28 117 117 LEU LEU C . n A 1 29 LYS 29 118 118 LYS LYS C . n A 1 30 ILE 30 119 119 ILE ILE C . n A 1 31 MET 31 120 120 MET MET C . n A 1 32 LEU 32 121 121 LEU LEU C . n A 1 33 GLN 33 122 122 GLN GLN C . n A 1 34 ALA 34 123 123 ALA ALA C . n A 1 35 THR 35 124 124 THR THR C . n A 1 36 GLY 36 125 125 GLY GLY C . n A 1 37 GLU 37 126 126 GLU GLU C . n A 1 38 THR 38 127 127 THR THR C . n A 1 39 ILE 39 128 128 ILE ILE C . n A 1 40 THR 40 129 129 THR THR C . n A 1 41 GLU 41 130 130 GLU GLU C . n A 1 42 ASP 42 131 131 ASP ASP C . n A 1 43 ASP 43 132 132 ASP ASP C . n A 1 44 ILE 44 133 133 ILE ILE C . n A 1 45 GLU 45 134 134 GLU GLU C . n A 1 46 GLU 46 135 135 GLU GLU C . n A 1 47 LEU 47 136 136 LEU LEU C . n A 1 48 MET 48 137 137 MET MET C . n A 1 49 LYS 49 138 138 LYS LYS C . n A 1 50 ASP 50 139 139 ASP ASP C . n A 1 51 GLY 51 140 140 GLY GLY C . n A 1 52 ASP 52 141 141 ASP ASP C . n A 1 53 LYS 53 142 142 LYS LYS C . n A 1 54 ASN 54 143 143 ASN ASN C . n A 1 55 ASN 55 144 144 ASN ASN C . n A 1 56 ASP 56 145 145 ASP ASP C . n A 1 57 GLY 57 146 146 GLY GLY C . n A 1 58 ARG 58 147 147 ARG ARG C . n A 1 59 ILE 59 148 148 ILE ILE C . n A 1 60 ASP 60 149 149 ASP ASP C . n A 1 61 TYR 61 150 150 TYR TYR C . n A 1 62 ASP 62 151 151 ASP ASP C . n A 1 63 GLU 63 152 152 GLU GLU C . n A 1 64 PHE 64 153 153 PHE PHE C . n A 1 65 LEU 65 154 154 LEU LEU C . n A 1 66 GLU 66 155 155 GLU GLU C . n A 1 67 PHE 67 156 156 PHE PHE C . n A 1 68 MET 68 157 157 MET MET C . n A 1 69 LYS 69 158 158 LYS LYS C . n A 1 70 ASP 70 159 159 ASP ASP C . n A 1 71 VAL 71 160 160 VAL VAL C . n A 1 72 GLU 72 161 161 GLU GLU C . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 201 201 CA CA2 C . C 2 CA 1 202 202 CA CA2 C . # _cell.entry_id 2MLF _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MLF _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MLF _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MLF _struct.title 'NMR structure of the dilated cardiomyopathy mutation G159D in troponin C bound to the anchoring region of troponin I' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MLF _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'troponin C, metal binding protein, dilated cardiomyopathy, G159D, EF-hand' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TNNC1_HUMAN _struct_ref.pdbx_db_accession P63316 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GKSEEELSDLFRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE _struct_ref.pdbx_align_begin 91 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MLF _struct_ref_seq.pdbx_strand_id C _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 72 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P63316 _struct_ref_seq.db_align_beg 91 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 91 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MLF MET C 1 ? UNP P63316 ? ? 'initiating methionine' 90 1 1 2MLF ASP C 70 ? UNP P63316 GLY 159 'engineered mutation' 159 2 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 4 ? ASP A 16 ? SER C 93 ASP C 105 1 ? 13 HELX_P HELX_P2 2 LEU A 25 ? GLY A 36 ? LEU C 114 GLY C 125 1 ? 12 HELX_P HELX_P3 3 THR A 40 ? ASP A 52 ? THR C 129 ASP C 141 1 ? 13 HELX_P HELX_P4 4 TYR A 61 ? MET A 68 ? TYR C 150 MET C 157 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 16 OD2 ? ? ? 1_555 C CA . CA ? ? C ASP 105 C CA 202 1_555 ? ? ? ? ? ? ? 1.859 ? ? metalc2 metalc ? ? A ASP 16 OD1 ? ? ? 1_555 C CA . CA ? ? C ASP 105 C CA 202 1_555 ? ? ? ? ? ? ? 3.143 ? ? metalc3 metalc ? ? A ASP 20 OD1 ? ? ? 1_555 C CA . CA ? ? C ASP 109 C CA 202 1_555 ? ? ? ? ? ? ? 1.886 ? ? metalc4 metalc ? ? A ASP 20 OD2 ? ? ? 1_555 C CA . CA ? ? C ASP 109 C CA 202 1_555 ? ? ? ? ? ? ? 1.933 ? ? metalc5 metalc ? ? A GLU 27 OE2 ? ? ? 1_555 C CA . CA ? ? C GLU 116 C CA 202 1_555 ? ? ? ? ? ? ? 1.915 ? ? metalc6 metalc ? ? A GLU 27 OE1 ? ? ? 1_555 C CA . CA ? ? C GLU 116 C CA 202 1_555 ? ? ? ? ? ? ? 1.935 ? ? metalc7 metalc ? ? A ASP 52 OD1 ? ? ? 1_555 B CA . CA ? ? C ASP 141 C CA 201 1_555 ? ? ? ? ? ? ? 2.522 ? ? metalc8 metalc ? ? A ASP 56 OD2 ? ? ? 1_555 B CA . CA ? ? C ASP 145 C CA 201 1_555 ? ? ? ? ? ? ? 1.917 ? ? metalc9 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 B CA . CA ? ? C ASP 145 C CA 201 1_555 ? ? ? ? ? ? ? 1.952 ? ? metalc10 metalc ? ? A ARG 58 O ? ? ? 1_555 B CA . CA ? ? C ARG 147 C CA 201 1_555 ? ? ? ? ? ? ? 1.983 ? ? metalc11 metalc ? ? A GLU 63 OE1 ? ? ? 1_555 B CA . CA ? ? C GLU 152 C CA 201 1_555 ? ? ? ? ? ? ? 1.879 ? ? metalc12 metalc ? ? A GLU 63 OE2 ? ? ? 1_555 B CA . CA ? ? C GLU 152 C CA 201 1_555 ? ? ? ? ? ? ? 2.004 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 16 ? C ASP 105 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OD1 ? A ASP 16 ? C ASP 105 ? 1_555 39.6 ? 2 OD2 ? A ASP 16 ? C ASP 105 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OD1 ? A ASP 20 ? C ASP 109 ? 1_555 98.9 ? 3 OD1 ? A ASP 16 ? C ASP 105 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OD1 ? A ASP 20 ? C ASP 109 ? 1_555 67.4 ? 4 OD2 ? A ASP 16 ? C ASP 105 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OD2 ? A ASP 20 ? C ASP 109 ? 1_555 99.2 ? 5 OD1 ? A ASP 16 ? C ASP 105 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OD2 ? A ASP 20 ? C ASP 109 ? 1_555 105.1 ? 6 OD1 ? A ASP 20 ? C ASP 109 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OD2 ? A ASP 20 ? C ASP 109 ? 1_555 64.9 ? 7 OD2 ? A ASP 16 ? C ASP 105 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OE2 ? A GLU 27 ? C GLU 116 ? 1_555 157.5 ? 8 OD1 ? A ASP 16 ? C ASP 105 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OE2 ? A GLU 27 ? C GLU 116 ? 1_555 135.6 ? 9 OD1 ? A ASP 20 ? C ASP 109 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OE2 ? A GLU 27 ? C GLU 116 ? 1_555 95.0 ? 10 OD2 ? A ASP 20 ? C ASP 109 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OE2 ? A GLU 27 ? C GLU 116 ? 1_555 102.7 ? 11 OD2 ? A ASP 16 ? C ASP 105 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OE1 ? A GLU 27 ? C GLU 116 ? 1_555 96.1 ? 12 OD1 ? A ASP 16 ? C ASP 105 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OE1 ? A GLU 27 ? C GLU 116 ? 1_555 78.8 ? 13 OD1 ? A ASP 20 ? C ASP 109 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OE1 ? A GLU 27 ? C GLU 116 ? 1_555 99.8 ? 14 OD2 ? A ASP 20 ? C ASP 109 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OE1 ? A GLU 27 ? C GLU 116 ? 1_555 159.8 ? 15 OE2 ? A GLU 27 ? C GLU 116 ? 1_555 CA ? C CA . ? C CA 202 ? 1_555 OE1 ? A GLU 27 ? C GLU 116 ? 1_555 63.9 ? 16 OD1 ? A ASP 52 ? C ASP 141 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OD2 ? A ASP 56 ? C ASP 145 ? 1_555 108.5 ? 17 OD1 ? A ASP 52 ? C ASP 141 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OD1 ? A ASP 56 ? C ASP 145 ? 1_555 75.5 ? 18 OD2 ? A ASP 56 ? C ASP 145 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OD1 ? A ASP 56 ? C ASP 145 ? 1_555 62.9 ? 19 OD1 ? A ASP 52 ? C ASP 141 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 O ? A ARG 58 ? C ARG 147 ? 1_555 127.0 ? 20 OD2 ? A ASP 56 ? C ASP 145 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 O ? A ARG 58 ? C ARG 147 ? 1_555 98.9 ? 21 OD1 ? A ASP 56 ? C ASP 145 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 O ? A ARG 58 ? C ARG 147 ? 1_555 78.4 ? 22 OD1 ? A ASP 52 ? C ASP 141 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OE1 ? A GLU 63 ? C GLU 152 ? 1_555 127.9 ? 23 OD2 ? A ASP 56 ? C ASP 145 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OE1 ? A GLU 63 ? C GLU 152 ? 1_555 103.4 ? 24 OD1 ? A ASP 56 ? C ASP 145 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OE1 ? A GLU 63 ? C GLU 152 ? 1_555 156.6 ? 25 O ? A ARG 58 ? C ARG 147 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OE1 ? A GLU 63 ? C GLU 152 ? 1_555 85.7 ? 26 OD1 ? A ASP 52 ? C ASP 141 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OE2 ? A GLU 63 ? C GLU 152 ? 1_555 76.2 ? 27 OD2 ? A ASP 56 ? C ASP 145 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OE2 ? A GLU 63 ? C GLU 152 ? 1_555 91.0 ? 28 OD1 ? A ASP 56 ? C ASP 145 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OE2 ? A GLU 63 ? C GLU 152 ? 1_555 131.9 ? 29 O ? A ARG 58 ? C ARG 147 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OE2 ? A GLU 63 ? C GLU 152 ? 1_555 148.7 ? 30 OE1 ? A GLU 63 ? C GLU 152 ? 1_555 CA ? B CA . ? C CA 201 ? 1_555 OE2 ? A GLU 63 ? C GLU 152 ? 1_555 63.0 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 22 ? ASP A 24 ? TYR C 111 ASP C 113 A 2 ARG A 58 ? ASP A 60 ? ARG C 147 ASP C 149 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 23 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id C _pdbx_struct_sheet_hbond.range_1_auth_seq_id 112 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 59 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id C _pdbx_struct_sheet_hbond.range_2_auth_seq_id 148 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software C CA 201 ? 4 'BINDING SITE FOR RESIDUE CA C 201' AC2 Software C CA 202 ? 4 'BINDING SITE FOR RESIDUE CA C 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ASP A 52 ? ASP C 141 . ? 1_555 ? 2 AC1 4 ASP A 56 ? ASP C 145 . ? 1_555 ? 3 AC1 4 ARG A 58 ? ARG C 147 . ? 1_555 ? 4 AC1 4 GLU A 63 ? GLU C 152 . ? 1_555 ? 5 AC2 4 ASP A 16 ? ASP C 105 . ? 1_555 ? 6 AC2 4 ASP A 20 ? ASP C 109 . ? 1_555 ? 7 AC2 4 TYR A 22 ? TYR C 111 . ? 1_555 ? 8 AC2 4 GLU A 27 ? GLU C 116 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O C MET 103 ? ? HZ1 C LYS 106 ? ? 1.44 2 1 OE2 C GLU 135 ? ? HZ2 C LYS 138 ? ? 1.48 3 1 O C ASP 105 ? ? HZ2 C LYS 106 ? ? 1.53 4 1 HZ2 C LYS 142 ? ? OE1 C GLU 155 ? ? 1.54 5 1 OD1 C ASP 115 ? ? HZ2 C LYS 118 ? ? 1.54 6 1 HZ3 C LYS 92 ? ? OD1 C ASP 159 ? ? 1.56 7 1 HZ2 C LYS 92 ? ? OE1 C GLU 161 ? ? 1.58 8 2 O C ASP 139 ? ? HZ3 C LYS 142 ? ? 1.46 9 2 O C MET 103 ? ? HZ3 C LYS 106 ? ? 1.55 10 2 OD1 C ASP 115 ? ? HZ1 C LYS 118 ? ? 1.57 11 2 O C MET 137 ? ? H C ASP 141 ? ? 1.58 12 2 HZ2 C LYS 118 ? ? OE1 C GLU 130 ? ? 1.59 13 3 O C ASP 139 ? ? HZ3 C LYS 142 ? ? 1.45 14 3 HZ1 C LYS 92 ? ? OG C SER 93 ? ? 1.46 15 3 O C GLU 155 ? ? HZ3 C LYS 158 ? ? 1.48 16 3 OE2 C GLU 135 ? ? HZ1 C LYS 138 ? ? 1.48 17 3 O C PHE 104 ? ? HZ1 C LYS 106 ? ? 1.50 18 3 OD1 C ASP 115 ? ? HZ1 C LYS 118 ? ? 1.51 19 3 HZ2 C LYS 158 ? ? OD1 C ASP 159 ? ? 1.51 20 3 OE1 C GLU 134 ? ? HZ3 C LYS 138 ? ? 1.54 21 4 O C MET 103 ? ? HZ2 C LYS 106 ? ? 1.51 22 4 O C ASP 139 ? ? HZ2 C LYS 142 ? ? 1.51 23 4 OE1 C GLU 134 ? ? HZ1 C LYS 138 ? ? 1.54 24 4 O C GLU 155 ? ? HZ3 C LYS 158 ? ? 1.55 25 4 O C ASP 115 ? ? HZ3 C LYS 118 ? ? 1.55 26 4 HZ1 C LYS 142 ? ? OE2 C GLU 155 ? ? 1.55 27 4 HZ2 C LYS 158 ? ? OD2 C ASP 159 ? ? 1.56 28 4 OD1 C ASP 115 ? ? HZ1 C LYS 118 ? ? 1.57 29 4 HZ3 C LYS 138 ? ? OD1 C ASN 144 ? ? 1.59 30 5 O C MET 103 ? ? HZ3 C LYS 106 ? ? 1.42 31 5 HZ1 C LYS 92 ? ? OG C SER 93 ? ? 1.46 32 5 O C ASP 139 ? ? HZ3 C LYS 142 ? ? 1.48 33 5 OE2 C GLU 135 ? ? HZ2 C LYS 138 ? ? 1.51 34 5 OD1 C ASP 115 ? ? HZ1 C LYS 118 ? ? 1.52 35 5 HZ1 C LYS 142 ? ? OD2 C ASP 159 ? ? 1.53 36 5 O C LEU 121 ? ? HG1 C THR 124 ? ? 1.53 37 5 OG C SER 98 ? ? HH C TYR 150 ? ? 1.54 38 5 OE1 C GLU 94 ? ? HZ1 C LYS 158 ? ? 1.57 39 6 O C MET 103 ? ? HZ1 C LYS 106 ? ? 1.46 40 6 H2 C MET 90 ? ? OE1 C GLU 95 ? ? 1.53 41 6 HZ3 C LYS 158 ? ? OD2 C ASP 159 ? ? 1.53 42 6 H3 C MET 90 ? ? OE2 C GLU 96 ? ? 1.54 43 6 HZ3 C LYS 142 ? ? OE1 C GLU 155 ? ? 1.57 44 6 O C MET 120 ? ? HG1 C THR 124 ? ? 1.59 45 7 O C ASP 139 ? ? HZ3 C LYS 142 ? ? 1.45 46 7 O C ASP 105 ? ? HZ3 C LYS 106 ? ? 1.52 47 7 H2 C MET 90 ? ? OG C SER 93 ? ? 1.53 48 7 OG C SER 98 ? ? HH C TYR 150 ? ? 1.54 49 7 OE1 C GLU 134 ? ? HZ3 C LYS 138 ? ? 1.55 50 7 H C ILE 112 ? ? O C ILE 148 ? ? 1.56 51 7 HZ2 C LYS 158 ? ? OD2 C ASP 159 ? ? 1.56 52 7 O C GLU 155 ? ? HZ3 C LYS 158 ? ? 1.56 53 7 OD1 C ASP 139 ? ? HZ1 C LYS 142 ? ? 1.56 54 7 H1 C MET 90 ? ? OE1 C GLU 95 ? ? 1.57 55 7 OE2 C GLU 135 ? ? HZ1 C LYS 138 ? ? 1.58 56 7 O C MET 137 ? ? H C ASP 141 ? ? 1.60 57 8 O C ASP 139 ? ? HZ3 C LYS 142 ? ? 1.46 58 8 O C MET 103 ? ? HZ3 C LYS 106 ? ? 1.48 59 8 H2 C MET 90 ? ? OG C SER 93 ? ? 1.48 60 8 O C LEU 121 ? ? HG1 C THR 124 ? ? 1.51 61 8 HZ2 C LYS 142 ? ? OE1 C GLU 155 ? ? 1.53 62 8 HZ2 C LYS 118 ? ? OE1 C GLU 130 ? ? 1.55 63 8 OE1 C GLU 134 ? ? HZ3 C LYS 138 ? ? 1.55 64 8 HZ2 C LYS 92 ? ? OE2 C GLU 94 ? ? 1.56 65 8 O C GLY 91 ? ? HZ1 C LYS 92 ? ? 1.58 66 8 OD1 C ASP 115 ? ? HZ3 C LYS 118 ? ? 1.60 67 9 HZ3 C LYS 142 ? ? OD2 C ASP 151 ? ? 1.48 68 9 HZ1 C LYS 92 ? ? O C LYS 158 ? ? 1.52 69 9 OD1 C ASP 115 ? ? HZ1 C LYS 118 ? ? 1.54 70 9 O C GLU 94 ? ? H C SER 98 ? ? 1.55 71 9 OE2 C GLU 135 ? ? HZ1 C LYS 138 ? ? 1.58 72 9 H3 C MET 90 ? ? OE2 C GLU 95 ? ? 1.59 73 9 HZ1 C LYS 142 ? ? OE2 C GLU 155 ? ? 1.59 74 10 O C GLY 91 ? ? HZ3 C LYS 92 ? ? 1.46 75 10 O C MET 103 ? ? HZ3 C LYS 106 ? ? 1.46 76 10 OG C SER 98 ? ? HH C TYR 150 ? ? 1.47 77 10 OE2 C GLU 155 ? ? HZ1 C LYS 158 ? ? 1.53 78 10 HZ2 C LYS 142 ? ? OE1 C GLU 155 ? ? 1.57 79 10 HZ3 C LYS 158 ? ? OD2 C ASP 159 ? ? 1.57 80 11 OE1 C GLU 135 ? ? HZ3 C LYS 138 ? ? 1.53 81 11 HZ2 C LYS 92 ? ? O C MET 157 ? ? 1.57 82 11 OE1 C GLU 155 ? ? HZ1 C LYS 158 ? ? 1.58 83 11 OG C SER 98 ? ? HH C TYR 150 ? ? 1.60 84 12 HZ1 C LYS 92 ? ? O C VAL 160 ? ? 1.46 85 12 O C MET 103 ? ? HZ3 C LYS 106 ? ? 1.46 86 12 OG C SER 98 ? ? HH C TYR 150 ? ? 1.48 87 12 OD1 C ASP 115 ? ? HZ3 C LYS 118 ? ? 1.53 88 12 OE2 C GLU 134 ? ? HZ1 C LYS 138 ? ? 1.56 89 12 O C GLY 140 ? ? HZ2 C LYS 142 ? ? 1.57 90 12 H3 C MET 90 ? ? O C GLU 161 ? ? 1.57 91 13 HZ1 C LYS 106 ? ? OD1 C ASN 107 ? ? 1.49 92 13 HZ3 C LYS 138 ? ? OD1 C ASP 139 ? ? 1.49 93 13 HZ2 C LYS 142 ? ? OE1 C GLU 155 ? ? 1.49 94 13 OD1 C ASP 115 ? ? HZ1 C LYS 118 ? ? 1.52 95 13 O C MET 137 ? ? H C ASP 141 ? ? 1.54 96 13 O C GLU 134 ? ? H C LYS 138 ? ? 1.57 97 13 OE2 C GLU 135 ? ? HZ2 C LYS 138 ? ? 1.57 98 14 O C GLU 95 ? ? HG C SER 98 ? ? 1.48 99 14 HZ1 C LYS 92 ? ? OE2 C GLU 96 ? ? 1.51 100 14 OD1 C ASP 115 ? ? HZ3 C LYS 118 ? ? 1.53 101 14 HZ1 C LYS 158 ? ? OD2 C ASP 159 ? ? 1.54 102 14 OE1 C GLU 155 ? ? HZ2 C LYS 158 ? ? 1.59 103 15 O C PHE 104 ? ? HZ2 C LYS 106 ? ? 1.47 104 15 O C LEU 121 ? ? HG1 C THR 124 ? ? 1.49 105 15 HZ2 C LYS 142 ? ? OD1 C ASP 151 ? ? 1.51 106 15 OG C SER 98 ? ? HH C TYR 150 ? ? 1.53 107 15 O C LYS 118 ? ? H C GLN 122 ? ? 1.54 108 15 HZ3 C LYS 158 ? ? OD2 C ASP 159 ? ? 1.55 109 15 HZ2 C LYS 92 ? ? OE2 C GLU 94 ? ? 1.57 110 15 HZ1 C LYS 142 ? ? OE2 C GLU 155 ? ? 1.57 111 15 OE1 C GLU 155 ? ? HZ1 C LYS 158 ? ? 1.58 112 15 HZ2 C LYS 118 ? ? OE1 C GLN 122 ? ? 1.58 113 15 H1 C MET 90 ? ? OE1 C GLU 96 ? ? 1.59 114 16 HZ3 C LYS 158 ? ? OD1 C ASP 159 ? ? 1.50 115 16 O C GLY 91 ? ? HZ2 C LYS 92 ? ? 1.50 116 16 OG C SER 98 ? ? HH C TYR 150 ? ? 1.50 117 16 OD1 C ASP 115 ? ? HZ1 C LYS 118 ? ? 1.53 118 16 H2 C MET 90 ? ? OE1 C GLU 95 ? ? 1.56 119 16 O C MET 90 ? ? HG C SER 93 ? ? 1.56 120 16 HZ3 C LYS 118 ? ? OE2 C GLU 130 ? ? 1.58 121 16 H C ILE 112 ? ? O C ILE 148 ? ? 1.59 122 16 HH12 C ARG 102 ? ? OD2 C ASP 105 ? ? 1.60 123 16 O C LEU 121 ? ? H C GLY 125 ? ? 1.60 124 17 O C MET 103 ? ? HZ1 C LYS 106 ? ? 1.41 125 17 HZ2 C LYS 158 ? ? OD2 C ASP 159 ? ? 1.54 126 17 HZ1 C LYS 142 ? ? OD1 C ASP 151 ? ? 1.55 127 17 OD1 C ASP 115 ? ? HZ1 C LYS 118 ? ? 1.55 128 17 O C MET 120 ? ? HG1 C THR 124 ? ? 1.55 129 17 OE2 C GLU 134 ? ? HZ2 C LYS 138 ? ? 1.56 130 17 OE2 C GLU 135 ? ? HZ3 C LYS 138 ? ? 1.57 131 18 O C MET 103 ? ? HZ2 C LYS 106 ? ? 1.46 132 18 O C LEU 121 ? ? HG1 C THR 124 ? ? 1.49 133 18 HZ1 C LYS 158 ? ? O C VAL 160 ? ? 1.51 134 18 OD1 C ASP 115 ? ? HZ2 C LYS 118 ? ? 1.52 135 18 OE2 C GLU 135 ? ? HZ1 C LYS 138 ? ? 1.52 136 18 H2 C MET 90 ? ? O C GLU 161 ? ? 1.53 137 18 HZ2 C LYS 92 ? ? OE2 C GLU 96 ? ? 1.55 138 18 HZ1 C LYS 142 ? ? OD1 C ASP 151 ? ? 1.58 139 18 OG C SER 98 ? ? HH21 C ARG 102 ? ? 1.58 140 18 HZ1 C LYS 118 ? ? OE1 C GLU 130 ? ? 1.59 141 19 O C LEU 121 ? ? HG1 C THR 124 ? ? 1.50 142 19 H2 C MET 90 ? ? OG C SER 93 ? ? 1.52 143 19 HZ2 C LYS 142 ? ? OE1 C GLU 155 ? ? 1.52 144 19 OE1 C GLU 135 ? ? HZ3 C LYS 138 ? ? 1.53 145 19 HZ1 C LYS 118 ? ? OE2 C GLU 130 ? ? 1.54 146 19 OD1 C ASP 115 ? ? HZ3 C LYS 118 ? ? 1.58 147 19 HZ1 C LYS 138 ? ? OD1 C ASP 139 ? ? 1.59 148 19 OG C SER 98 ? ? HH C TYR 150 ? ? 1.60 149 20 O C MET 103 ? ? HZ2 C LYS 106 ? ? 1.49 150 20 HZ3 C LYS 142 ? ? OD2 C ASP 151 ? ? 1.54 151 20 OD1 C ASP 115 ? ? HZ2 C LYS 118 ? ? 1.56 152 20 O C GLY 146 ? ? HH21 C ARG 147 ? ? 1.58 153 20 O C GLU 94 ? ? HG C SER 98 ? ? 1.58 154 20 HZ1 C LYS 92 ? ? OE1 C GLU 161 ? ? 1.59 155 20 OD1 C ASP 99 ? ? HH11 C ARG 102 ? ? 1.60 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.171 1.252 -0.081 0.011 N 2 1 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.181 1.252 -0.071 0.011 N 3 1 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.170 1.252 -0.082 0.011 N 4 2 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.167 1.252 -0.085 0.011 N 5 2 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.185 1.252 -0.067 0.011 N 6 2 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.165 1.252 -0.087 0.011 N 7 3 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.164 1.252 -0.088 0.011 N 8 3 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.185 1.252 -0.067 0.011 N 9 3 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.174 1.252 -0.078 0.011 N 10 4 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.180 1.252 -0.072 0.011 N 11 4 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.164 1.252 -0.088 0.011 N 12 4 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.173 1.252 -0.079 0.011 N 13 5 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.170 1.252 -0.082 0.011 N 14 5 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.170 1.252 -0.082 0.011 N 15 5 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.172 1.252 -0.080 0.011 N 16 5 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.175 1.252 -0.077 0.011 N 17 6 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.186 1.252 -0.066 0.011 N 18 6 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.148 1.252 -0.104 0.011 N 19 6 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.180 1.252 -0.072 0.011 N 20 6 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.156 1.252 -0.096 0.011 N 21 7 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.181 1.252 -0.071 0.011 N 22 7 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.168 1.252 -0.084 0.011 N 23 7 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.174 1.252 -0.078 0.011 N 24 7 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.181 1.252 -0.071 0.011 N 25 8 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.159 1.252 -0.093 0.011 N 26 8 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.174 1.252 -0.078 0.011 N 27 8 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.174 1.252 -0.078 0.011 N 28 8 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.171 1.252 -0.081 0.011 N 29 9 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.169 1.252 -0.083 0.011 N 30 9 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.177 1.252 -0.075 0.011 N 31 9 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.183 1.252 -0.069 0.011 N 32 10 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.185 1.252 -0.067 0.011 N 33 10 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.175 1.252 -0.077 0.011 N 34 10 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.176 1.252 -0.076 0.011 N 35 10 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.156 1.252 -0.096 0.011 N 36 11 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.180 1.252 -0.072 0.011 N 37 11 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.170 1.252 -0.082 0.011 N 38 11 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.162 1.252 -0.090 0.011 N 39 12 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.166 1.252 -0.086 0.011 N 40 12 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.165 1.252 -0.087 0.011 N 41 12 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.176 1.252 -0.076 0.011 N 42 13 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.178 1.252 -0.074 0.011 N 43 13 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.162 1.252 -0.090 0.011 N 44 13 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.170 1.252 -0.082 0.011 N 45 13 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.169 1.252 -0.083 0.011 N 46 14 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.185 1.252 -0.067 0.011 N 47 14 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.174 1.252 -0.078 0.011 N 48 14 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.166 1.252 -0.086 0.011 N 49 14 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.167 1.252 -0.085 0.011 N 50 15 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.173 1.252 -0.079 0.011 N 51 15 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.172 1.252 -0.080 0.011 N 52 15 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.163 1.252 -0.089 0.011 N 53 15 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.167 1.252 -0.085 0.011 N 54 16 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.185 1.252 -0.067 0.011 N 55 16 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.148 1.252 -0.104 0.011 N 56 16 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.180 1.252 -0.072 0.011 N 57 16 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.182 1.252 -0.070 0.011 N 58 17 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.184 1.252 -0.068 0.011 N 59 17 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.170 1.252 -0.082 0.011 N 60 17 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.182 1.252 -0.070 0.011 N 61 17 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.162 1.252 -0.090 0.011 N 62 18 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.166 1.252 -0.086 0.011 N 63 18 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.179 1.252 -0.073 0.011 N 64 18 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.166 1.252 -0.086 0.011 N 65 19 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.161 1.252 -0.091 0.011 N 66 19 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.167 1.252 -0.085 0.011 N 67 19 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.176 1.252 -0.076 0.011 N 68 19 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.164 1.252 -0.088 0.011 N 69 20 CD C GLU 116 ? ? OE1 C GLU 116 ? ? 1.182 1.252 -0.070 0.011 N 70 20 CD C GLU 116 ? ? OE2 C GLU 116 ? ? 1.162 1.252 -0.090 0.011 N 71 20 CD C GLU 152 ? ? OE1 C GLU 152 ? ? 1.180 1.252 -0.072 0.011 N 72 20 CD C GLU 152 ? ? OE2 C GLU 152 ? ? 1.175 1.252 -0.077 0.011 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP C 159 ? ? -91.67 -71.93 2 1 VAL C 160 ? ? 43.29 71.64 3 2 ASP C 159 ? ? 57.44 -57.06 4 2 VAL C 160 ? ? 40.44 91.52 5 4 LYS C 92 ? ? -142.51 48.80 6 4 GLU C 126 ? ? -77.59 -72.71 7 4 ILE C 128 ? ? 61.30 171.60 8 4 GLU C 130 ? ? 63.43 -64.63 9 5 GLU C 130 ? ? -72.81 49.58 10 5 ASP C 131 ? ? -144.60 -63.02 11 6 LYS C 92 ? ? -133.95 -78.60 12 6 SER C 93 ? ? -180.00 -63.70 13 6 GLU C 126 ? ? 41.61 -112.33 14 6 LYS C 158 ? ? -60.14 -73.00 15 7 LYS C 92 ? ? -146.85 39.40 16 7 GLU C 130 ? ? 68.18 -56.69 17 7 ASN C 143 ? ? -96.59 -125.84 18 7 ASN C 144 ? ? -141.91 33.28 19 8 GLU C 130 ? ? -172.36 -27.98 20 9 LYS C 92 ? ? -154.37 61.04 21 9 THR C 124 ? ? -151.60 70.25 22 9 GLU C 126 ? ? -93.50 -92.35 23 10 LYS C 92 ? ? -137.96 -35.84 24 10 ASP C 159 ? ? -108.24 60.34 25 11 GLU C 126 ? ? -82.09 -124.08 26 12 THR C 124 ? ? -159.12 57.90 27 12 ASP C 131 ? ? -145.86 -62.52 28 13 THR C 129 ? ? -77.22 -166.77 29 14 ASP C 159 ? ? -112.39 77.63 30 16 ALA C 108 ? ? 59.24 13.87 31 16 GLU C 126 ? ? 59.79 -81.92 32 16 ASP C 141 ? ? -113.14 63.57 33 16 ASN C 144 ? ? -64.36 92.49 34 17 ASP C 159 ? ? -83.42 49.90 35 19 VAL C 160 ? ? -137.57 -32.64 36 20 VAL C 160 ? ? -153.08 -54.00 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG C 102 ? ? 0.277 'SIDE CHAIN' 2 1 ARG C 147 ? ? 0.292 'SIDE CHAIN' 3 2 ARG C 102 ? ? 0.329 'SIDE CHAIN' 4 2 ARG C 147 ? ? 0.175 'SIDE CHAIN' 5 3 ARG C 102 ? ? 0.259 'SIDE CHAIN' 6 3 ARG C 147 ? ? 0.258 'SIDE CHAIN' 7 4 ARG C 102 ? ? 0.319 'SIDE CHAIN' 8 4 ARG C 147 ? ? 0.288 'SIDE CHAIN' 9 5 ARG C 102 ? ? 0.293 'SIDE CHAIN' 10 5 ARG C 147 ? ? 0.323 'SIDE CHAIN' 11 6 ARG C 102 ? ? 0.328 'SIDE CHAIN' 12 6 ARG C 147 ? ? 0.279 'SIDE CHAIN' 13 7 ARG C 102 ? ? 0.294 'SIDE CHAIN' 14 7 ARG C 147 ? ? 0.263 'SIDE CHAIN' 15 8 ARG C 102 ? ? 0.311 'SIDE CHAIN' 16 8 ARG C 147 ? ? 0.306 'SIDE CHAIN' 17 9 ARG C 102 ? ? 0.255 'SIDE CHAIN' 18 9 ARG C 147 ? ? 0.252 'SIDE CHAIN' 19 10 ARG C 102 ? ? 0.239 'SIDE CHAIN' 20 11 ARG C 102 ? ? 0.285 'SIDE CHAIN' 21 11 ARG C 147 ? ? 0.288 'SIDE CHAIN' 22 12 ARG C 102 ? ? 0.240 'SIDE CHAIN' 23 12 ARG C 147 ? ? 0.281 'SIDE CHAIN' 24 13 ARG C 102 ? ? 0.171 'SIDE CHAIN' 25 13 ARG C 147 ? ? 0.257 'SIDE CHAIN' 26 14 ARG C 102 ? ? 0.284 'SIDE CHAIN' 27 14 ARG C 147 ? ? 0.307 'SIDE CHAIN' 28 15 ARG C 102 ? ? 0.305 'SIDE CHAIN' 29 15 ARG C 147 ? ? 0.327 'SIDE CHAIN' 30 16 ARG C 102 ? ? 0.309 'SIDE CHAIN' 31 16 ARG C 147 ? ? 0.319 'SIDE CHAIN' 32 17 ARG C 102 ? ? 0.293 'SIDE CHAIN' 33 17 ARG C 147 ? ? 0.300 'SIDE CHAIN' 34 18 ARG C 102 ? ? 0.278 'SIDE CHAIN' 35 18 ARG C 147 ? ? 0.113 'SIDE CHAIN' 36 19 ARG C 102 ? ? 0.283 'SIDE CHAIN' 37 19 ARG C 147 ? ? 0.321 'SIDE CHAIN' 38 20 ARG C 102 ? ? 0.285 'SIDE CHAIN' 39 20 ARG C 147 ? ? 0.287 'SIDE CHAIN' # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MLF _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MLF _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system ;0.5 mM [U-95% 13C; U-95% 15N] cCTnC, 2 mM Calcium, 0.2 mM DSS, 100 mM potassium chloride, 5 mM sodium azide, 10 mM imidazole, 1.2 mM troponin I(34-71), 90% H2O/10% D2O ; 1 '90% H2O/10% D2O' ;0.5 mM [U-95% 13C; U-95% 15N] cCTnC, 2 mM Calcium, 0.2 mM DSS, 100 mM potassium chloride, 5 mM sodium azide, 0.5 mM imidazole, 1.2 mM troponin I(34-71), 9.5 mM [U-2H] imidazole, 100% D2O ; 2 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id cCTnC-1 0.5 ? mM '[U-95% 13C; U-95% 15N]' 1 Calcium-2 2 ? mM ? 1 DSS-3 0.2 ? mM ? 1 'potassium chloride-4' 100 ? mM ? 1 'sodium azide-5' 5 ? mM ? 1 imidazole-6 10 ? mM ? 1 'troponin I(34-71)-7' 1.2 ? mM ? 1 cCTnC-8 0.5 ? mM '[U-95% 13C; U-95% 15N]' 2 Calcium-9 2 ? mM ? 2 DSS-10 0.2 ? mM ? 2 'potassium chloride-11' 100 ? mM ? 2 'sodium azide-12' 5 ? mM ? 2 imidazole-13 0.5 ? mM ? 2 'troponin I(34-71)-14' 1.2 ? mM ? 2 imidazole-15 9.5 ? mM '[U-2H]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.12 _pdbx_nmr_exptl_sample_conditions.pH 6.7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HCCH-TOCSY' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D H(CCO)NH' 1 6 1 '3D C(CO)NH' 1 7 1 '3D 1H-13C NOESY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-15N TOCSY' 1 10 1 '3D HNHA' 1 11 1 '3D HNHB' 1 12 2 '2D DQF-COSY' 1 13 2 '2D 1H-1H NOESY' 1 14 1 '2D 13C-15N Filtered 1H-1H TOCSY' 1 15 1 '2D 13C-15N Filtered 1H-1H NOESY' 1 16 1 '2D 13C Edited,Filtered NOESY' # _pdbx_nmr_refine.entry_id 2MLF _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 'Guntert, Mumenthaler and Wuthrich' 'geometry optimization' CYANA ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRDraw ? 3 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 4 'Johnson, One Moon Scientific' 'peak picking' NMRView ? 5 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 6 'Laskowski and MacArthur' refinement ProcheckNMR ? 7 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 8 'Cornilescu, Delaglio and Bax' refinement TALOS ? 9 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 10 Varian 'data analysis' VnmrJ ? 11 ? refinement CYANA ? 12 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 ILE N N N N 124 ILE CA C N S 125 ILE C C N N 126 ILE O O N N 127 ILE CB C N S 128 ILE CG1 C N N 129 ILE CG2 C N N 130 ILE CD1 C N N 131 ILE OXT O N N 132 ILE H H N N 133 ILE H2 H N N 134 ILE HA H N N 135 ILE HB H N N 136 ILE HG12 H N N 137 ILE HG13 H N N 138 ILE HG21 H N N 139 ILE HG22 H N N 140 ILE HG23 H N N 141 ILE HD11 H N N 142 ILE HD12 H N N 143 ILE HD13 H N N 144 ILE HXT H N N 145 LEU N N N N 146 LEU CA C N S 147 LEU C C N N 148 LEU O O N N 149 LEU CB C N N 150 LEU CG C N N 151 LEU CD1 C N N 152 LEU CD2 C N N 153 LEU OXT O N N 154 LEU H H N N 155 LEU H2 H N N 156 LEU HA H N N 157 LEU HB2 H N N 158 LEU HB3 H N N 159 LEU HG H N N 160 LEU HD11 H N N 161 LEU HD12 H N N 162 LEU HD13 H N N 163 LEU HD21 H N N 164 LEU HD22 H N N 165 LEU HD23 H N N 166 LEU HXT H N N 167 LYS N N N N 168 LYS CA C N S 169 LYS C C N N 170 LYS O O N N 171 LYS CB C N N 172 LYS CG C N N 173 LYS CD C N N 174 LYS CE C N N 175 LYS NZ N N N 176 LYS OXT O N N 177 LYS H H N N 178 LYS H2 H N N 179 LYS HA H N N 180 LYS HB2 H N N 181 LYS HB3 H N N 182 LYS HG2 H N N 183 LYS HG3 H N N 184 LYS HD2 H N N 185 LYS HD3 H N N 186 LYS HE2 H N N 187 LYS HE3 H N N 188 LYS HZ1 H N N 189 LYS HZ2 H N N 190 LYS HZ3 H N N 191 LYS HXT H N N 192 MET N N N N 193 MET CA C N S 194 MET C C N N 195 MET O O N N 196 MET CB C N N 197 MET CG C N N 198 MET SD S N N 199 MET CE C N N 200 MET OXT O N N 201 MET H H N N 202 MET H2 H N N 203 MET HA H N N 204 MET HB2 H N N 205 MET HB3 H N N 206 MET HG2 H N N 207 MET HG3 H N N 208 MET HE1 H N N 209 MET HE2 H N N 210 MET HE3 H N N 211 MET HXT H N N 212 PHE N N N N 213 PHE CA C N S 214 PHE C C N N 215 PHE O O N N 216 PHE CB C N N 217 PHE CG C Y N 218 PHE CD1 C Y N 219 PHE CD2 C Y N 220 PHE CE1 C Y N 221 PHE CE2 C Y N 222 PHE CZ C Y N 223 PHE OXT O N N 224 PHE H H N N 225 PHE H2 H N N 226 PHE HA H N N 227 PHE HB2 H N N 228 PHE HB3 H N N 229 PHE HD1 H N N 230 PHE HD2 H N N 231 PHE HE1 H N N 232 PHE HE2 H N N 233 PHE HZ H N N 234 PHE HXT H N N 235 SER N N N N 236 SER CA C N S 237 SER C C N N 238 SER O O N N 239 SER CB C N N 240 SER OG O N N 241 SER OXT O N N 242 SER H H N N 243 SER H2 H N N 244 SER HA H N N 245 SER HB2 H N N 246 SER HB3 H N N 247 SER HG H N N 248 SER HXT H N N 249 THR N N N N 250 THR CA C N S 251 THR C C N N 252 THR O O N N 253 THR CB C N R 254 THR OG1 O N N 255 THR CG2 C N N 256 THR OXT O N N 257 THR H H N N 258 THR H2 H N N 259 THR HA H N N 260 THR HB H N N 261 THR HG1 H N N 262 THR HG21 H N N 263 THR HG22 H N N 264 THR HG23 H N N 265 THR HXT H N N 266 TYR N N N N 267 TYR CA C N S 268 TYR C C N N 269 TYR O O N N 270 TYR CB C N N 271 TYR CG C Y N 272 TYR CD1 C Y N 273 TYR CD2 C Y N 274 TYR CE1 C Y N 275 TYR CE2 C Y N 276 TYR CZ C Y N 277 TYR OH O N N 278 TYR OXT O N N 279 TYR H H N N 280 TYR H2 H N N 281 TYR HA H N N 282 TYR HB2 H N N 283 TYR HB3 H N N 284 TYR HD1 H N N 285 TYR HD2 H N N 286 TYR HE1 H N N 287 TYR HE2 H N N 288 TYR HH H N N 289 TYR HXT H N N 290 VAL N N N N 291 VAL CA C N S 292 VAL C C N N 293 VAL O O N N 294 VAL CB C N N 295 VAL CG1 C N N 296 VAL CG2 C N N 297 VAL OXT O N N 298 VAL H H N N 299 VAL H2 H N N 300 VAL HA H N N 301 VAL HB H N N 302 VAL HG11 H N N 303 VAL HG12 H N N 304 VAL HG13 H N N 305 VAL HG21 H N N 306 VAL HG22 H N N 307 VAL HG23 H N N 308 VAL HXT H N N 309 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 ILE N CA sing N N 116 ILE N H sing N N 117 ILE N H2 sing N N 118 ILE CA C sing N N 119 ILE CA CB sing N N 120 ILE CA HA sing N N 121 ILE C O doub N N 122 ILE C OXT sing N N 123 ILE CB CG1 sing N N 124 ILE CB CG2 sing N N 125 ILE CB HB sing N N 126 ILE CG1 CD1 sing N N 127 ILE CG1 HG12 sing N N 128 ILE CG1 HG13 sing N N 129 ILE CG2 HG21 sing N N 130 ILE CG2 HG22 sing N N 131 ILE CG2 HG23 sing N N 132 ILE CD1 HD11 sing N N 133 ILE CD1 HD12 sing N N 134 ILE CD1 HD13 sing N N 135 ILE OXT HXT sing N N 136 LEU N CA sing N N 137 LEU N H sing N N 138 LEU N H2 sing N N 139 LEU CA C sing N N 140 LEU CA CB sing N N 141 LEU CA HA sing N N 142 LEU C O doub N N 143 LEU C OXT sing N N 144 LEU CB CG sing N N 145 LEU CB HB2 sing N N 146 LEU CB HB3 sing N N 147 LEU CG CD1 sing N N 148 LEU CG CD2 sing N N 149 LEU CG HG sing N N 150 LEU CD1 HD11 sing N N 151 LEU CD1 HD12 sing N N 152 LEU CD1 HD13 sing N N 153 LEU CD2 HD21 sing N N 154 LEU CD2 HD22 sing N N 155 LEU CD2 HD23 sing N N 156 LEU OXT HXT sing N N 157 LYS N CA sing N N 158 LYS N H sing N N 159 LYS N H2 sing N N 160 LYS CA C sing N N 161 LYS CA CB sing N N 162 LYS CA HA sing N N 163 LYS C O doub N N 164 LYS C OXT sing N N 165 LYS CB CG sing N N 166 LYS CB HB2 sing N N 167 LYS CB HB3 sing N N 168 LYS CG CD sing N N 169 LYS CG HG2 sing N N 170 LYS CG HG3 sing N N 171 LYS CD CE sing N N 172 LYS CD HD2 sing N N 173 LYS CD HD3 sing N N 174 LYS CE NZ sing N N 175 LYS CE HE2 sing N N 176 LYS CE HE3 sing N N 177 LYS NZ HZ1 sing N N 178 LYS NZ HZ2 sing N N 179 LYS NZ HZ3 sing N N 180 LYS OXT HXT sing N N 181 MET N CA sing N N 182 MET N H sing N N 183 MET N H2 sing N N 184 MET CA C sing N N 185 MET CA CB sing N N 186 MET CA HA sing N N 187 MET C O doub N N 188 MET C OXT sing N N 189 MET CB CG sing N N 190 MET CB HB2 sing N N 191 MET CB HB3 sing N N 192 MET CG SD sing N N 193 MET CG HG2 sing N N 194 MET CG HG3 sing N N 195 MET SD CE sing N N 196 MET CE HE1 sing N N 197 MET CE HE2 sing N N 198 MET CE HE3 sing N N 199 MET OXT HXT sing N N 200 PHE N CA sing N N 201 PHE N H sing N N 202 PHE N H2 sing N N 203 PHE CA C sing N N 204 PHE CA CB sing N N 205 PHE CA HA sing N N 206 PHE C O doub N N 207 PHE C OXT sing N N 208 PHE CB CG sing N N 209 PHE CB HB2 sing N N 210 PHE CB HB3 sing N N 211 PHE CG CD1 doub Y N 212 PHE CG CD2 sing Y N 213 PHE CD1 CE1 sing Y N 214 PHE CD1 HD1 sing N N 215 PHE CD2 CE2 doub Y N 216 PHE CD2 HD2 sing N N 217 PHE CE1 CZ doub Y N 218 PHE CE1 HE1 sing N N 219 PHE CE2 CZ sing Y N 220 PHE CE2 HE2 sing N N 221 PHE CZ HZ sing N N 222 PHE OXT HXT sing N N 223 SER N CA sing N N 224 SER N H sing N N 225 SER N H2 sing N N 226 SER CA C sing N N 227 SER CA CB sing N N 228 SER CA HA sing N N 229 SER C O doub N N 230 SER C OXT sing N N 231 SER CB OG sing N N 232 SER CB HB2 sing N N 233 SER CB HB3 sing N N 234 SER OG HG sing N N 235 SER OXT HXT sing N N 236 THR N CA sing N N 237 THR N H sing N N 238 THR N H2 sing N N 239 THR CA C sing N N 240 THR CA CB sing N N 241 THR CA HA sing N N 242 THR C O doub N N 243 THR C OXT sing N N 244 THR CB OG1 sing N N 245 THR CB CG2 sing N N 246 THR CB HB sing N N 247 THR OG1 HG1 sing N N 248 THR CG2 HG21 sing N N 249 THR CG2 HG22 sing N N 250 THR CG2 HG23 sing N N 251 THR OXT HXT sing N N 252 TYR N CA sing N N 253 TYR N H sing N N 254 TYR N H2 sing N N 255 TYR CA C sing N N 256 TYR CA CB sing N N 257 TYR CA HA sing N N 258 TYR C O doub N N 259 TYR C OXT sing N N 260 TYR CB CG sing N N 261 TYR CB HB2 sing N N 262 TYR CB HB3 sing N N 263 TYR CG CD1 doub Y N 264 TYR CG CD2 sing Y N 265 TYR CD1 CE1 sing Y N 266 TYR CD1 HD1 sing N N 267 TYR CD2 CE2 doub Y N 268 TYR CD2 HD2 sing N N 269 TYR CE1 CZ doub Y N 270 TYR CE1 HE1 sing N N 271 TYR CE2 CZ sing Y N 272 TYR CE2 HE2 sing N N 273 TYR CZ OH sing N N 274 TYR OH HH sing N N 275 TYR OXT HXT sing N N 276 VAL N CA sing N N 277 VAL N H sing N N 278 VAL N H2 sing N N 279 VAL CA C sing N N 280 VAL CA CB sing N N 281 VAL CA HA sing N N 282 VAL C O doub N N 283 VAL C OXT sing N N 284 VAL CB CG1 sing N N 285 VAL CB CG2 sing N N 286 VAL CB HB sing N N 287 VAL CG1 HG11 sing N N 288 VAL CG1 HG12 sing N N 289 VAL CG1 HG13 sing N N 290 VAL CG2 HG21 sing N N 291 VAL CG2 HG22 sing N N 292 VAL CG2 HG23 sing N N 293 VAL OXT HXT sing N N 294 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian INOVA 1 'Varian INOVA' 600 Varian UNITY 2 'Varian Unity' 800 Varian INOVA 3 'Varian INOVA' # _atom_sites.entry_id 2MLF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_