data_2MQK # _entry.id 2MQK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MQK pdb_00002mqk 10.2210/pdb2mqk/pdb RCSB RCSB103932 ? ? BMRB 25037 ? ? WWPDB D_1000103932 ? ? # _pdbx_database_related.db_id 25037 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MQK _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2014-06-23 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lopez-Mendez, B.' 1 'Dramicanin, M.' 2 'Campos-Olivas, R.' 3 'Ramon-Maiques, S.' 4 # _citation.id primary _citation.title 'Solution structure of N terminal domain of the MuB AAA+ ATPase' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Dramicanin, M.' 1 ? primary 'Lopez-Mendez, B.' 2 ? primary 'Campos-Olivas, R.' 3 ? primary 'Ramon-Maiques, S.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'ATP-dependent target DNA activator B' _entity.formula_weight 7353.117 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 3.6.1.3 _entity.pdbx_mutation M53T _entity.pdbx_fragment 'N-terminal domain, UNP residues 1-63' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gene product B, gpB, MuB' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPMNISDIRAGLRTLVENEETTFKQIALESGLSTGTISSFINDKYNGDNERVSQTLQRWLEKYHA _entity_poly.pdbx_seq_one_letter_code_can GPMNISDIRAGLRTLVENEETTFKQIALESGLSTGTISSFINDKYNGDNERVSQTLQRWLEKYHA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 ASN n 1 5 ILE n 1 6 SER n 1 7 ASP n 1 8 ILE n 1 9 ARG n 1 10 ALA n 1 11 GLY n 1 12 LEU n 1 13 ARG n 1 14 THR n 1 15 LEU n 1 16 VAL n 1 17 GLU n 1 18 ASN n 1 19 GLU n 1 20 GLU n 1 21 THR n 1 22 THR n 1 23 PHE n 1 24 LYS n 1 25 GLN n 1 26 ILE n 1 27 ALA n 1 28 LEU n 1 29 GLU n 1 30 SER n 1 31 GLY n 1 32 LEU n 1 33 SER n 1 34 THR n 1 35 GLY n 1 36 THR n 1 37 ILE n 1 38 SER n 1 39 SER n 1 40 PHE n 1 41 ILE n 1 42 ASN n 1 43 ASP n 1 44 LYS n 1 45 TYR n 1 46 ASN n 1 47 GLY n 1 48 ASP n 1 49 ASN n 1 50 GLU n 1 51 ARG n 1 52 VAL n 1 53 SER n 1 54 GLN n 1 55 THR n 1 56 LEU n 1 57 GLN n 1 58 ARG n 1 59 TRP n 1 60 LEU n 1 61 GLU n 1 62 LYS n 1 63 TYR n 1 64 HIS n 1 65 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'B, Mup04' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Enterobacteria phage Mu' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10677 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pOPINB _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TARGB_BPMU _struct_ref.pdbx_db_accession P03763 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MNISDIRAGLRTLVENEETTFKQIALESGLSTGTISSFINDKYNGDNERVSQMLQRWLEKYHA _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MQK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 65 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03763 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 63 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 63 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MQK GLY A 1 ? UNP P03763 ? ? 'expression tag' -1 1 1 2MQK PRO A 2 ? UNP P03763 ? ? 'expression tag' 0 2 1 2MQK THR A 55 ? UNP P03763 MET 53 'engineered mutation' 53 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 2 '2D 1H-15N HSQC' 1 2 2 '3D 1H-15N NOESY' 1 3 2 '3D HNHA' 1 4 1 '2D 1H-1H TOCSY' 1 5 1 '2D 1H-1H NOESY' 1 6 1 '2D 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 100 _pdbx_nmr_exptl_sample_conditions.pH 7.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '500 uM MuB-NTD-1, 20 mM sodium phosphate-2, 100 mM sodium chloride-3, 93% H2O/7% D2O' 1 '93% H2O/7% D2O' '500 uM [U-98% 15N] MuB-NTD-4, 20 mM sodium phosphate-5, 100 mM sodium chloride-6, 93% H2O/7% D2O' 2 '93% H2O/7% D2O' # _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MQK _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MQK _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation 2 _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation 0.16 _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MQK _pdbx_nmr_representative.selection_criteria 'fewest violations' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 1 2.2.6 'Luginbuhl, Guntert, Billeter and Wuthrich' refinement OPAL 2 1.4 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe 3 ? CCPN 'data analysis' CCPN 4 2.3.1 CCPN 'chemical shift assignment' CCPN 5 2.3.1 CCPN 'peak picking' CCPN 6 2.3.1 'Bruker Biospin' collection TopSpin 7 2.1 'Bruker Biospin' processing TopSpin 8 2.1 'Cornilescu, Delaglio and Bax' 'backbone torsion angle restraint generation' TALOS+ 9 ? 'GUNTERT, MUMENTHALER AND WUTHRICH' refinement CYANA 10 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MQK _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MQK _struct.title 'Solution structure of N terminal domain of the MuB AAA+ ATPase' _struct.pdbx_model_details 'fewest violations, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MQK _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text HYDROLASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 4 ? ASN A 18 ? ASN A 2 ASN A 16 1 ? 15 HELX_P HELX_P2 2 THR A 22 ? GLY A 31 ? THR A 20 GLY A 29 1 ? 10 HELX_P HELX_P3 3 SER A 33 ? ASN A 42 ? SER A 31 ASN A 40 1 ? 10 HELX_P HELX_P4 4 ASP A 48 ? ALA A 65 ? ASP A 46 ALA A 63 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MQK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -1 -1 GLY GLY A . n A 1 2 PRO 2 0 0 PRO PRO A . n A 1 3 MET 3 1 1 MET MET A . n A 1 4 ASN 4 2 2 ASN ASN A . n A 1 5 ILE 5 3 3 ILE ILE A . n A 1 6 SER 6 4 4 SER SER A . n A 1 7 ASP 7 5 5 ASP ASP A . n A 1 8 ILE 8 6 6 ILE ILE A . n A 1 9 ARG 9 7 7 ARG ARG A . n A 1 10 ALA 10 8 8 ALA ALA A . n A 1 11 GLY 11 9 9 GLY GLY A . n A 1 12 LEU 12 10 10 LEU LEU A . n A 1 13 ARG 13 11 11 ARG ARG A . n A 1 14 THR 14 12 12 THR THR A . n A 1 15 LEU 15 13 13 LEU LEU A . n A 1 16 VAL 16 14 14 VAL VAL A . n A 1 17 GLU 17 15 15 GLU GLU A . n A 1 18 ASN 18 16 16 ASN ASN A . n A 1 19 GLU 19 17 17 GLU GLU A . n A 1 20 GLU 20 18 18 GLU GLU A . n A 1 21 THR 21 19 19 THR THR A . n A 1 22 THR 22 20 20 THR THR A . n A 1 23 PHE 23 21 21 PHE PHE A . n A 1 24 LYS 24 22 22 LYS LYS A . n A 1 25 GLN 25 23 23 GLN GLN A . n A 1 26 ILE 26 24 24 ILE ILE A . n A 1 27 ALA 27 25 25 ALA ALA A . n A 1 28 LEU 28 26 26 LEU LEU A . n A 1 29 GLU 29 27 27 GLU GLU A . n A 1 30 SER 30 28 28 SER SER A . n A 1 31 GLY 31 29 29 GLY GLY A . n A 1 32 LEU 32 30 30 LEU LEU A . n A 1 33 SER 33 31 31 SER SER A . n A 1 34 THR 34 32 32 THR THR A . n A 1 35 GLY 35 33 33 GLY GLY A . n A 1 36 THR 36 34 34 THR THR A . n A 1 37 ILE 37 35 35 ILE ILE A . n A 1 38 SER 38 36 36 SER SER A . n A 1 39 SER 39 37 37 SER SER A . n A 1 40 PHE 40 38 38 PHE PHE A . n A 1 41 ILE 41 39 39 ILE ILE A . n A 1 42 ASN 42 40 40 ASN ASN A . n A 1 43 ASP 43 41 41 ASP ASP A . n A 1 44 LYS 44 42 42 LYS LYS A . n A 1 45 TYR 45 43 43 TYR TYR A . n A 1 46 ASN 46 44 44 ASN ASN A . n A 1 47 GLY 47 45 45 GLY GLY A . n A 1 48 ASP 48 46 46 ASP ASP A . n A 1 49 ASN 49 47 47 ASN ASN A . n A 1 50 GLU 50 48 48 GLU GLU A . n A 1 51 ARG 51 49 49 ARG ARG A . n A 1 52 VAL 52 50 50 VAL VAL A . n A 1 53 SER 53 51 51 SER SER A . n A 1 54 GLN 54 52 52 GLN GLN A . n A 1 55 THR 55 53 53 THR THR A . n A 1 56 LEU 56 54 54 LEU LEU A . n A 1 57 GLN 57 55 55 GLN GLN A . n A 1 58 ARG 58 56 56 ARG ARG A . n A 1 59 TRP 59 57 57 TRP TRP A . n A 1 60 LEU 60 58 58 LEU LEU A . n A 1 61 GLU 61 59 59 GLU GLU A . n A 1 62 LYS 62 60 60 LYS LYS A . n A 1 63 TYR 63 61 61 TYR TYR A . n A 1 64 HIS 64 62 62 HIS HIS A . n A 1 65 ALA 65 63 63 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-07-01 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_nmr_ensemble_rms.atom_type ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev ? _pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.chain_range_begin ? _pdbx_nmr_ensemble_rms.chain_range_end ? _pdbx_nmr_ensemble_rms.coord_average_rmsd_method ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev ? _pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev ? _pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error ? _pdbx_nmr_ensemble_rms.distance_rms_dev 0.0105 _pdbx_nmr_ensemble_rms.distance_rms_dev_error 0.0004 _pdbx_nmr_ensemble_rms.entry_id 2MQK _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev ? _pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev ? _pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error ? _pdbx_nmr_ensemble_rms.residue_range_begin ? _pdbx_nmr_ensemble_rms.residue_range_end ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id MuB-NTD-1 500 ? uM ? 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 MuB-NTD-4 500 ? uM '[U-98% 15N]' 2 'sodium phosphate-5' 20 ? mM ? 2 'sodium chloride-6' 100 ? mM ? 2 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MQK _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1518 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 356 _pdbx_nmr_constraints.NOE_long_range_total_count 432 _pdbx_nmr_constraints.NOE_medium_range_total_count 390 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 340 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 46 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 46 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 2 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH2 A ARG 7 ? ? 117.05 120.30 -3.25 0.50 N 2 4 NE A ARG 7 ? ? CZ A ARG 7 ? ? NH2 A ARG 7 ? ? 116.94 120.30 -3.36 0.50 N 3 13 NE A ARG 49 ? ? CZ A ARG 49 ? ? NH2 A ARG 49 ? ? 117.19 120.30 -3.11 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 17 ? ? 59.65 17.79 2 2 PRO A 0 ? ? -67.05 98.49 3 5 GLU A 17 ? ? 59.72 18.60 4 6 THR A 19 ? ? -173.86 -171.21 5 10 GLU A 17 ? ? 47.30 29.68 6 10 ASP A 41 ? ? 67.06 -1.64 7 11 PRO A 0 ? ? -53.53 108.96 8 11 ASP A 41 ? ? 58.67 19.88 9 11 ASP A 46 ? ? 107.22 17.63 10 12 THR A 19 ? ? -171.28 -168.21 11 13 ASN A 44 ? ? -60.78 -75.21 12 14 GLU A 17 ? ? 59.47 19.95 13 14 TYR A 43 ? ? -65.96 91.07 14 16 ASN A 44 ? ? -72.46 -169.98 15 18 GLU A 17 ? ? 57.66 15.06 16 19 PRO A 0 ? ? -65.97 94.02 17 19 GLU A 17 ? ? 56.85 13.79 18 19 ASN A 44 ? ? -153.13 75.58 19 19 ASP A 46 ? ? 76.87 58.40 20 20 GLU A 17 ? ? 56.38 18.57 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 4 ARG A 56 ? ? 0.089 'SIDE CHAIN' 2 6 TYR A 43 ? ? 0.087 'SIDE CHAIN' 3 7 ARG A 49 ? ? 0.102 'SIDE CHAIN' 4 9 ARG A 49 ? ? 0.118 'SIDE CHAIN' 5 11 TYR A 43 ? ? 0.091 'SIDE CHAIN' 6 11 ARG A 49 ? ? 0.079 'SIDE CHAIN' 7 14 ARG A 11 ? ? 0.082 'SIDE CHAIN' 8 18 ARG A 49 ? ? 0.078 'SIDE CHAIN' #