data_2MLM # _entry.id 2MLM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MLM pdb_00002mlm 10.2210/pdb2mlm/pdb RCSB RCSB103762 ? ? BMRB 19826 ? 10.13018/BMR19826 WWPDB D_1000103762 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-11-19 2 'Structure model' 1 1 2014-12-17 3 'Structure model' 1 2 2018-06-27 4 'Structure model' 1 3 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Experimental preparation' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Derived calculations' 8 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_nmr_sample_details 2 3 'Structure model' struct_conn 3 3 'Structure model' struct_conn_type 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_entry_details 8 4 'Structure model' pdbx_modification_feature 9 4 'Structure model' pdbx_nmr_software 10 4 'Structure model' struct_conn 11 4 'Structure model' struct_ref_seq_dif 12 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_nmr_sample_details.contents' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_pdbx_nmr_software.name' 5 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 6 4 'Structure model' '_struct_ref_seq_dif.details' 7 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 8 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 9 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MLM _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-03-03 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_id 19826 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jaudzems, K.' 1 'Zhulenkovs, D.' 2 'Leonchiks, A.' 3 # _citation.id primary _citation.title ;Discovery and structure-activity relationship studies of irreversible benzisothiazolinone-based inhibitors against Staphylococcus aureus sortase A transpeptidase. ; _citation.journal_abbrev Bioorg.Med.Chem. _citation.journal_volume 22 _citation.page_first 5988 _citation.page_last 6003 _citation.year 2014 _citation.journal_id_ASTM BMECEP _citation.country UK _citation.journal_id_ISSN 0968-0896 _citation.journal_id_CSD 1200 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25282649 _citation.pdbx_database_id_DOI 10.1016/j.bmc.2014.09.011 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhulenkovs, D.' 1 ? primary 'Rudevica, Z.' 2 ? primary 'Jaudzems, K.' 3 ? primary 'Turks, M.' 4 ? primary 'Leonchiks, A.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Sortase family protein' 16825.062 1 ? ? ? ? 2 non-polymer syn 'N-{2-oxo-2-[(3s,5s,7s)-tricyclo[3.3.1.1~3,7~]dec-1-ylamino]ethyl}-2-sulfanylbenzamide' 344.471 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKK GSMVYFKVGNETRKYKMTSIRDVKPTDVEVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK ; _entity_poly.pdbx_seq_one_letter_code_can ;MQAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKK GSMVYFKVGNETRKYKMTSIRDVKPTDVEVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'N-{2-oxo-2-[(3s,5s,7s)-tricyclo[3.3.1.1~3,7~]dec-1-ylamino]ethyl}-2-sulfanylbenzamide' _pdbx_entity_nonpoly.comp_id 2W7 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 ALA n 1 4 LYS n 1 5 PRO n 1 6 GLN n 1 7 ILE n 1 8 PRO n 1 9 LYS n 1 10 ASP n 1 11 LYS n 1 12 SER n 1 13 LYS n 1 14 VAL n 1 15 ALA n 1 16 GLY n 1 17 TYR n 1 18 ILE n 1 19 GLU n 1 20 ILE n 1 21 PRO n 1 22 ASP n 1 23 ALA n 1 24 ASP n 1 25 ILE n 1 26 LYS n 1 27 GLU n 1 28 PRO n 1 29 VAL n 1 30 TYR n 1 31 PRO n 1 32 GLY n 1 33 PRO n 1 34 ALA n 1 35 THR n 1 36 PRO n 1 37 GLU n 1 38 GLN n 1 39 LEU n 1 40 ASN n 1 41 ARG n 1 42 GLY n 1 43 VAL n 1 44 SER n 1 45 PHE n 1 46 ALA n 1 47 GLU n 1 48 GLU n 1 49 ASN n 1 50 GLU n 1 51 SER n 1 52 LEU n 1 53 ASP n 1 54 ASP n 1 55 GLN n 1 56 ASN n 1 57 ILE n 1 58 SER n 1 59 ILE n 1 60 ALA n 1 61 GLY n 1 62 HIS n 1 63 THR n 1 64 PHE n 1 65 ILE n 1 66 ASP n 1 67 ARG n 1 68 PRO n 1 69 ASN n 1 70 TYR n 1 71 GLN n 1 72 PHE n 1 73 THR n 1 74 ASN n 1 75 LEU n 1 76 LYS n 1 77 ALA n 1 78 ALA n 1 79 LYS n 1 80 LYS n 1 81 GLY n 1 82 SER n 1 83 MET n 1 84 VAL n 1 85 TYR n 1 86 PHE n 1 87 LYS n 1 88 VAL n 1 89 GLY n 1 90 ASN n 1 91 GLU n 1 92 THR n 1 93 ARG n 1 94 LYS n 1 95 TYR n 1 96 LYS n 1 97 MET n 1 98 THR n 1 99 SER n 1 100 ILE n 1 101 ARG n 1 102 ASP n 1 103 VAL n 1 104 LYS n 1 105 PRO n 1 106 THR n 1 107 ASP n 1 108 VAL n 1 109 GLU n 1 110 VAL n 1 111 LEU n 1 112 ASP n 1 113 GLU n 1 114 GLN n 1 115 LYS n 1 116 GLY n 1 117 LYS n 1 118 ASP n 1 119 LYS n 1 120 GLN n 1 121 LEU n 1 122 THR n 1 123 LEU n 1 124 ILE n 1 125 THR n 1 126 CYS n 1 127 ASP n 1 128 ASP n 1 129 TYR n 1 130 ASN n 1 131 GLU n 1 132 LYS n 1 133 THR n 1 134 GLY n 1 135 VAL n 1 136 TRP n 1 137 GLU n 1 138 LYS n 1 139 ARG n 1 140 LYS n 1 141 ILE n 1 142 PHE n 1 143 VAL n 1 144 ALA n 1 145 THR n 1 146 GLU n 1 147 VAL n 1 148 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene CA347_2602 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Staphylococcus aureus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1323661 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET23a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 2W7 non-polymer . 'N-{2-oxo-2-[(3s,5s,7s)-tricyclo[3.3.1.1~3,7~]dec-1-ylamino]ethyl}-2-sulfanylbenzamide' ? 'C19 H24 N2 O2 S' 344.471 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ALA 3 3 3 ALA ALA A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 PRO 5 5 5 PRO PRO A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 PRO 21 21 21 PRO PRO A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 ILE 25 25 25 ILE ILE A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 TYR 30 30 30 TYR TYR A . n A 1 31 PRO 31 31 31 PRO PRO A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 PRO 33 33 33 PRO PRO A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 THR 35 35 35 THR THR A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLN 38 38 38 GLN GLN A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASN 40 40 40 ASN ASN A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 HIS 62 62 62 HIS HIS A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 ILE 65 65 65 ILE ILE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ALA 77 77 77 ALA ALA A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 PHE 86 86 86 PHE PHE A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 ARG 93 93 93 ARG ARG A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 MET 97 97 97 MET MET A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 SER 99 99 99 SER SER A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 VAL 110 110 110 VAL VAL A . n A 1 111 LEU 111 111 111 LEU LEU A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 LYS 115 115 115 LYS LYS A . n A 1 116 GLY 116 116 116 GLY GLY A . n A 1 117 LYS 117 117 117 LYS LYS A . n A 1 118 ASP 118 118 118 ASP ASP A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 GLN 120 120 120 GLN GLN A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 CYS 126 126 126 CYS CYS A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 ASP 128 128 128 ASP ASP A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 GLU 131 131 131 GLU GLU A . n A 1 132 LYS 132 132 132 LYS LYS A . n A 1 133 THR 133 133 133 THR THR A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 TRP 136 136 136 TRP TRP A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 LYS 138 138 138 LYS LYS A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ILE 141 141 141 ILE ILE A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 LYS 148 148 148 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id 2W7 _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id 2W7 _pdbx_nonpoly_scheme.auth_mon_id 2W7 _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _cell.entry_id 2MLM _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2MLM _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MLM _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MLM _struct.title 'Solution structure of sortase A from S. aureus in complex with benzo[d]isothiazol-3-one based inhibitor' _struct.pdbx_model_details 'closest to the average, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MLM _struct_keywords.pdbx_keywords 'HYDROLASE/HYDROLASE INHIBITOR' _struct_keywords.text 'HYDROLASE/HYDROLASE INHIBITOR, HYDROLASE-HYDROLASE INHIBITOR complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code R9YTM5_STAAU _struct_ref.pdbx_db_accession R9YTM5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QAKPQIPKDKSKVAGYIEIPDADIKEPVYPGPATPEQLNRGVSFAEENESLDDQNISIAGHTFIDRPNYQFTNLKAAKKG SMVYFKVGNETRKYKMTSIRDVKPTDVEVLDEQKGKDKQLTLITCDDYNEKTGVWEKRKIFVATEVK ; _struct_ref.pdbx_align_begin 60 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MLM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 148 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession R9YTM5 _struct_ref_seq.db_align_beg 60 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 206 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 148 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2MLM _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code R9YTM5 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 21 ? ASP A 24 ? PRO A 21 ASP A 24 5 ? 4 HELX_P HELX_P2 2 GLU A 37 ? ARG A 41 ? GLU A 37 ARG A 41 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag one _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 126 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id 2W7 _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id S2 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 126 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id 2W7 _struct_conn.ptnr2_auth_seq_id 201 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.030 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id 2W7 _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 126 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id 2W7 _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 201 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 126 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom S2 _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id 2W7 _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Covalent chemical modification' # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 25 ? VAL A 29 ? ILE A 25 VAL A 29 A 2 GLY A 16 ? ILE A 20 ? GLY A 16 ILE A 20 A 3 MET A 83 ? VAL A 88 ? MET A 83 VAL A 88 A 4 GLU A 91 ? VAL A 103 ? GLU A 91 VAL A 103 A 5 ARG A 139 ? GLU A 146 ? ARG A 139 GLU A 146 A 6 GLN A 120 ? CYS A 126 ? GLN A 120 CYS A 126 A 7 ASN A 56 ? HIS A 62 ? ASN A 56 HIS A 62 A 8 SER A 44 ? PHE A 45 ? SER A 44 PHE A 45 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O VAL A 29 ? O VAL A 29 N GLY A 16 ? N GLY A 16 A 2 3 N GLU A 19 ? N GLU A 19 O TYR A 85 ? O TYR A 85 A 3 4 N VAL A 84 ? N VAL A 84 O TYR A 95 ? O TYR A 95 A 4 5 N SER A 99 ? N SER A 99 O VAL A 143 ? O VAL A 143 A 5 6 O PHE A 142 ? O PHE A 142 N LEU A 123 ? N LEU A 123 A 6 7 O ILE A 124 ? O ILE A 124 N GLY A 61 ? N GLY A 61 A 7 8 O ALA A 60 ? O ALA A 60 N SER A 44 ? N SER A 44 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id 2W7 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 6 _struct_site.details 'BINDING SITE FOR RESIDUE 2W7 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 VAL A 108 ? VAL A 108 . ? 1_555 ? 2 AC1 6 GLU A 113 ? GLU A 113 . ? 1_555 ? 3 AC1 6 ILE A 124 ? ILE A 124 . ? 1_555 ? 4 AC1 6 CYS A 126 ? CYS A 126 . ? 1_555 ? 5 AC1 6 TRP A 136 ? TRP A 136 . ? 1_555 ? 6 AC1 6 ARG A 139 ? ARG A 139 . ? 1_555 ? # _pdbx_entry_details.entry_id 2MLM _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 HB2 A ASP 102 ? ? HD3 A LYS 138 ? ? 1.31 2 1 HH21 A ARG 139 ? ? O2 A 2W7 201 ? ? 1.42 3 2 HG23 A THR 63 ? ? HA A THR 73 ? ? 1.30 4 2 HH21 A ARG 139 ? ? O3 A 2W7 201 ? ? 1.34 5 2 OD2 A ASP 102 ? ? HZ3 A LYS 104 ? ? 1.59 6 3 HH11 A ARG 139 ? ? O2 A 2W7 201 ? ? 1.39 7 3 OD2 A ASP 22 ? ? HG A SER 82 ? ? 1.55 8 3 OD2 A ASP 127 ? ? HZ3 A LYS 138 ? ? 1.60 9 3 OD2 A ASP 102 ? ? HZ3 A LYS 104 ? ? 1.60 10 4 OE2 A GLU 19 ? ? HZ2 A LYS 87 ? ? 1.55 11 4 HZ2 A LYS 4 ? ? OE1 A GLU 91 ? ? 1.56 12 5 HE A ARG 139 ? ? O2 A 2W7 201 ? ? 1.37 13 5 OE1 A GLU 19 ? ? HZ2 A LYS 26 ? ? 1.58 14 6 HZ2 A LYS 4 ? ? OD1 A ASP 53 ? ? 1.56 15 6 OD2 A ASP 102 ? ? HZ3 A LYS 104 ? ? 1.60 16 7 HH21 A ARG 139 ? ? O3 A 2W7 201 ? ? 1.47 17 7 HZ2 A LYS 94 ? ? O A LYS 148 ? ? 1.59 18 7 OD2 A ASP 10 ? ? HZ3 A LYS 13 ? ? 1.59 19 7 OD2 A ASP 102 ? ? HZ3 A LYS 138 ? ? 1.60 20 8 HH21 A ARG 139 ? ? O3 A 2W7 201 ? ? 1.48 21 8 HZ3 A LYS 4 ? ? OE1 A GLU 91 ? ? 1.56 22 9 H A ASP 127 ? ? HA A ARG 139 ? ? 1.33 23 10 HG23 A VAL 84 ? ? HZ A PHE 142 ? ? 1.33 24 10 OE2 A GLU 19 ? ? HZ1 A LYS 26 ? ? 1.56 25 10 OD1 A ASP 102 ? ? HZ2 A LYS 138 ? ? 1.57 26 10 OD2 A ASP 102 ? ? HZ2 A LYS 104 ? ? 1.58 27 11 HB A VAL 43 ? ? HE2 A PHE 72 ? ? 1.32 28 11 HH21 A ARG 139 ? ? O2 A 2W7 201 ? ? 1.50 29 11 OD1 A ASP 10 ? ? HG A SER 12 ? ? 1.58 30 12 HE1 A PHE 72 ? ? HD22 A LEU 75 ? ? 1.33 31 12 HH11 A ARG 139 ? ? O3 A 2W7 201 ? ? 1.38 32 13 O A ASP 10 ? ? HZ2 A LYS 13 ? ? 1.59 33 14 HG22 A VAL 84 ? ? HZ A PHE 142 ? ? 1.34 34 15 HA3 A GLY 61 ? ? HE2 A PHE 72 ? ? 1.25 35 15 HH12 A ARG 139 ? ? O2 A 2W7 201 ? ? 1.33 36 15 OD2 A ASP 102 ? ? HZ3 A LYS 104 ? ? 1.53 37 15 OE2 A GLU 113 ? ? HZ1 A LYS 117 ? ? 1.59 38 16 HH11 A ARG 139 ? ? O3 A 2W7 201 ? ? 1.44 39 16 OE2 A GLU 19 ? ? HZ3 A LYS 87 ? ? 1.57 40 17 HG2 A GLN 71 ? ? HD1 A PHE 72 ? ? 1.34 41 17 HH22 A ARG 139 ? ? O2 A 2W7 201 ? ? 1.42 42 18 HH21 A ARG 139 ? ? O2 A 2W7 201 ? ? 1.38 43 19 HG21 A VAL 84 ? ? HZ A PHE 142 ? ? 1.28 44 19 HH12 A ARG 139 ? ? O3 A 2W7 201 ? ? 1.39 45 19 H A GLY 61 ? ? O2 A 2W7 201 ? ? 1.44 46 19 HG1 A THR 35 ? ? OE2 A GLU 37 ? ? 1.59 47 19 OE1 A GLU 19 ? ? HZ1 A LYS 87 ? ? 1.60 48 20 HH21 A ARG 139 ? ? O2 A 2W7 201 ? ? 1.39 49 20 OD1 A ASP 102 ? ? HZ3 A LYS 104 ? ? 1.58 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 2 ? ? -122.68 -164.70 2 1 ILE A 65 ? ? -129.28 -90.17 3 1 THR A 106 ? ? 74.30 -59.49 4 1 TYR A 129 ? ? -171.82 103.11 5 2 LYS A 26 ? ? -161.95 81.60 6 2 LEU A 75 ? ? -76.09 21.77 7 2 PRO A 105 ? ? -104.13 -158.81 8 2 ASP A 128 ? ? 55.76 93.62 9 2 GLU A 137 ? ? -81.57 -75.48 10 3 PRO A 5 ? ? -49.84 107.10 11 3 LYS A 9 ? ? -89.51 34.08 12 3 ALA A 34 ? ? -63.80 98.46 13 3 ASP A 118 ? ? -104.89 -157.59 14 3 LYS A 119 ? ? -68.11 95.39 15 4 GLN A 2 ? ? -123.49 -96.84 16 4 ALA A 3 ? ? -171.00 -178.48 17 4 LYS A 26 ? ? -152.52 78.03 18 4 ALA A 34 ? ? -57.95 109.93 19 4 ARG A 41 ? ? -95.00 -64.86 20 4 GLU A 48 ? ? -95.28 39.12 21 4 SER A 82 ? ? -86.26 -158.36 22 4 ASP A 112 ? ? -107.87 -164.15 23 4 ASP A 118 ? ? -165.45 -166.72 24 4 THR A 125 ? ? -105.61 52.25 25 4 TYR A 129 ? ? -168.13 114.07 26 4 LYS A 138 ? ? -176.86 130.54 27 4 ARG A 139 ? ? -161.28 -82.30 28 5 GLN A 6 ? ? -121.13 -166.03 29 5 LEU A 39 ? ? -78.69 20.65 30 5 THR A 73 ? ? -133.30 -46.11 31 5 MET A 97 ? ? -78.87 48.29 32 5 ASP A 128 ? ? 76.22 128.17 33 5 GLU A 137 ? ? -118.73 -76.23 34 6 ILE A 7 ? ? -59.90 109.84 35 6 ASP A 54 ? ? -77.90 -167.48 36 6 THR A 63 ? ? -94.26 -86.10 37 6 ILE A 65 ? ? -127.49 -72.71 38 6 MET A 97 ? ? -81.67 46.88 39 6 PRO A 105 ? ? -76.58 46.23 40 6 ASP A 118 ? ? 175.19 -164.99 41 6 GLU A 137 ? ? -95.76 -66.09 42 7 GLN A 55 ? ? -102.18 41.53 43 7 ASN A 56 ? ? -171.94 126.69 44 7 ASP A 118 ? ? -175.23 -178.83 45 7 LYS A 132 ? ? -73.28 -79.77 46 7 GLU A 137 ? ? -71.77 -87.29 47 8 ARG A 41 ? ? -137.11 -43.64 48 8 ALA A 46 ? ? -83.96 -79.93 49 8 GLU A 47 ? ? -160.00 77.32 50 8 GLU A 50 ? ? -156.97 -150.02 51 8 TYR A 70 ? ? -104.25 -167.42 52 8 THR A 73 ? ? -130.88 -48.96 53 8 PRO A 105 ? ? -101.73 -150.41 54 8 THR A 106 ? ? -144.49 -46.92 55 8 ASP A 107 ? ? -138.39 -154.98 56 8 GLU A 109 ? ? 69.41 -3.91 57 8 LYS A 117 ? ? -102.53 -165.21 58 9 PRO A 8 ? ? -89.41 -93.83 59 9 LYS A 9 ? ? -164.97 -40.98 60 9 ALA A 34 ? ? -53.98 107.98 61 9 ASP A 54 ? ? -71.79 -84.65 62 9 GLN A 55 ? ? 172.27 -40.44 63 9 HIS A 62 ? ? -84.00 -84.16 64 9 THR A 63 ? ? 171.75 -170.04 65 9 ASP A 66 ? ? -76.77 34.65 66 9 PRO A 105 ? ? -74.06 42.92 67 9 ASP A 118 ? ? -111.98 -161.31 68 10 ALA A 3 ? ? 68.66 105.60 69 10 HIS A 62 ? ? 78.18 122.90 70 10 ASP A 66 ? ? 83.33 -25.40 71 10 GLN A 71 ? ? -1.17 -71.13 72 10 MET A 97 ? ? -83.50 44.61 73 10 GLU A 109 ? ? 48.42 23.35 74 10 ASP A 118 ? ? -110.65 -169.84 75 10 GLU A 137 ? ? -129.21 -92.55 76 11 GLN A 6 ? ? -119.31 -166.69 77 11 LYS A 26 ? ? -158.67 61.09 78 11 ASP A 54 ? ? -94.64 -157.09 79 11 GLU A 109 ? ? -96.67 34.68 80 11 LYS A 117 ? ? -76.19 -161.67 81 11 ASP A 118 ? ? -71.86 -168.23 82 11 ASP A 127 ? ? -63.50 -79.30 83 11 THR A 133 ? ? -130.79 -40.23 84 11 GLU A 137 ? ? -139.15 -84.28 85 12 ALA A 3 ? ? 73.16 151.14 86 12 ILE A 65 ? ? -135.46 -80.04 87 12 ASN A 69 ? ? -116.92 61.82 88 12 THR A 73 ? ? -141.75 -62.84 89 12 SER A 82 ? ? -85.24 -150.05 90 12 VAL A 103 ? ? -127.21 -169.52 91 12 ASP A 128 ? ? 67.25 108.44 92 13 ILE A 7 ? ? -51.04 107.24 93 13 PRO A 33 ? ? -62.07 99.62 94 13 ASN A 49 ? ? 69.41 160.31 95 13 PHE A 64 ? ? -146.74 17.55 96 13 PRO A 68 ? ? -69.94 0.85 97 13 GLN A 71 ? ? -62.18 -73.05 98 13 MET A 97 ? ? -78.02 43.35 99 13 SER A 99 ? ? -143.84 51.40 100 13 PRO A 105 ? ? -96.20 -158.44 101 13 THR A 106 ? ? -172.38 20.57 102 13 GLU A 109 ? ? 64.61 -0.77 103 13 TYR A 129 ? ? -160.30 116.33 104 13 GLU A 137 ? ? -119.77 -70.00 105 13 ARG A 139 ? ? -172.47 139.93 106 14 LYS A 26 ? ? -144.48 59.19 107 14 ASP A 54 ? ? -92.09 -159.23 108 14 THR A 63 ? ? 176.70 -176.65 109 14 ILE A 65 ? ? -91.32 47.10 110 14 ASP A 66 ? ? 69.80 -29.90 111 14 ARG A 67 ? ? 60.56 67.55 112 14 THR A 73 ? ? -107.33 -67.28 113 14 ASN A 90 ? ? -161.40 -35.80 114 14 VAL A 110 ? ? 48.79 21.81 115 14 ASP A 118 ? ? -124.81 -168.14 116 14 ASP A 128 ? ? -141.65 -1.47 117 14 GLU A 137 ? ? -104.63 -95.31 118 15 ARG A 41 ? ? -99.03 -65.16 119 15 PHE A 64 ? ? -110.73 -158.81 120 15 ARG A 67 ? ? -161.29 105.14 121 15 THR A 73 ? ? -150.55 -40.28 122 15 PRO A 105 ? ? -73.39 41.42 123 15 ASP A 118 ? ? -108.89 -168.18 124 15 ASP A 128 ? ? -164.81 106.80 125 16 GLN A 2 ? ? -142.62 -155.09 126 16 ALA A 34 ? ? -62.67 99.98 127 16 ASP A 53 ? ? -149.16 54.46 128 16 GLN A 55 ? ? 178.82 -65.27 129 16 ILE A 65 ? ? -164.66 -51.31 130 16 GLN A 71 ? ? -33.06 -88.18 131 16 SER A 82 ? ? -96.78 -159.10 132 16 THR A 106 ? ? 72.57 -46.73 133 16 LYS A 115 ? ? 52.30 -172.31 134 16 ASP A 128 ? ? 175.61 93.99 135 16 GLU A 131 ? ? 53.80 -22.97 136 17 ALA A 3 ? ? 60.33 87.47 137 17 PRO A 5 ? ? -57.36 109.57 138 17 ASP A 54 ? ? -86.80 -95.09 139 17 GLN A 55 ? ? -173.45 -18.51 140 17 SER A 82 ? ? -78.16 -165.12 141 17 PRO A 105 ? ? -53.60 99.96 142 17 GLU A 109 ? ? -94.85 35.39 143 17 LYS A 115 ? ? -96.23 33.50 144 17 ASP A 118 ? ? -117.78 -161.91 145 17 GLU A 137 ? ? -91.54 -67.23 146 18 PHE A 64 ? ? -164.72 86.00 147 18 GLN A 71 ? ? -74.93 -81.44 148 18 PHE A 72 ? ? -89.82 37.11 149 18 LYS A 115 ? ? -82.88 36.02 150 18 ASP A 118 ? ? -127.41 -161.32 151 18 TYR A 129 ? ? -179.14 102.42 152 19 ILE A 7 ? ? 24.98 91.57 153 19 ASP A 54 ? ? -108.08 -156.44 154 19 GLN A 71 ? ? -25.46 -67.75 155 19 CYS A 126 ? ? -56.74 109.14 156 19 GLU A 137 ? ? -123.38 -78.99 157 20 PRO A 8 ? ? -94.52 -159.66 158 20 ASN A 49 ? ? 70.80 -22.67 159 20 GLU A 50 ? ? 82.34 -22.70 160 20 VAL A 88 ? ? -162.00 118.89 161 20 ILE A 100 ? ? -119.99 76.71 162 20 THR A 106 ? ? -153.99 -55.47 163 20 GLU A 137 ? ? -92.11 -70.65 164 20 ARG A 139 ? ? -114.58 66.33 165 20 LYS A 140 ? ? -69.53 96.86 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MLM _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0156 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0013 _pdbx_nmr_ensemble_rms.entry_id 2MLM _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MLM _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents ;1.6 mM [U-100% 13C; U-100% 15N] sortase A-1, 2.4 mM N-(adamantan-1-yl)-2-(3-oxo-2,3-dihydro-1,2-benzothiazol-2-yl)-acetamide-2, 5.0 % [U-100% 2H] D2O-3, 2.4 % [U-100% 2H] DMSO-4, 20 mM [U-100% 2H] sodium acetate-5, 50 mM sodium chloride-6, 10 mM calcium chloride-7, 95% H2O/5% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'sortase A-1' 1.6 ? mM '[U-100% 13C; U-100% 15N]' 1 'N-(adamantan-1-yl)-2-(3-oxo-2,3-dihydro-1,2-benzothiazol-2-yl)-acetamide-2' 2.4 ? mM ? 1 D2O-3 5.0 ? % '[U-100% 2H]' 1 DMSO-4 2.4 ? % '[U-100% 2H]' 1 'sodium acetate-5' 20 ? mM '[U-100% 2H]' 1 'sodium chloride-6' 50 ? mM ? 1 'calcium chloride-7' 10 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCA' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '3D 1H-13C NOESY aliphatic' 1 6 1 '3D 1H-13C NOESY aromatic' 1 7 1 '3D (F1)-15N,13C-filtered 1H-13C NOESY aliphatic' 1 8 1 '2D (F1,F2)-13C,15N-filtered NOESY' 1 9 1 '2D (F1,F2)-13C,15N-filtered TOCSY' # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MLM _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1670 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 570 _pdbx_nmr_constraints.NOE_long_range_total_count 482 _pdbx_nmr_constraints.NOE_medium_range_total_count 156 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 462 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # _pdbx_nmr_refine.entry_id 2MLM _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 1.2 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.1 2 'Guntert, Mumenthaler and Wuthrich' 'data analysis' CYANA 2.1 3 'Bruker Biospin' processing TopSpin 3.2 4 Varian collection VnmrJ 2.1b 5 'R. Keller' 'chemical shift assignment' CARA 1.9.0 6 'T. Herrmann, F. Fiorito, J. Volk' 'structure solution' UNIO 2.0.2 7 'T. Herrmann, F. Fiorito, J. Volk' 'peak picking' UNIO 2.0.2 8 'T. Herrmann, F. Fiorito, J. Volk' 'data analysis' UNIO 2.0.2 9 'Guntert, Mumenthaler and Wuthrich' refinement CYANA 2.1 10 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal 2W7 S2 S N N 1 2W7 C5 C Y N 2 2W7 C6 C Y N 3 2W7 C10 C Y N 4 2W7 C7 C Y N 5 2W7 C8 C Y N 6 2W7 C9 C Y N 7 2W7 C11 C N N 8 2W7 O2 O N N 9 2W7 N3 N N N 10 2W7 C12 C N N 11 2W7 C13 C N N 12 2W7 O3 O N N 13 2W7 N4 N N N 14 2W7 C14 C N N 15 2W7 C18 C N N 16 2W7 C17 C N N 17 2W7 C19 C N N 18 2W7 C23 C N N 19 2W7 C24 C N N 20 2W7 C25 C N N 21 2W7 C20 C N N 22 2W7 C26 C N N 23 2W7 C16 C N N 24 2W7 H1 H N N 25 2W7 H6 H N N 26 2W7 H7 H N N 27 2W7 H8 H N N 28 2W7 H9 H N N 29 2W7 H3 H N N 30 2W7 H122 H N N 31 2W7 H121 H N N 32 2W7 H4 H N N 33 2W7 HZ12 H N N 34 2W7 HZ11 H N N 35 2W7 HY1 H N N 36 2W7 HX22 H N N 37 2W7 HX21 H N N 38 2W7 HY3 H N N 39 2W7 HZ21 H N N 40 2W7 HZ22 H N N 41 2W7 HX31 H N N 42 2W7 HX32 H N N 43 2W7 HY2 H N N 44 2W7 HZ32 H N N 45 2W7 HZ31 H N N 46 2W7 HX12 H N N 47 2W7 HX11 H N N 48 ALA N N N N 49 ALA CA C N S 50 ALA C C N N 51 ALA O O N N 52 ALA CB C N N 53 ALA OXT O N N 54 ALA H H N N 55 ALA H2 H N N 56 ALA HA H N N 57 ALA HB1 H N N 58 ALA HB2 H N N 59 ALA HB3 H N N 60 ALA HXT H N N 61 ARG N N N N 62 ARG CA C N S 63 ARG C C N N 64 ARG O O N N 65 ARG CB C N N 66 ARG CG C N N 67 ARG CD C N N 68 ARG NE N N N 69 ARG CZ C N N 70 ARG NH1 N N N 71 ARG NH2 N N N 72 ARG OXT O N N 73 ARG H H N N 74 ARG H2 H N N 75 ARG HA H N N 76 ARG HB2 H N N 77 ARG HB3 H N N 78 ARG HG2 H N N 79 ARG HG3 H N N 80 ARG HD2 H N N 81 ARG HD3 H N N 82 ARG HE H N N 83 ARG HH11 H N N 84 ARG HH12 H N N 85 ARG HH21 H N N 86 ARG HH22 H N N 87 ARG HXT H N N 88 ASN N N N N 89 ASN CA C N S 90 ASN C C N N 91 ASN O O N N 92 ASN CB C N N 93 ASN CG C N N 94 ASN OD1 O N N 95 ASN ND2 N N N 96 ASN OXT O N N 97 ASN H H N N 98 ASN H2 H N N 99 ASN HA H N N 100 ASN HB2 H N N 101 ASN HB3 H N N 102 ASN HD21 H N N 103 ASN HD22 H N N 104 ASN HXT H N N 105 ASP N N N N 106 ASP CA C N S 107 ASP C C N N 108 ASP O O N N 109 ASP CB C N N 110 ASP CG C N N 111 ASP OD1 O N N 112 ASP OD2 O N N 113 ASP OXT O N N 114 ASP H H N N 115 ASP H2 H N N 116 ASP HA H N N 117 ASP HB2 H N N 118 ASP HB3 H N N 119 ASP HD2 H N N 120 ASP HXT H N N 121 CYS N N N N 122 CYS CA C N R 123 CYS C C N N 124 CYS O O N N 125 CYS CB C N N 126 CYS SG S N N 127 CYS OXT O N N 128 CYS H H N N 129 CYS H2 H N N 130 CYS HA H N N 131 CYS HB2 H N N 132 CYS HB3 H N N 133 CYS HG H N N 134 CYS HXT H N N 135 GLN N N N N 136 GLN CA C N S 137 GLN C C N N 138 GLN O O N N 139 GLN CB C N N 140 GLN CG C N N 141 GLN CD C N N 142 GLN OE1 O N N 143 GLN NE2 N N N 144 GLN OXT O N N 145 GLN H H N N 146 GLN H2 H N N 147 GLN HA H N N 148 GLN HB2 H N N 149 GLN HB3 H N N 150 GLN HG2 H N N 151 GLN HG3 H N N 152 GLN HE21 H N N 153 GLN HE22 H N N 154 GLN HXT H N N 155 GLU N N N N 156 GLU CA C N S 157 GLU C C N N 158 GLU O O N N 159 GLU CB C N N 160 GLU CG C N N 161 GLU CD C N N 162 GLU OE1 O N N 163 GLU OE2 O N N 164 GLU OXT O N N 165 GLU H H N N 166 GLU H2 H N N 167 GLU HA H N N 168 GLU HB2 H N N 169 GLU HB3 H N N 170 GLU HG2 H N N 171 GLU HG3 H N N 172 GLU HE2 H N N 173 GLU HXT H N N 174 GLY N N N N 175 GLY CA C N N 176 GLY C C N N 177 GLY O O N N 178 GLY OXT O N N 179 GLY H H N N 180 GLY H2 H N N 181 GLY HA2 H N N 182 GLY HA3 H N N 183 GLY HXT H N N 184 HIS N N N N 185 HIS CA C N S 186 HIS C C N N 187 HIS O O N N 188 HIS CB C N N 189 HIS CG C Y N 190 HIS ND1 N Y N 191 HIS CD2 C Y N 192 HIS CE1 C Y N 193 HIS NE2 N Y N 194 HIS OXT O N N 195 HIS H H N N 196 HIS H2 H N N 197 HIS HA H N N 198 HIS HB2 H N N 199 HIS HB3 H N N 200 HIS HD1 H N N 201 HIS HD2 H N N 202 HIS HE1 H N N 203 HIS HE2 H N N 204 HIS HXT H N N 205 ILE N N N N 206 ILE CA C N S 207 ILE C C N N 208 ILE O O N N 209 ILE CB C N S 210 ILE CG1 C N N 211 ILE CG2 C N N 212 ILE CD1 C N N 213 ILE OXT O N N 214 ILE H H N N 215 ILE H2 H N N 216 ILE HA H N N 217 ILE HB H N N 218 ILE HG12 H N N 219 ILE HG13 H N N 220 ILE HG21 H N N 221 ILE HG22 H N N 222 ILE HG23 H N N 223 ILE HD11 H N N 224 ILE HD12 H N N 225 ILE HD13 H N N 226 ILE HXT H N N 227 LEU N N N N 228 LEU CA C N S 229 LEU C C N N 230 LEU O O N N 231 LEU CB C N N 232 LEU CG C N N 233 LEU CD1 C N N 234 LEU CD2 C N N 235 LEU OXT O N N 236 LEU H H N N 237 LEU H2 H N N 238 LEU HA H N N 239 LEU HB2 H N N 240 LEU HB3 H N N 241 LEU HG H N N 242 LEU HD11 H N N 243 LEU HD12 H N N 244 LEU HD13 H N N 245 LEU HD21 H N N 246 LEU HD22 H N N 247 LEU HD23 H N N 248 LEU HXT H N N 249 LYS N N N N 250 LYS CA C N S 251 LYS C C N N 252 LYS O O N N 253 LYS CB C N N 254 LYS CG C N N 255 LYS CD C N N 256 LYS CE C N N 257 LYS NZ N N N 258 LYS OXT O N N 259 LYS H H N N 260 LYS H2 H N N 261 LYS HA H N N 262 LYS HB2 H N N 263 LYS HB3 H N N 264 LYS HG2 H N N 265 LYS HG3 H N N 266 LYS HD2 H N N 267 LYS HD3 H N N 268 LYS HE2 H N N 269 LYS HE3 H N N 270 LYS HZ1 H N N 271 LYS HZ2 H N N 272 LYS HZ3 H N N 273 LYS HXT H N N 274 MET N N N N 275 MET CA C N S 276 MET C C N N 277 MET O O N N 278 MET CB C N N 279 MET CG C N N 280 MET SD S N N 281 MET CE C N N 282 MET OXT O N N 283 MET H H N N 284 MET H2 H N N 285 MET HA H N N 286 MET HB2 H N N 287 MET HB3 H N N 288 MET HG2 H N N 289 MET HG3 H N N 290 MET HE1 H N N 291 MET HE2 H N N 292 MET HE3 H N N 293 MET HXT H N N 294 PHE N N N N 295 PHE CA C N S 296 PHE C C N N 297 PHE O O N N 298 PHE CB C N N 299 PHE CG C Y N 300 PHE CD1 C Y N 301 PHE CD2 C Y N 302 PHE CE1 C Y N 303 PHE CE2 C Y N 304 PHE CZ C Y N 305 PHE OXT O N N 306 PHE H H N N 307 PHE H2 H N N 308 PHE HA H N N 309 PHE HB2 H N N 310 PHE HB3 H N N 311 PHE HD1 H N N 312 PHE HD2 H N N 313 PHE HE1 H N N 314 PHE HE2 H N N 315 PHE HZ H N N 316 PHE HXT H N N 317 PRO N N N N 318 PRO CA C N S 319 PRO C C N N 320 PRO O O N N 321 PRO CB C N N 322 PRO CG C N N 323 PRO CD C N N 324 PRO OXT O N N 325 PRO H H N N 326 PRO HA H N N 327 PRO HB2 H N N 328 PRO HB3 H N N 329 PRO HG2 H N N 330 PRO HG3 H N N 331 PRO HD2 H N N 332 PRO HD3 H N N 333 PRO HXT H N N 334 SER N N N N 335 SER CA C N S 336 SER C C N N 337 SER O O N N 338 SER CB C N N 339 SER OG O N N 340 SER OXT O N N 341 SER H H N N 342 SER H2 H N N 343 SER HA H N N 344 SER HB2 H N N 345 SER HB3 H N N 346 SER HG H N N 347 SER HXT H N N 348 THR N N N N 349 THR CA C N S 350 THR C C N N 351 THR O O N N 352 THR CB C N R 353 THR OG1 O N N 354 THR CG2 C N N 355 THR OXT O N N 356 THR H H N N 357 THR H2 H N N 358 THR HA H N N 359 THR HB H N N 360 THR HG1 H N N 361 THR HG21 H N N 362 THR HG22 H N N 363 THR HG23 H N N 364 THR HXT H N N 365 TRP N N N N 366 TRP CA C N S 367 TRP C C N N 368 TRP O O N N 369 TRP CB C N N 370 TRP CG C Y N 371 TRP CD1 C Y N 372 TRP CD2 C Y N 373 TRP NE1 N Y N 374 TRP CE2 C Y N 375 TRP CE3 C Y N 376 TRP CZ2 C Y N 377 TRP CZ3 C Y N 378 TRP CH2 C Y N 379 TRP OXT O N N 380 TRP H H N N 381 TRP H2 H N N 382 TRP HA H N N 383 TRP HB2 H N N 384 TRP HB3 H N N 385 TRP HD1 H N N 386 TRP HE1 H N N 387 TRP HE3 H N N 388 TRP HZ2 H N N 389 TRP HZ3 H N N 390 TRP HH2 H N N 391 TRP HXT H N N 392 TYR N N N N 393 TYR CA C N S 394 TYR C C N N 395 TYR O O N N 396 TYR CB C N N 397 TYR CG C Y N 398 TYR CD1 C Y N 399 TYR CD2 C Y N 400 TYR CE1 C Y N 401 TYR CE2 C Y N 402 TYR CZ C Y N 403 TYR OH O N N 404 TYR OXT O N N 405 TYR H H N N 406 TYR H2 H N N 407 TYR HA H N N 408 TYR HB2 H N N 409 TYR HB3 H N N 410 TYR HD1 H N N 411 TYR HD2 H N N 412 TYR HE1 H N N 413 TYR HE2 H N N 414 TYR HH H N N 415 TYR HXT H N N 416 VAL N N N N 417 VAL CA C N S 418 VAL C C N N 419 VAL O O N N 420 VAL CB C N N 421 VAL CG1 C N N 422 VAL CG2 C N N 423 VAL OXT O N N 424 VAL H H N N 425 VAL H2 H N N 426 VAL HA H N N 427 VAL HB H N N 428 VAL HG11 H N N 429 VAL HG12 H N N 430 VAL HG13 H N N 431 VAL HG21 H N N 432 VAL HG22 H N N 433 VAL HG23 H N N 434 VAL HXT H N N 435 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal 2W7 C19 C23 sing N N 1 2W7 C19 C17 sing N N 2 2W7 C23 C25 sing N N 3 2W7 C23 C24 sing N N 4 2W7 C25 C20 sing N N 5 2W7 C24 C14 sing N N 6 2W7 C17 C16 sing N N 7 2W7 C17 C18 sing N N 8 2W7 C16 C20 sing N N 9 2W7 C20 C26 sing N N 10 2W7 O3 C13 doub N N 11 2W7 C18 C14 sing N N 12 2W7 C14 C26 sing N N 13 2W7 C14 N4 sing N N 14 2W7 C13 N4 sing N N 15 2W7 C13 C12 sing N N 16 2W7 C12 N3 sing N N 17 2W7 N3 C11 sing N N 18 2W7 C9 C8 doub Y N 19 2W7 C9 C10 sing Y N 20 2W7 C8 C7 sing Y N 21 2W7 C11 C10 sing N N 22 2W7 C11 O2 doub N N 23 2W7 C10 C5 doub Y N 24 2W7 C7 C6 doub Y N 25 2W7 C5 C6 sing Y N 26 2W7 C5 S2 sing N N 27 2W7 S2 H1 sing N N 28 2W7 C6 H6 sing N N 29 2W7 C7 H7 sing N N 30 2W7 C8 H8 sing N N 31 2W7 C9 H9 sing N N 32 2W7 N3 H3 sing N N 33 2W7 C12 H122 sing N N 34 2W7 C12 H121 sing N N 35 2W7 N4 H4 sing N N 36 2W7 C18 HZ12 sing N N 37 2W7 C18 HZ11 sing N N 38 2W7 C17 HY1 sing N N 39 2W7 C19 HX22 sing N N 40 2W7 C19 HX21 sing N N 41 2W7 C23 HY3 sing N N 42 2W7 C24 HZ21 sing N N 43 2W7 C24 HZ22 sing N N 44 2W7 C25 HX31 sing N N 45 2W7 C25 HX32 sing N N 46 2W7 C20 HY2 sing N N 47 2W7 C26 HZ32 sing N N 48 2W7 C26 HZ31 sing N N 49 2W7 C16 HX12 sing N N 50 2W7 C16 HX11 sing N N 51 ALA N CA sing N N 52 ALA N H sing N N 53 ALA N H2 sing N N 54 ALA CA C sing N N 55 ALA CA CB sing N N 56 ALA CA HA sing N N 57 ALA C O doub N N 58 ALA C OXT sing N N 59 ALA CB HB1 sing N N 60 ALA CB HB2 sing N N 61 ALA CB HB3 sing N N 62 ALA OXT HXT sing N N 63 ARG N CA sing N N 64 ARG N H sing N N 65 ARG N H2 sing N N 66 ARG CA C sing N N 67 ARG CA CB sing N N 68 ARG CA HA sing N N 69 ARG C O doub N N 70 ARG C OXT sing N N 71 ARG CB CG sing N N 72 ARG CB HB2 sing N N 73 ARG CB HB3 sing N N 74 ARG CG CD sing N N 75 ARG CG HG2 sing N N 76 ARG CG HG3 sing N N 77 ARG CD NE sing N N 78 ARG CD HD2 sing N N 79 ARG CD HD3 sing N N 80 ARG NE CZ sing N N 81 ARG NE HE sing N N 82 ARG CZ NH1 sing N N 83 ARG CZ NH2 doub N N 84 ARG NH1 HH11 sing N N 85 ARG NH1 HH12 sing N N 86 ARG NH2 HH21 sing N N 87 ARG NH2 HH22 sing N N 88 ARG OXT HXT sing N N 89 ASN N CA sing N N 90 ASN N H sing N N 91 ASN N H2 sing N N 92 ASN CA C sing N N 93 ASN CA CB sing N N 94 ASN CA HA sing N N 95 ASN C O doub N N 96 ASN C OXT sing N N 97 ASN CB CG sing N N 98 ASN CB HB2 sing N N 99 ASN CB HB3 sing N N 100 ASN CG OD1 doub N N 101 ASN CG ND2 sing N N 102 ASN ND2 HD21 sing N N 103 ASN ND2 HD22 sing N N 104 ASN OXT HXT sing N N 105 ASP N CA sing N N 106 ASP N H sing N N 107 ASP N H2 sing N N 108 ASP CA C sing N N 109 ASP CA CB sing N N 110 ASP CA HA sing N N 111 ASP C O doub N N 112 ASP C OXT sing N N 113 ASP CB CG sing N N 114 ASP CB HB2 sing N N 115 ASP CB HB3 sing N N 116 ASP CG OD1 doub N N 117 ASP CG OD2 sing N N 118 ASP OD2 HD2 sing N N 119 ASP OXT HXT sing N N 120 CYS N CA sing N N 121 CYS N H sing N N 122 CYS N H2 sing N N 123 CYS CA C sing N N 124 CYS CA CB sing N N 125 CYS CA HA sing N N 126 CYS C O doub N N 127 CYS C OXT sing N N 128 CYS CB SG sing N N 129 CYS CB HB2 sing N N 130 CYS CB HB3 sing N N 131 CYS SG HG sing N N 132 CYS OXT HXT sing N N 133 GLN N CA sing N N 134 GLN N H sing N N 135 GLN N H2 sing N N 136 GLN CA C sing N N 137 GLN CA CB sing N N 138 GLN CA HA sing N N 139 GLN C O doub N N 140 GLN C OXT sing N N 141 GLN CB CG sing N N 142 GLN CB HB2 sing N N 143 GLN CB HB3 sing N N 144 GLN CG CD sing N N 145 GLN CG HG2 sing N N 146 GLN CG HG3 sing N N 147 GLN CD OE1 doub N N 148 GLN CD NE2 sing N N 149 GLN NE2 HE21 sing N N 150 GLN NE2 HE22 sing N N 151 GLN OXT HXT sing N N 152 GLU N CA sing N N 153 GLU N H sing N N 154 GLU N H2 sing N N 155 GLU CA C sing N N 156 GLU CA CB sing N N 157 GLU CA HA sing N N 158 GLU C O doub N N 159 GLU C OXT sing N N 160 GLU CB CG sing N N 161 GLU CB HB2 sing N N 162 GLU CB HB3 sing N N 163 GLU CG CD sing N N 164 GLU CG HG2 sing N N 165 GLU CG HG3 sing N N 166 GLU CD OE1 doub N N 167 GLU CD OE2 sing N N 168 GLU OE2 HE2 sing N N 169 GLU OXT HXT sing N N 170 GLY N CA sing N N 171 GLY N H sing N N 172 GLY N H2 sing N N 173 GLY CA C sing N N 174 GLY CA HA2 sing N N 175 GLY CA HA3 sing N N 176 GLY C O doub N N 177 GLY C OXT sing N N 178 GLY OXT HXT sing N N 179 HIS N CA sing N N 180 HIS N H sing N N 181 HIS N H2 sing N N 182 HIS CA C sing N N 183 HIS CA CB sing N N 184 HIS CA HA sing N N 185 HIS C O doub N N 186 HIS C OXT sing N N 187 HIS CB CG sing N N 188 HIS CB HB2 sing N N 189 HIS CB HB3 sing N N 190 HIS CG ND1 sing Y N 191 HIS CG CD2 doub Y N 192 HIS ND1 CE1 doub Y N 193 HIS ND1 HD1 sing N N 194 HIS CD2 NE2 sing Y N 195 HIS CD2 HD2 sing N N 196 HIS CE1 NE2 sing Y N 197 HIS CE1 HE1 sing N N 198 HIS NE2 HE2 sing N N 199 HIS OXT HXT sing N N 200 ILE N CA sing N N 201 ILE N H sing N N 202 ILE N H2 sing N N 203 ILE CA C sing N N 204 ILE CA CB sing N N 205 ILE CA HA sing N N 206 ILE C O doub N N 207 ILE C OXT sing N N 208 ILE CB CG1 sing N N 209 ILE CB CG2 sing N N 210 ILE CB HB sing N N 211 ILE CG1 CD1 sing N N 212 ILE CG1 HG12 sing N N 213 ILE CG1 HG13 sing N N 214 ILE CG2 HG21 sing N N 215 ILE CG2 HG22 sing N N 216 ILE CG2 HG23 sing N N 217 ILE CD1 HD11 sing N N 218 ILE CD1 HD12 sing N N 219 ILE CD1 HD13 sing N N 220 ILE OXT HXT sing N N 221 LEU N CA sing N N 222 LEU N H sing N N 223 LEU N H2 sing N N 224 LEU CA C sing N N 225 LEU CA CB sing N N 226 LEU CA HA sing N N 227 LEU C O doub N N 228 LEU C OXT sing N N 229 LEU CB CG sing N N 230 LEU CB HB2 sing N N 231 LEU CB HB3 sing N N 232 LEU CG CD1 sing N N 233 LEU CG CD2 sing N N 234 LEU CG HG sing N N 235 LEU CD1 HD11 sing N N 236 LEU CD1 HD12 sing N N 237 LEU CD1 HD13 sing N N 238 LEU CD2 HD21 sing N N 239 LEU CD2 HD22 sing N N 240 LEU CD2 HD23 sing N N 241 LEU OXT HXT sing N N 242 LYS N CA sing N N 243 LYS N H sing N N 244 LYS N H2 sing N N 245 LYS CA C sing N N 246 LYS CA CB sing N N 247 LYS CA HA sing N N 248 LYS C O doub N N 249 LYS C OXT sing N N 250 LYS CB CG sing N N 251 LYS CB HB2 sing N N 252 LYS CB HB3 sing N N 253 LYS CG CD sing N N 254 LYS CG HG2 sing N N 255 LYS CG HG3 sing N N 256 LYS CD CE sing N N 257 LYS CD HD2 sing N N 258 LYS CD HD3 sing N N 259 LYS CE NZ sing N N 260 LYS CE HE2 sing N N 261 LYS CE HE3 sing N N 262 LYS NZ HZ1 sing N N 263 LYS NZ HZ2 sing N N 264 LYS NZ HZ3 sing N N 265 LYS OXT HXT sing N N 266 MET N CA sing N N 267 MET N H sing N N 268 MET N H2 sing N N 269 MET CA C sing N N 270 MET CA CB sing N N 271 MET CA HA sing N N 272 MET C O doub N N 273 MET C OXT sing N N 274 MET CB CG sing N N 275 MET CB HB2 sing N N 276 MET CB HB3 sing N N 277 MET CG SD sing N N 278 MET CG HG2 sing N N 279 MET CG HG3 sing N N 280 MET SD CE sing N N 281 MET CE HE1 sing N N 282 MET CE HE2 sing N N 283 MET CE HE3 sing N N 284 MET OXT HXT sing N N 285 PHE N CA sing N N 286 PHE N H sing N N 287 PHE N H2 sing N N 288 PHE CA C sing N N 289 PHE CA CB sing N N 290 PHE CA HA sing N N 291 PHE C O doub N N 292 PHE C OXT sing N N 293 PHE CB CG sing N N 294 PHE CB HB2 sing N N 295 PHE CB HB3 sing N N 296 PHE CG CD1 doub Y N 297 PHE CG CD2 sing Y N 298 PHE CD1 CE1 sing Y N 299 PHE CD1 HD1 sing N N 300 PHE CD2 CE2 doub Y N 301 PHE CD2 HD2 sing N N 302 PHE CE1 CZ doub Y N 303 PHE CE1 HE1 sing N N 304 PHE CE2 CZ sing Y N 305 PHE CE2 HE2 sing N N 306 PHE CZ HZ sing N N 307 PHE OXT HXT sing N N 308 PRO N CA sing N N 309 PRO N CD sing N N 310 PRO N H sing N N 311 PRO CA C sing N N 312 PRO CA CB sing N N 313 PRO CA HA sing N N 314 PRO C O doub N N 315 PRO C OXT sing N N 316 PRO CB CG sing N N 317 PRO CB HB2 sing N N 318 PRO CB HB3 sing N N 319 PRO CG CD sing N N 320 PRO CG HG2 sing N N 321 PRO CG HG3 sing N N 322 PRO CD HD2 sing N N 323 PRO CD HD3 sing N N 324 PRO OXT HXT sing N N 325 SER N CA sing N N 326 SER N H sing N N 327 SER N H2 sing N N 328 SER CA C sing N N 329 SER CA CB sing N N 330 SER CA HA sing N N 331 SER C O doub N N 332 SER C OXT sing N N 333 SER CB OG sing N N 334 SER CB HB2 sing N N 335 SER CB HB3 sing N N 336 SER OG HG sing N N 337 SER OXT HXT sing N N 338 THR N CA sing N N 339 THR N H sing N N 340 THR N H2 sing N N 341 THR CA C sing N N 342 THR CA CB sing N N 343 THR CA HA sing N N 344 THR C O doub N N 345 THR C OXT sing N N 346 THR CB OG1 sing N N 347 THR CB CG2 sing N N 348 THR CB HB sing N N 349 THR OG1 HG1 sing N N 350 THR CG2 HG21 sing N N 351 THR CG2 HG22 sing N N 352 THR CG2 HG23 sing N N 353 THR OXT HXT sing N N 354 TRP N CA sing N N 355 TRP N H sing N N 356 TRP N H2 sing N N 357 TRP CA C sing N N 358 TRP CA CB sing N N 359 TRP CA HA sing N N 360 TRP C O doub N N 361 TRP C OXT sing N N 362 TRP CB CG sing N N 363 TRP CB HB2 sing N N 364 TRP CB HB3 sing N N 365 TRP CG CD1 doub Y N 366 TRP CG CD2 sing Y N 367 TRP CD1 NE1 sing Y N 368 TRP CD1 HD1 sing N N 369 TRP CD2 CE2 doub Y N 370 TRP CD2 CE3 sing Y N 371 TRP NE1 CE2 sing Y N 372 TRP NE1 HE1 sing N N 373 TRP CE2 CZ2 sing Y N 374 TRP CE3 CZ3 doub Y N 375 TRP CE3 HE3 sing N N 376 TRP CZ2 CH2 doub Y N 377 TRP CZ2 HZ2 sing N N 378 TRP CZ3 CH2 sing Y N 379 TRP CZ3 HZ3 sing N N 380 TRP CH2 HH2 sing N N 381 TRP OXT HXT sing N N 382 TYR N CA sing N N 383 TYR N H sing N N 384 TYR N H2 sing N N 385 TYR CA C sing N N 386 TYR CA CB sing N N 387 TYR CA HA sing N N 388 TYR C O doub N N 389 TYR C OXT sing N N 390 TYR CB CG sing N N 391 TYR CB HB2 sing N N 392 TYR CB HB3 sing N N 393 TYR CG CD1 doub Y N 394 TYR CG CD2 sing Y N 395 TYR CD1 CE1 sing Y N 396 TYR CD1 HD1 sing N N 397 TYR CD2 CE2 doub Y N 398 TYR CD2 HD2 sing N N 399 TYR CE1 CZ doub Y N 400 TYR CE1 HE1 sing N N 401 TYR CE2 CZ sing Y N 402 TYR CE2 HE2 sing N N 403 TYR CZ OH sing N N 404 TYR OH HH sing N N 405 TYR OXT HXT sing N N 406 VAL N CA sing N N 407 VAL N H sing N N 408 VAL N H2 sing N N 409 VAL CA C sing N N 410 VAL CA CB sing N N 411 VAL CA HA sing N N 412 VAL C O doub N N 413 VAL C OXT sing N N 414 VAL CB CG1 sing N N 415 VAL CB CG2 sing N N 416 VAL CB HB sing N N 417 VAL CG1 HG11 sing N N 418 VAL CG1 HG12 sing N N 419 VAL CG1 HG13 sing N N 420 VAL CG2 HG21 sing N N 421 VAL CG2 HG22 sing N N 422 VAL CG2 HG23 sing N N 423 VAL OXT HXT sing N N 424 # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _atom_sites.entry_id 2MLM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ #