data_2MTS # _entry.id 2MTS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2MTS pdb_00002mts 10.2210/pdb2mts/pdb RCSB RCSB104035 ? ? BMRB 25181 ? ? WWPDB D_1000104035 ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25181 BMRB unspecified . 2MTR PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MTS _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-08-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cook, G.A.' 1 'Dawson, L.A.' 2 'Tian, Y.' 3 'Opella, S.J.' 4 # _citation.id primary _citation.title ;Three-dimensional structure and interaction studies of hepatitis C virus p7 in 1,2-dihexanoyl-sn-glycero-3-phosphocholine by solution nuclear magnetic resonance. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 52 _citation.page_first 5295 _citation.page_last 5303 _citation.year 2013 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23841474 _citation.pdbx_database_id_DOI 10.1021/bi4006623 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cook, G.A.' 1 ? primary 'Dawson, L.A.' 2 ? primary 'Tian, Y.' 3 ? primary 'Opella, S.J.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'HEPATITIS C VIRUS P7 PROTEIN' _entity.formula_weight 6693.917 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation C27S _entity.pdbx_fragment 'UNP residues 747-809' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ALENLVVLNAASVAGAHGILSFLVFFSAAWYIKGRLAPGAAYAFYGVWPLLLLLLALPPRAYA _entity_poly.pdbx_seq_one_letter_code_can ALENLVVLNAASVAGAHGILSFLVFFSAAWYIKGRLAPGAAYAFYGVWPLLLLLLALPPRAYA _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 LEU n 1 3 GLU n 1 4 ASN n 1 5 LEU n 1 6 VAL n 1 7 VAL n 1 8 LEU n 1 9 ASN n 1 10 ALA n 1 11 ALA n 1 12 SER n 1 13 VAL n 1 14 ALA n 1 15 GLY n 1 16 ALA n 1 17 HIS n 1 18 GLY n 1 19 ILE n 1 20 LEU n 1 21 SER n 1 22 PHE n 1 23 LEU n 1 24 VAL n 1 25 PHE n 1 26 PHE n 1 27 SER n 1 28 ALA n 1 29 ALA n 1 30 TRP n 1 31 TYR n 1 32 ILE n 1 33 LYS n 1 34 GLY n 1 35 ARG n 1 36 LEU n 1 37 ALA n 1 38 PRO n 1 39 GLY n 1 40 ALA n 1 41 ALA n 1 42 TYR n 1 43 ALA n 1 44 PHE n 1 45 TYR n 1 46 GLY n 1 47 VAL n 1 48 TRP n 1 49 PRO n 1 50 LEU n 1 51 LEU n 1 52 LEU n 1 53 LEU n 1 54 LEU n 1 55 LEU n 1 56 ALA n 1 57 LEU n 1 58 PRO n 1 59 PRO n 1 60 ARG n 1 61 ALA n 1 62 TYR n 1 63 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Hepatitis C virus (HCV)' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain HC-J4 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hepatitis C virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 420174 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pHLV _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POLG_HCVJ4 _struct_ref.pdbx_db_accession O92972 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ALENLVVLNAASVAGAHGILSFLVFFCAAWYIKGRLAPGAAYAFYGVWPLLLLLLALPPRAYA _struct_ref.pdbx_align_begin 747 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MTS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 63 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O92972 _struct_ref_seq.db_align_beg 747 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 809 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 63 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2MTS _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 27 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O92972 _struct_ref_seq_dif.db_mon_id CYS _struct_ref_seq_dif.pdbx_seq_db_seq_num 773 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 27 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D 1H-15N HSQC NOESY' 1 3 2 '2D 1H-15N HSQC' 1 4 1 '3D HNCA' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 4.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.5 mM [U-100% 13C; U-100% 15N] p7, 125 mM DHPC, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.5 mM [U-100% 15N] p7, 125 mM DHPC, 6 % polyacrylamide gel, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MTS _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MTS _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MTS _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 Goddard 'chemical shift assignment' Sparky ? 2 'Shen, Vernon, Baker and Bax' 'structure solution' CS-ROSETTA ? 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' ? 4 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MTS _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MTS _struct.title ;Three-Dimensional Structure and Interaction Studies of Hepatitis C Virus p7 in 1,2-Dihexanoyl-sn-glycero-3-phosphocholine by Solution Nuclear Magnetic Resonance ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MTS _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' _struct_keywords.text 'membrane protein, viroporin, ion channel' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 3 ? GLY A 15 ? GLU A 3 GLY A 15 1 ? 13 HELX_P HELX_P2 2 GLY A 15 ? PHE A 22 ? GLY A 15 PHE A 22 1 ? 8 HELX_P HELX_P3 3 PHE A 22 ? ILE A 32 ? PHE A 22 ILE A 32 1 ? 11 HELX_P HELX_P4 4 GLY A 39 ? PHE A 44 ? GLY A 39 PHE A 44 1 ? 6 HELX_P HELX_P5 5 TYR A 45 ? VAL A 47 ? TYR A 45 VAL A 47 5 ? 3 HELX_P HELX_P6 6 TRP A 48 ? PRO A 49 ? TRP A 48 PRO A 49 5 ? 2 HELX_P HELX_P7 7 LEU A 50 ? LEU A 57 ? LEU A 50 LEU A 57 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MTS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 VAL 7 7 7 VAL VAL A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 ALA 16 16 16 ALA ALA A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ILE 32 32 32 ILE ILE A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 TRP 48 48 48 TRP TRP A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 PRO 59 59 59 PRO PRO A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 TYR 62 62 62 TYR TYR A . n A 1 63 ALA 63 63 63 ALA ALA A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-10-15 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id p7-1 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 DHPC-2 125 ? mM ? 1 p7-3 0.5 ? mM '[U-100% 15N]' 2 DHPC-4 125 ? mM ? 2 'polyacrylamide gel-5' 6 ? % ? 2 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PRO 59 ? ? H A ALA 61 ? ? 1.57 2 1 O A ARG 35 ? ? N A ALA 37 ? ? 2.19 3 4 H2 A ALA 1 ? ? H A LEU 2 ? ? 1.27 4 6 O A PHE 22 ? ? H A PHE 26 ? ? 1.58 5 8 O A ASN 4 ? ? H A LEU 8 ? ? 1.57 6 8 O A LEU 52 ? ? H A ALA 56 ? ? 1.60 7 10 H2 A ALA 1 ? ? H A LEU 2 ? ? 1.32 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 3 ? ? -108.40 -166.49 2 1 LEU A 5 ? ? -53.00 -6.41 3 1 ARG A 35 ? ? -145.50 -5.06 4 1 LEU A 36 ? ? -6.33 71.38 5 1 ALA A 37 ? ? -21.10 91.90 6 1 ALA A 40 ? ? -87.77 -72.51 7 1 ALA A 41 ? ? -48.12 -13.25 8 1 TYR A 45 ? ? -49.01 -10.40 9 1 VAL A 47 ? ? -148.62 23.91 10 1 ARG A 60 ? ? -68.16 42.25 11 2 LEU A 2 ? ? -86.39 -99.60 12 2 GLU A 3 ? ? -76.99 -138.18 13 2 LEU A 5 ? ? -48.27 -104.73 14 2 ALA A 10 ? ? -72.24 -77.93 15 2 ALA A 11 ? ? -43.16 -15.00 16 2 ARG A 35 ? ? -72.19 20.75 17 2 PRO A 38 ? ? -65.40 -91.97 18 2 TYR A 42 ? ? -64.45 -71.23 19 2 ALA A 43 ? ? -79.18 -77.70 20 2 PHE A 44 ? ? -23.17 -89.70 21 2 VAL A 47 ? ? -102.25 59.32 22 2 LEU A 52 ? ? -69.36 4.13 23 2 LEU A 55 ? ? -127.40 -56.50 24 2 LEU A 57 ? ? -119.93 65.90 25 2 ARG A 60 ? ? -56.27 -75.56 26 3 ASN A 4 ? ? 82.16 -123.02 27 3 LEU A 5 ? ? -56.31 7.95 28 3 LEU A 8 ? ? -46.07 -70.74 29 3 HIS A 17 ? ? -55.14 -3.82 30 3 ILE A 19 ? ? -45.75 -17.64 31 3 ALA A 37 ? ? -47.43 -179.80 32 3 ALA A 41 ? ? -82.96 -72.47 33 3 ALA A 43 ? ? -57.67 -88.63 34 3 ARG A 60 ? ? 44.85 -91.15 35 3 ALA A 61 ? ? -19.70 91.06 36 4 GLU A 3 ? ? -102.24 -165.89 37 4 ASN A 4 ? ? 72.82 -60.75 38 4 HIS A 17 ? ? -50.75 -8.03 39 4 PRO A 38 ? ? -47.63 106.40 40 4 PHE A 44 ? ? -63.10 -83.05 41 4 TYR A 45 ? ? -53.65 -8.76 42 4 PRO A 59 ? ? -43.67 -11.79 43 5 GLU A 3 ? ? -41.13 108.03 44 5 LEU A 5 ? ? -112.52 -70.86 45 5 ALA A 14 ? ? -93.16 -77.84 46 5 HIS A 17 ? ? -41.66 -19.02 47 5 PRO A 38 ? ? -63.88 -177.89 48 5 ALA A 41 ? ? -71.47 21.19 49 5 VAL A 47 ? ? -144.46 36.24 50 5 LEU A 52 ? ? -49.06 -19.04 51 5 PRO A 58 ? ? -47.08 175.37 52 6 GLU A 3 ? ? -74.48 25.65 53 6 ALA A 41 ? ? -47.79 -85.35 54 6 PHE A 44 ? ? -87.99 -70.47 55 6 LEU A 54 ? ? -53.90 -9.99 56 6 LEU A 55 ? ? -75.73 -73.30 57 6 TYR A 62 ? ? -83.11 -89.57 58 7 LEU A 5 ? ? -106.82 -73.53 59 7 ALA A 16 ? ? -61.10 -110.85 60 7 HIS A 17 ? ? -44.79 -13.12 61 7 LEU A 36 ? ? -70.32 49.67 62 7 ALA A 43 ? ? -64.82 -74.07 63 7 PHE A 44 ? ? -65.34 6.10 64 7 ALA A 56 ? ? -62.82 1.00 65 8 ASN A 4 ? ? -100.59 -64.88 66 8 LEU A 8 ? ? -58.32 -74.24 67 8 ALA A 10 ? ? -78.41 -82.30 68 8 ALA A 16 ? ? -50.79 -98.47 69 8 HIS A 17 ? ? -47.48 -5.12 70 8 PRO A 38 ? ? -52.42 72.83 71 8 PRO A 49 ? ? -57.98 13.84 72 8 LEU A 52 ? ? -59.33 -73.93 73 8 PRO A 58 ? ? -50.63 -178.39 74 8 ARG A 60 ? ? -63.79 8.42 75 9 ASN A 4 ? ? -65.28 -144.79 76 9 HIS A 17 ? ? -49.11 -19.10 77 9 ALA A 41 ? ? -55.81 -3.27 78 9 LEU A 53 ? ? -48.89 -9.23 79 9 PRO A 58 ? ? -48.29 -175.39 80 9 TYR A 62 ? ? -161.19 30.76 81 10 GLU A 3 ? ? -90.60 -141.43 82 10 LEU A 5 ? ? -69.20 -85.54 83 10 LEU A 8 ? ? -56.98 -70.45 84 10 LEU A 36 ? ? -52.82 -1.73 85 10 ALA A 37 ? ? -39.74 164.87 86 10 PRO A 49 ? ? -59.58 2.85 87 10 ARG A 60 ? ? -56.90 -72.44 #