data_2MX4 # _entry.id 2MX4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id RCSB104153 RCSB 2MX4 PDB 19905 BMRB D_1000104153 WWPDB # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 19905 BMRB 'chemical shifts of full length phosphorylated 4E-BP2' unspecified 19114 BMRB 'chemical shifts of full length non-phosphorylated 4E-BP2' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MX4 _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-12-10 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bah, A.' 1 'Forman-Kay, J.' 2 'Vernon, R.' 3 'Siddiqui, Z.' 4 'Krzeminski, M.' 5 'Muhandiram, R.' 6 'Zhao, C.' 7 'Sonenberg, N.' 8 'Kay, L.' 9 # _citation.id primary _citation.title 'Folding of an intrinsically disordered protein by phosphorylation as a regulatory switch.' _citation.journal_abbrev Nature _citation.journal_volume 519 _citation.page_first 106 _citation.page_last 109 _citation.year 2015 _citation.journal_id_ASTM NATUAS _citation.country UK _citation.journal_id_ISSN 0028-0836 _citation.journal_id_CSD 0006 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25533957 _citation.pdbx_database_id_DOI 10.1038/nature13999 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Bah, A.' 1 primary 'Vernon, R.M.' 2 primary 'Siddiqui, Z.' 3 primary 'Krzeminski, M.' 4 primary 'Muhandiram, R.' 5 primary 'Zhao, C.' 6 primary 'Sonenberg, N.' 7 primary 'Kay, L.E.' 8 primary 'Forman-Kay, J.D.' 9 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Eukaryotic translation initiation factor 4E-binding protein 2' _entity.formula_weight 5090.515 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 18-62' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name '4E-BP2, eIF4E-binding protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'PTRTVAISDAAQLPHDYCT(TPO)PGGTLFST(TPO)PGGTRIIYDRKFLLDR' _entity_poly.pdbx_seq_one_letter_code_can PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 THR n 1 3 ARG n 1 4 THR n 1 5 VAL n 1 6 ALA n 1 7 ILE n 1 8 SER n 1 9 ASP n 1 10 ALA n 1 11 ALA n 1 12 GLN n 1 13 LEU n 1 14 PRO n 1 15 HIS n 1 16 ASP n 1 17 TYR n 1 18 CYS n 1 19 THR n 1 20 TPO n 1 21 PRO n 1 22 GLY n 1 23 GLY n 1 24 THR n 1 25 LEU n 1 26 PHE n 1 27 SER n 1 28 THR n 1 29 TPO n 1 30 PRO n 1 31 GLY n 1 32 GLY n 1 33 THR n 1 34 ARG n 1 35 ILE n 1 36 ILE n 1 37 TYR n 1 38 ASP n 1 39 ARG n 1 40 LYS n 1 41 PHE n 1 42 LEU n 1 43 LEU n 1 44 ASP n 1 45 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene EIF4EBP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET SUMO' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code 4EBP2_HUMAN _struct_ref.pdbx_db_accession Q13542 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code PTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDR _struct_ref.pdbx_align_begin 18 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MX4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 45 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q13542 _struct_ref_seq.db_align_beg 18 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 62 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 18 _struct_ref_seq.pdbx_auth_seq_align_end 62 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D H(CCO)NH' 1 4 1 '3D 1H-15N NOESY' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D 1H-13C NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.150 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 20 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents ;1 mM [U-99% 13C; U-99% 15N] Phosphorylated 4E-BP2, 2 mM DTT, 100 mM sodium chloride, 30 mM sodium phosphate, 1 mM EDTA, 1 mM Benzamidine, 90% H2O/10% D2O ; _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' 800 Varian INOVA 3 'Varian INOVA' 500 Varian INOVA 4 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2MX4 _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 20359 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MX4 _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MX4 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'chemical shift assignment' NMRPipe ? 2 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 'structure solution' NMRPipe ? 3 Goddard processing NMRPipe ? 4 Goddard 'chemical shift assignment' NMRPipe ? 5 Goddard 'structure solution' NMRPipe ? 6 'Shen, Vernon, Baker and Bax' processing NMRPipe ? 7 'Shen, Vernon, Baker and Bax' 'chemical shift assignment' NMRPipe ? 8 'Shen, Vernon, Baker and Bax' 'structure solution' NMRPipe ? 9 'Lange and Baker' refinement CS-ROSETTA ? 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MX4 _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MX4 _struct.title 'NMR structure of Phosphorylated 4E-BP2' _struct.pdbx_descriptor 'Eukaryotic translation initiation factor 4E-binding protein 2' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MX4 _struct_keywords.pdbx_keywords 'Translation,protein Binding' _struct_keywords.text 'phosphorylation, intrinsic disorder, Translation, protein Binding' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A THR 19 C ? ? ? 1_555 A TPO 20 N ? ? A THR 36 A TPO 37 1_555 ? ? ? ? ? ? ? 1.329 ? covale2 covale ? ? A TPO 20 C ? ? ? 1_555 A PRO 21 N ? ? A TPO 37 A PRO 38 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A THR 28 C ? ? ? 1_555 A TPO 29 N ? ? A THR 45 A TPO 46 1_555 ? ? ? ? ? ? ? 1.329 ? covale4 covale ? ? A TPO 29 C ? ? ? 1_555 A PRO 30 N ? ? A TPO 46 A PRO 47 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 HIS 15 A . ? HIS 32 A ASP 16 A ? ASP 33 A 6 6.79 2 HIS 15 A . ? HIS 32 A ASP 16 A ? ASP 33 A 8 2.95 3 HIS 15 A . ? HIS 32 A ASP 16 A ? ASP 33 A 9 4.85 4 HIS 15 A . ? HIS 32 A ASP 16 A ? ASP 33 A 10 4.65 5 HIS 15 A . ? HIS 32 A ASP 16 A ? ASP 33 A 14 -0.55 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 4 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 2 ? ILE A 7 ? THR A 19 ILE A 24 A 2 ARG A 34 ? ARG A 39 ? ARG A 51 ARG A 56 A 3 LEU A 25 ? THR A 28 ? LEU A 42 THR A 45 A 4 CYS A 18 ? THR A 19 ? CYS A 35 THR A 36 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 7 ? N ILE A 24 O ASP A 38 ? O ASP A 55 A 2 3 O ILE A 35 ? O ILE A 52 N SER A 27 ? N SER A 44 A 3 4 O PHE A 26 ? O PHE A 43 N CYS A 18 ? N CYS A 35 # _atom_sites.entry_id 2MX4 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 18 18 PRO PRO A . n A 1 2 THR 2 19 19 THR THR A . n A 1 3 ARG 3 20 20 ARG ARG A . n A 1 4 THR 4 21 21 THR THR A . n A 1 5 VAL 5 22 22 VAL VAL A . n A 1 6 ALA 6 23 23 ALA ALA A . n A 1 7 ILE 7 24 24 ILE ILE A . n A 1 8 SER 8 25 25 SER SER A . n A 1 9 ASP 9 26 26 ASP ASP A . n A 1 10 ALA 10 27 27 ALA ALA A . n A 1 11 ALA 11 28 28 ALA ALA A . n A 1 12 GLN 12 29 29 GLN GLN A . n A 1 13 LEU 13 30 30 LEU LEU A . n A 1 14 PRO 14 31 31 PRO PRO A . n A 1 15 HIS 15 32 32 HIS HIS A . n A 1 16 ASP 16 33 33 ASP ASP A . n A 1 17 TYR 17 34 34 TYR TYR A . n A 1 18 CYS 18 35 35 CYS CYS A . n A 1 19 THR 19 36 36 THR THR A . n A 1 20 TPO 20 37 37 TPO TPO A . n A 1 21 PRO 21 38 38 PRO PRO A . n A 1 22 GLY 22 39 39 GLY GLY A . n A 1 23 GLY 23 40 40 GLY GLY A . n A 1 24 THR 24 41 41 THR THR A . n A 1 25 LEU 25 42 42 LEU LEU A . n A 1 26 PHE 26 43 43 PHE PHE A . n A 1 27 SER 27 44 44 SER SER A . n A 1 28 THR 28 45 45 THR THR A . n A 1 29 TPO 29 46 46 TPO TPO A . n A 1 30 PRO 30 47 47 PRO PRO A . n A 1 31 GLY 31 48 48 GLY GLY A . n A 1 32 GLY 32 49 49 GLY GLY A . n A 1 33 THR 33 50 50 THR THR A . n A 1 34 ARG 34 51 51 ARG ARG A . n A 1 35 ILE 35 52 52 ILE ILE A . n A 1 36 ILE 36 53 53 ILE ILE A . n A 1 37 TYR 37 54 54 TYR TYR A . n A 1 38 ASP 38 55 55 ASP ASP A . n A 1 39 ARG 39 56 56 ARG ARG A . n A 1 40 LYS 40 57 57 LYS LYS A . n A 1 41 PHE 41 58 58 PHE PHE A . n A 1 42 LEU 42 59 59 LEU LEU A . n A 1 43 LEU 43 60 60 LEU LEU A . n A 1 44 ASP 44 61 61 ASP ASP A . n A 1 45 ARG 45 62 62 ARG ARG A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A TPO 20 A TPO 37 ? THR PHOSPHOTHREONINE 2 A TPO 29 A TPO 46 ? THR PHOSPHOTHREONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-01-07 2 'Structure model' 1 1 2015-03-18 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'Phosphorylated 4E-BP2-1' 1 ? mM '[U-99% 13C; U-99% 15N]' 1 DTT-2 2 ? mM ? 1 'sodium chloride-3' 100 ? mM ? 1 'sodium phosphate-4' 30 ? mM ? 1 EDTA-5 1 ? mM ? 1 Benzamidine-6 1 ? mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 11 PRO A 31 ? ? -67.77 -176.10 2 14 PHE A 58 ? ? -105.34 41.74 #