data_2MRY
# 
_entry.id   2MRY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2MRY         pdb_00002mry 10.2210/pdb2mry/pdb 
RCSB  RCSB103980   ?            ?                   
BMRB  25098        ?            10.13018/BMR25098   
WWPDB D_1000103980 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-07-29 
2 'Structure model' 1 1 2017-07-12 
3 'Structure model' 1 2 2023-06-14 
4 'Structure model' 1 3 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
4 3 'Structure model' Other                 
5 4 'Structure model' 'Data collection'     
6 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation             
2 2 'Structure model' citation_author      
3 3 'Structure model' database_2           
4 3 'Structure model' pdbx_database_status 
5 3 'Structure model' pdbx_nmr_software    
6 3 'Structure model' struct_ref_seq_dif   
7 4 'Structure model' chem_comp_atom       
8 4 'Structure model' chem_comp_bond       
9 4 'Structure model' database_2           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                          
2  2 'Structure model' '_citation.journal_abbrev'                   
3  2 'Structure model' '_citation.journal_id_CSD'                   
4  2 'Structure model' '_citation.journal_id_ISSN'                  
5  2 'Structure model' '_citation.journal_volume'                   
6  2 'Structure model' '_citation.page_first'                       
7  2 'Structure model' '_citation.page_last'                        
8  2 'Structure model' '_citation.pdbx_database_id_DOI'             
9  2 'Structure model' '_citation.pdbx_database_id_PubMed'          
10 2 'Structure model' '_citation.title'                            
11 2 'Structure model' '_citation.year'                             
12 2 'Structure model' '_citation_author.name'                      
13 3 'Structure model' '_database_2.pdbx_DOI'                       
14 3 'Structure model' '_database_2.pdbx_database_accession'        
15 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
16 3 'Structure model' '_pdbx_nmr_software.name'                    
17 3 'Structure model' '_struct_ref_seq_dif.details'                
18 4 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2MRY 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-17 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.db_id          25098 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fu, Y.'      1 
'Wu, H.'      2 
'Bruce, K.'   3 
'Giedroc, D.' 4 
# 
_citation.id                        primary 
_citation.title                     
'The S2 Cu(i) site in CupA from Streptococcus pneumoniae is required for cellular copper resistance.' 
_citation.journal_abbrev            Metallomics 
_citation.journal_volume            8 
_citation.page_first                61 
_citation.page_last                 70 
_citation.year                      2016 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           1756-591X 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26346139 
_citation.pdbx_database_id_DOI      10.1039/c5mt00221d 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fu, Y.'        1 ? 
primary 'Bruce, K.E.'   2 ? 
primary 'Wu, H.'        3 ? 
primary 'Giedroc, D.P.' 4 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Uncharacterized protein' 
_entity.formula_weight             10887.588 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAG
EFSFACGMNMMHGKMIVE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAG
EFSFACGMNMMHGKMIVE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  ALA n 
1 3  MET n 
1 4  GLY n 
1 5  GLN n 
1 6  LYS n 
1 7  ALA n 
1 8  GLN n 
1 9  GLN n 
1 10 LYS n 
1 11 ASN n 
1 12 GLY n 
1 13 TYR n 
1 14 GLN n 
1 15 GLU n 
1 16 ILE n 
1 17 ARG n 
1 18 VAL n 
1 19 GLU n 
1 20 VAL n 
1 21 MET n 
1 22 GLY n 
1 23 GLY n 
1 24 TYR n 
1 25 THR n 
1 26 PRO n 
1 27 GLU n 
1 28 LEU n 
1 29 ILE n 
1 30 VAL n 
1 31 LEU n 
1 32 LYS n 
1 33 LYS n 
1 34 SER n 
1 35 VAL n 
1 36 PRO n 
1 37 ALA n 
1 38 ARG n 
1 39 ILE n 
1 40 VAL n 
1 41 PHE n 
1 42 ASP n 
1 43 ARG n 
1 44 LYS n 
1 45 ASP n 
1 46 PRO n 
1 47 SER n 
1 48 PRO n 
1 49 CYS n 
1 50 LEU n 
1 51 ASP n 
1 52 GLN n 
1 53 ILE n 
1 54 VAL n 
1 55 PHE n 
1 56 PRO n 
1 57 ASP n 
1 58 PHE n 
1 59 GLY n 
1 60 VAL n 
1 61 HIS n 
1 62 ALA n 
1 63 ASN n 
1 64 LEU n 
1 65 PRO n 
1 66 MET n 
1 67 GLY n 
1 68 GLU n 
1 69 GLU n 
1 70 TYR n 
1 71 VAL n 
1 72 VAL n 
1 73 GLU n 
1 74 ILE n 
1 75 THR n 
1 76 PRO n 
1 77 GLU n 
1 78 GLN n 
1 79 ALA n 
1 80 GLY n 
1 81 GLU n 
1 82 PHE n 
1 83 SER n 
1 84 PHE n 
1 85 ALA n 
1 86 CYS n 
1 87 GLY n 
1 88 MET n 
1 89 ASN n 
1 90 MET n 
1 91 MET n 
1 92 HIS n 
1 93 GLY n 
1 94 LYS n 
1 95 MET n 
1 96 ILE n 
1 97 VAL n 
1 98 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'spd0634, SPD_0634' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    D39 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptococcus pneumoniae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     373153 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pHis 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  26  26  GLY GLY A . n 
A 1 2  ALA 2  27  27  ALA ALA A . n 
A 1 3  MET 3  28  28  MET MET A . n 
A 1 4  GLY 4  29  29  GLY GLY A . n 
A 1 5  GLN 5  30  30  GLN GLN A . n 
A 1 6  LYS 6  31  31  LYS LYS A . n 
A 1 7  ALA 7  32  32  ALA ALA A . n 
A 1 8  GLN 8  33  33  GLN GLN A . n 
A 1 9  GLN 9  34  34  GLN GLN A . n 
A 1 10 LYS 10 35  35  LYS LYS A . n 
A 1 11 ASN 11 36  36  ASN ASN A . n 
A 1 12 GLY 12 37  37  GLY GLY A . n 
A 1 13 TYR 13 38  38  TYR TYR A . n 
A 1 14 GLN 14 39  39  GLN GLN A . n 
A 1 15 GLU 15 40  40  GLU GLU A . n 
A 1 16 ILE 16 41  41  ILE ILE A . n 
A 1 17 ARG 17 42  42  ARG ARG A . n 
A 1 18 VAL 18 43  43  VAL VAL A . n 
A 1 19 GLU 19 44  44  GLU GLU A . n 
A 1 20 VAL 20 45  45  VAL VAL A . n 
A 1 21 MET 21 46  46  MET MET A . n 
A 1 22 GLY 22 47  47  GLY GLY A . n 
A 1 23 GLY 23 48  48  GLY GLY A . n 
A 1 24 TYR 24 49  49  TYR TYR A . n 
A 1 25 THR 25 50  50  THR THR A . n 
A 1 26 PRO 26 51  51  PRO PRO A . n 
A 1 27 GLU 27 52  52  GLU GLU A . n 
A 1 28 LEU 28 53  53  LEU LEU A . n 
A 1 29 ILE 29 54  54  ILE ILE A . n 
A 1 30 VAL 30 55  55  VAL VAL A . n 
A 1 31 LEU 31 56  56  LEU LEU A . n 
A 1 32 LYS 32 57  57  LYS LYS A . n 
A 1 33 LYS 33 58  58  LYS LYS A . n 
A 1 34 SER 34 59  59  SER SER A . n 
A 1 35 VAL 35 60  60  VAL VAL A . n 
A 1 36 PRO 36 61  61  PRO PRO A . n 
A 1 37 ALA 37 62  62  ALA ALA A . n 
A 1 38 ARG 38 63  63  ARG ARG A . n 
A 1 39 ILE 39 64  64  ILE ILE A . n 
A 1 40 VAL 40 65  65  VAL VAL A . n 
A 1 41 PHE 41 66  66  PHE PHE A . n 
A 1 42 ASP 42 67  67  ASP ASP A . n 
A 1 43 ARG 43 68  68  ARG ARG A . n 
A 1 44 LYS 44 69  69  LYS LYS A . n 
A 1 45 ASP 45 70  70  ASP ASP A . n 
A 1 46 PRO 46 71  71  PRO PRO A . n 
A 1 47 SER 47 72  72  SER SER A . n 
A 1 48 PRO 48 73  73  PRO PRO A . n 
A 1 49 CYS 49 74  74  CYS CYS A . n 
A 1 50 LEU 50 75  75  LEU LEU A . n 
A 1 51 ASP 51 76  76  ASP ASP A . n 
A 1 52 GLN 52 77  77  GLN GLN A . n 
A 1 53 ILE 53 78  78  ILE ILE A . n 
A 1 54 VAL 54 79  79  VAL VAL A . n 
A 1 55 PHE 55 80  80  PHE PHE A . n 
A 1 56 PRO 56 81  81  PRO PRO A . n 
A 1 57 ASP 57 82  82  ASP ASP A . n 
A 1 58 PHE 58 83  83  PHE PHE A . n 
A 1 59 GLY 59 84  84  GLY GLY A . n 
A 1 60 VAL 60 85  85  VAL VAL A . n 
A 1 61 HIS 61 86  86  HIS HIS A . n 
A 1 62 ALA 62 87  87  ALA ALA A . n 
A 1 63 ASN 63 88  88  ASN ASN A . n 
A 1 64 LEU 64 89  89  LEU LEU A . n 
A 1 65 PRO 65 90  90  PRO PRO A . n 
A 1 66 MET 66 91  91  MET MET A . n 
A 1 67 GLY 67 92  92  GLY GLY A . n 
A 1 68 GLU 68 93  93  GLU GLU A . n 
A 1 69 GLU 69 94  94  GLU GLU A . n 
A 1 70 TYR 70 95  95  TYR TYR A . n 
A 1 71 VAL 71 96  96  VAL VAL A . n 
A 1 72 VAL 72 97  97  VAL VAL A . n 
A 1 73 GLU 73 98  98  GLU GLU A . n 
A 1 74 ILE 74 99  99  ILE ILE A . n 
A 1 75 THR 75 100 100 THR THR A . n 
A 1 76 PRO 76 101 101 PRO PRO A . n 
A 1 77 GLU 77 102 102 GLU GLU A . n 
A 1 78 GLN 78 103 103 GLN GLN A . n 
A 1 79 ALA 79 104 104 ALA ALA A . n 
A 1 80 GLY 80 105 105 GLY GLY A . n 
A 1 81 GLU 81 106 106 GLU GLU A . n 
A 1 82 PHE 82 107 107 PHE PHE A . n 
A 1 83 SER 83 108 108 SER SER A . n 
A 1 84 PHE 84 109 109 PHE PHE A . n 
A 1 85 ALA 85 110 110 ALA ALA A . n 
A 1 86 CYS 86 111 111 CYS CYS A . n 
A 1 87 GLY 87 112 112 GLY GLY A . n 
A 1 88 MET 88 113 113 MET MET A . n 
A 1 89 ASN 89 114 114 ASN ASN A . n 
A 1 90 MET 90 115 115 MET MET A . n 
A 1 91 MET 91 116 116 MET MET A . n 
A 1 92 HIS 92 117 117 HIS HIS A . n 
A 1 93 GLY 93 118 118 GLY GLY A . n 
A 1 94 LYS 94 119 119 LYS LYS A . n 
A 1 95 MET 95 120 120 MET MET A . n 
A 1 96 ILE 96 121 121 ILE ILE A . n 
A 1 97 VAL 97 122 122 VAL VAL A . n 
A 1 98 GLU 98 123 123 GLU GLU A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2MRY 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2MRY 
_struct.title                     'NMR solution structure of copper binding protein in the apo form' 
_struct.pdbx_model_details        'fewest violations, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2MRY 
_struct_keywords.pdbx_keywords   'copper binding protein' 
_struct_keywords.text            'copper binding protein' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q04LG8_STRP2 
_struct_ref.pdbx_db_accession          Q04LG8 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFS
FACGMNMMHGKMIVE
;
_struct_ref.pdbx_align_begin           29 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2MRY 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 4 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 98 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q04LG8 
_struct_ref_seq.db_align_beg                  29 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  123 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       29 
_struct_ref_seq.pdbx_auth_seq_align_end       123 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2MRY GLY A 1 ? UNP Q04LG8 ? ? 'expression tag' 26 1 
1 2MRY ALA A 2 ? UNP Q04LG8 ? ? 'expression tag' 27 2 
1 2MRY MET A 3 ? UNP Q04LG8 ? ? 'expression tag' 28 3 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        47 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       LEU 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        50 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         72 
_struct_conf.end_auth_comp_id        LEU 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         75 
_struct_conf.pdbx_PDB_helix_class    5 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   4 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 5  ? LYS A 6  ? GLN A 30  LYS A 31  
A 2 LEU A 28 ? LYS A 32 ? LEU A 53  LYS A 57  
A 3 LYS A 94 ? GLU A 98 ? LYS A 119 GLU A 123 
A 4 GLY A 80 ? SER A 83 ? GLY A 105 SER A 108 
B 1 GLN A 8  ? GLN A 9  ? GLN A 33  GLN A 34  
B 2 GLN A 14 ? VAL A 20 ? GLN A 39  VAL A 45  
B 3 ALA A 37 ? ARG A 43 ? ALA A 62  ARG A 68  
B 4 GLU A 69 ? ILE A 74 ? GLU A 94  ILE A 99  
C 1 GLN A 52 ? VAL A 54 ? GLN A 77  VAL A 79  
C 2 HIS A 61 ? ASN A 63 ? HIS A 86  ASN A 88  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 5  ? N GLN A 30  O LEU A 28 ? O LEU A 53  
A 2 3 N ILE A 29 ? N ILE A 54  O ILE A 96 ? O ILE A 121 
A 3 4 O MET A 95 ? O MET A 120 N PHE A 82 ? N PHE A 107 
B 1 2 N GLN A 8  ? N GLN A 33  O GLU A 15 ? O GLU A 40  
B 2 3 N VAL A 18 ? N VAL A 43  O VAL A 40 ? O VAL A 65  
B 3 4 N ALA A 37 ? N ALA A 62  O ILE A 74 ? O ILE A 99  
C 1 2 N ILE A 53 ? N ILE A 78  O ALA A 62 ? O ALA A 87  
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 4  N A GLY 26 ? ? HZ3 A LYS 31 ? ? 1.54 
2 13 N A GLY 26 ? ? HZ1 A LYS 31 ? ? 1.54 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  LYS A 35  ? ? -93.42  -154.28 
2  1  PRO A 71  ? ? -81.42  40.10   
3  1  MET A 113 ? ? -137.97 -90.85  
4  1  MET A 116 ? ? 66.17   -177.51 
5  2  LYS A 35  ? ? -93.20  -148.68 
6  2  PRO A 71  ? ? -79.23  38.63   
7  2  MET A 115 ? ? -126.94 -92.60  
8  3  LYS A 35  ? ? -95.34  -150.28 
9  3  PRO A 71  ? ? -81.87  39.66   
10 3  MET A 116 ? ? 61.75   73.22   
11 4  LYS A 35  ? ? -97.10  -153.07 
12 4  PRO A 71  ? ? -80.18  38.48   
13 4  MET A 113 ? ? -139.30 -107.06 
14 4  ASN A 114 ? ? 59.05   -160.13 
15 5  MET A 28  ? ? -124.95 -74.36  
16 5  LYS A 35  ? ? -94.89  -151.14 
17 5  PRO A 71  ? ? -80.73  39.63   
18 6  LYS A 35  ? ? -95.41  -156.17 
19 6  PRO A 71  ? ? -80.97  39.53   
20 6  MET A 113 ? ? -141.86 -31.53  
21 6  ASN A 114 ? ? -156.14 -159.78 
22 7  LYS A 35  ? ? -95.39  -149.82 
23 7  PRO A 71  ? ? -80.52  39.13   
24 7  MET A 113 ? ? -164.30 -39.26  
25 8  LYS A 35  ? ? -91.03  -157.07 
26 8  PRO A 61  ? ? -67.25  93.44   
27 8  PRO A 71  ? ? -81.13  40.43   
28 9  ALA A 27  ? ? 63.47   -91.23  
29 9  LYS A 35  ? ? -97.51  -149.88 
30 9  PRO A 71  ? ? -79.60  39.54   
31 10 LYS A 35  ? ? -94.75  -149.79 
32 10 PRO A 71  ? ? -80.62  39.25   
33 11 LYS A 35  ? ? -94.97  -150.72 
34 11 PRO A 71  ? ? -79.75  38.57   
35 11 MET A 113 ? ? -122.69 -96.98  
36 11 MET A 116 ? ? 69.50   174.18  
37 11 HIS A 117 ? ? -164.90 103.74  
38 12 LYS A 35  ? ? -94.89  -154.50 
39 12 PRO A 71  ? ? -81.20  39.39   
40 13 MET A 28  ? ? -132.11 -51.32  
41 13 LYS A 35  ? ? -92.63  -151.32 
42 13 PRO A 71  ? ? -81.67  40.29   
43 13 MET A 115 ? ? -85.35  48.86   
44 14 LYS A 35  ? ? -93.03  -156.08 
45 14 PRO A 71  ? ? -80.49  39.47   
46 14 ASN A 114 ? ? 68.33   -170.63 
47 14 MET A 115 ? ? -102.21 65.04   
48 15 LYS A 35  ? ? -96.63  -151.62 
49 15 PRO A 71  ? ? -80.24  39.33   
50 15 ASN A 114 ? ? -156.16 -48.24  
51 15 MET A 116 ? ? 68.50   -179.36 
52 16 ALA A 27  ? ? 58.59   -124.00 
53 16 LYS A 35  ? ? -95.33  -151.91 
54 16 PRO A 71  ? ? -81.31  39.43   
55 16 MET A 115 ? ? 62.80   -141.68 
56 16 MET A 116 ? ? 73.35   151.13  
57 17 MET A 28  ? ? -91.09  57.58   
58 17 LYS A 35  ? ? -95.71  -150.87 
59 17 PRO A 71  ? ? -81.01  39.47   
60 17 MET A 113 ? ? -126.78 -60.31  
61 17 ASN A 114 ? ? -151.36 -86.08  
62 18 MET A 28  ? ? 59.88   -160.62 
63 18 LYS A 35  ? ? -95.76  -149.99 
64 18 PRO A 71  ? ? -80.63  39.45   
65 18 MET A 113 ? ? -153.47 75.55   
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             18 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2MRY 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2MRY 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
_pdbx_nmr_sample_details.contents         
;0.4-0.6 mM [U-98% 13C; U-98% 15N] copper binding protein, 10 % [U-99% 2H] D2O, 50 mM sodium phosphate, 50 mM sodium chloride, 5 mM EDTA, 5 mM TCEP, 10 uM DSS, 0.02 % sodium azide, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
entity-1             ?    0.4-0.6 mM '[U-98% 13C; U-98% 15N]' 1 
D2O-2                10   ?       %  '[U-99% 2H]'             1 
'sodium phosphate-3' 50   ?       mM ?                        1 
'sodium chloride-4'  50   ?       mM ?                        1 
EDTA-5               5    ?       mM ?                        1 
TCEP-6               5    ?       mM ?                        1 
DSS-7                10   ?       uM ?                        1 
'sodium azide-8'     0.02 ?       %  ?                        1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      300 
_pdbx_nmr_exptl_sample_conditions.pH                  6 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-15N HSQC'  
1 3  1 '3D CBCA(CO)NH'   
1 4  1 '3D CBCANH'       
1 5  1 '3D HNCO'         
1 6  1 '3D C(CO)NH'      
1 7  1 '3D H(CCO)NH'     
1 8  1 '3D HCCH-TOCSY'   
1 9  1 '3D HCCH-COSY'    
1 10 1 '3D HNHA'         
1 11 1 '3D 1H-15N NOESY' 
1 12 1 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2MRY 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         2201 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  347 
_pdbx_nmr_constraints.NOE_long_range_total_count                    1067 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  248 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    539 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     65 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     65 
# 
_pdbx_nmr_refine.entry_id           2MRY 
_pdbx_nmr_refine.method             'simulated annealing, torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA             2.1   1 
CCPN                                                'peak picking'              'CcpNmr Analysis' 2.3.0 2 
CCPN                                                'data analysis'             'CcpNmr Analysis' 2.3.0 3 
Goddard                                             'chemical shift assignment' Sparky            2.6   4 
Goddard                                             'peak picking'              Sparky            2.6   5 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe           8.1   6 
'Bhattacharya and Montelione'                       'structure validation'      PSVS              1.5   7 
'Bahrami, Markley, Assadi, and Eghbalnia'           'chemical shift assignment' PINE              2.0   8 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  'X-PLOR NIH'      2.36  9 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
SER N    N N N 287 
SER CA   C N S 288 
SER C    C N N 289 
SER O    O N N 290 
SER CB   C N N 291 
SER OG   O N N 292 
SER OXT  O N N 293 
SER H    H N N 294 
SER H2   H N N 295 
SER HA   H N N 296 
SER HB2  H N N 297 
SER HB3  H N N 298 
SER HG   H N N 299 
SER HXT  H N N 300 
THR N    N N N 301 
THR CA   C N S 302 
THR C    C N N 303 
THR O    O N N 304 
THR CB   C N R 305 
THR OG1  O N N 306 
THR CG2  C N N 307 
THR OXT  O N N 308 
THR H    H N N 309 
THR H2   H N N 310 
THR HA   H N N 311 
THR HB   H N N 312 
THR HG1  H N N 313 
THR HG21 H N N 314 
THR HG22 H N N 315 
THR HG23 H N N 316 
THR HXT  H N N 317 
TYR N    N N N 318 
TYR CA   C N S 319 
TYR C    C N N 320 
TYR O    O N N 321 
TYR CB   C N N 322 
TYR CG   C Y N 323 
TYR CD1  C Y N 324 
TYR CD2  C Y N 325 
TYR CE1  C Y N 326 
TYR CE2  C Y N 327 
TYR CZ   C Y N 328 
TYR OH   O N N 329 
TYR OXT  O N N 330 
TYR H    H N N 331 
TYR H2   H N N 332 
TYR HA   H N N 333 
TYR HB2  H N N 334 
TYR HB3  H N N 335 
TYR HD1  H N N 336 
TYR HD2  H N N 337 
TYR HE1  H N N 338 
TYR HE2  H N N 339 
TYR HH   H N N 340 
TYR HXT  H N N 341 
VAL N    N N N 342 
VAL CA   C N S 343 
VAL C    C N N 344 
VAL O    O N N 345 
VAL CB   C N N 346 
VAL CG1  C N N 347 
VAL CG2  C N N 348 
VAL OXT  O N N 349 
VAL H    H N N 350 
VAL H2   H N N 351 
VAL HA   H N N 352 
VAL HB   H N N 353 
VAL HG11 H N N 354 
VAL HG12 H N N 355 
VAL HG13 H N N 356 
VAL HG21 H N N 357 
VAL HG22 H N N 358 
VAL HG23 H N N 359 
VAL HXT  H N N 360 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TYR N   CA   sing N N 304 
TYR N   H    sing N N 305 
TYR N   H2   sing N N 306 
TYR CA  C    sing N N 307 
TYR CA  CB   sing N N 308 
TYR CA  HA   sing N N 309 
TYR C   O    doub N N 310 
TYR C   OXT  sing N N 311 
TYR CB  CG   sing N N 312 
TYR CB  HB2  sing N N 313 
TYR CB  HB3  sing N N 314 
TYR CG  CD1  doub Y N 315 
TYR CG  CD2  sing Y N 316 
TYR CD1 CE1  sing Y N 317 
TYR CD1 HD1  sing N N 318 
TYR CD2 CE2  doub Y N 319 
TYR CD2 HD2  sing N N 320 
TYR CE1 CZ   doub Y N 321 
TYR CE1 HE1  sing N N 322 
TYR CE2 CZ   sing Y N 323 
TYR CE2 HE2  sing N N 324 
TYR CZ  OH   sing N N 325 
TYR OH  HH   sing N N 326 
TYR OXT HXT  sing N N 327 
VAL N   CA   sing N N 328 
VAL N   H    sing N N 329 
VAL N   H2   sing N N 330 
VAL CA  C    sing N N 331 
VAL CA  CB   sing N N 332 
VAL CA  HA   sing N N 333 
VAL C   O    doub N N 334 
VAL C   OXT  sing N N 335 
VAL CB  CG1  sing N N 336 
VAL CB  CG2  sing N N 337 
VAL CB  HB   sing N N 338 
VAL CG1 HG11 sing N N 339 
VAL CG1 HG12 sing N N 340 
VAL CG1 HG13 sing N N 341 
VAL CG2 HG21 sing N N 342 
VAL CG2 HG22 sing N N 343 
VAL CG2 HG23 sing N N 344 
VAL OXT HXT  sing N N 345 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
800 Agilent VNMRS 1 'Agilent VNMRS' 
600 Agilent VNMRS 2 'Agilent VNMRS' 
# 
_atom_sites.entry_id                    2MRY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_