data_2MXD # _entry.id 2MXD # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104162 RCSB ? ? 2MXD PDB pdb_00002mxd 10.2210/pdb2mxd/pdb 25404 BMRB ? ? D_1000104162 WWPDB ? ? # _pdbx_database_related.db_id 25404 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MXD _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2014-12-24 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kim, J.' 1 'Hwang, H.' 2 'Min, H.' 3 'Yun, H.' 4 'Cho, K.' 5 'Pelton, J.G.' 6 'Wemmer, D.E.' 7 'Lee, C.' 8 # _citation.id primary _citation.title 'Solution structure of the porcine sapovirus VPg core reveals a stable three-helical bundle with a conserved surface patch.' _citation.journal_abbrev Biochem.Biophys.Res.Commun. _citation.journal_volume 459 _citation.page_first 610 _citation.page_last 616 _citation.year 2015 _citation.journal_id_ASTM BBRCA9 _citation.country US _citation.journal_id_ISSN 0006-291X _citation.journal_id_CSD 0146 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25753201 _citation.pdbx_database_id_DOI 10.1016/j.bbrc.2015.02.156 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hwang, H.J.' 1 ? primary 'Min, H.J.' 2 ? primary 'Yun, H.' 3 ? primary 'Pelton, J.G.' 4 ? primary 'Wemmer, D.E.' 5 ? primary 'Cho, K.O.' 6 ? primary 'Kim, J.S.' 7 ? primary 'Lee, C.W.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Viral protein genome-linked' _entity.formula_weight 7382.227 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'UNP residues 948-1006' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name VPg # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAMAIALRDDEYDEWQDIIRDWRKEMTVQQFLDLKERALSGASDPDSQRYNAWLELRAKRLS _entity_poly.pdbx_seq_one_letter_code_can GAMAIALRDDEYDEWQDIIRDWRKEMTVQQFLDLKERALSGASDPDSQRYNAWLELRAKRLS _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 ALA n 1 5 ILE n 1 6 ALA n 1 7 LEU n 1 8 ARG n 1 9 ASP n 1 10 ASP n 1 11 GLU n 1 12 TYR n 1 13 ASP n 1 14 GLU n 1 15 TRP n 1 16 GLN n 1 17 ASP n 1 18 ILE n 1 19 ILE n 1 20 ARG n 1 21 ASP n 1 22 TRP n 1 23 ARG n 1 24 LYS n 1 25 GLU n 1 26 MET n 1 27 THR n 1 28 VAL n 1 29 GLN n 1 30 GLN n 1 31 PHE n 1 32 LEU n 1 33 ASP n 1 34 LEU n 1 35 LYS n 1 36 GLU n 1 37 ARG n 1 38 ALA n 1 39 LEU n 1 40 SER n 1 41 GLY n 1 42 ALA n 1 43 SER n 1 44 ASP n 1 45 PRO n 1 46 ASP n 1 47 SER n 1 48 GLN n 1 49 ARG n 1 50 TYR n 1 51 ASN n 1 52 ALA n 1 53 TRP n 1 54 LEU n 1 55 GLU n 1 56 LEU n 1 57 ARG n 1 58 ALA n 1 59 LYS n 1 60 ARG n 1 61 LEU n 1 62 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ORF1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Porcine enteric sapovirus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 106333 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pET21a _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code POLG_PESV _struct_ref.pdbx_db_accession Q9QEJ5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code AIALRDDEYDEWQDIIRDWRKEMTVQQFLDLKERALSGASDPDSQRYNAWLELRAKRLS _struct_ref.pdbx_align_begin 948 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MXD _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 62 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9QEJ5 _struct_ref_seq.db_align_beg 948 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 1006 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 948 _struct_ref_seq.pdbx_auth_seq_align_end 1006 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2MXD GLY A 1 ? UNP Q9QEJ5 ? ? 'expression tag' 945 1 1 2MXD ALA A 2 ? UNP Q9QEJ5 ? ? 'expression tag' 946 2 1 2MXD MET A 3 ? UNP Q9QEJ5 ? ? 'expression tag' 947 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCO' 1 4 1 '3D HNCA' 1 5 1 '3D HNCACB' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D HCCH-COSY' 1 8 1 '3D 1H-15N NOESY' 1 9 1 '3D 1H-15N TOCSY' 1 10 1 '3D 1H-13C NOESY aliphatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 10 _pdbx_nmr_exptl_sample_conditions.pH 6.2 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 310 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1 mM [U-99% 13C; U-99% 15N] protein, 10 mM potassium phosphate, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model DRX _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker DRX' # _pdbx_nmr_refine.entry_id 2MXD _pdbx_nmr_refine.method 'DGSA-distance geometry simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MXD _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MXD _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_software.authors 'Schwieters, Kuszewski, Tjandra and Clore' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name 'X-PLOR NIH' _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MXD _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MXD _struct.title 'Solution structure of VPg of porcine sapovirus' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MXD _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'Viral protein genome-linked, Porcine sapovirus, VIRAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 8 ? ARG A 23 ? ARG A 952 ARG A 967 1 ? 16 HELX_P HELX_P2 2 THR A 27 ? SER A 40 ? THR A 971 SER A 984 1 ? 14 HELX_P HELX_P3 3 ASP A 44 ? ARG A 60 ? ASP A 988 ARG A 1004 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MXD _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 945 945 GLY GLY A . n A 1 2 ALA 2 946 946 ALA ALA A . n A 1 3 MET 3 947 947 MET MET A . n A 1 4 ALA 4 948 948 ALA ALA A . n A 1 5 ILE 5 949 949 ILE ILE A . n A 1 6 ALA 6 950 950 ALA ALA A . n A 1 7 LEU 7 951 951 LEU LEU A . n A 1 8 ARG 8 952 952 ARG ARG A . n A 1 9 ASP 9 953 953 ASP ASP A . n A 1 10 ASP 10 954 954 ASP ASP A . n A 1 11 GLU 11 955 955 GLU GLU A . n A 1 12 TYR 12 956 956 TYR TYR A . n A 1 13 ASP 13 957 957 ASP ASP A . n A 1 14 GLU 14 958 958 GLU GLU A . n A 1 15 TRP 15 959 959 TRP TRP A . n A 1 16 GLN 16 960 960 GLN GLN A . n A 1 17 ASP 17 961 961 ASP ASP A . n A 1 18 ILE 18 962 962 ILE ILE A . n A 1 19 ILE 19 963 963 ILE ILE A . n A 1 20 ARG 20 964 964 ARG ARG A . n A 1 21 ASP 21 965 965 ASP ASP A . n A 1 22 TRP 22 966 966 TRP TRP A . n A 1 23 ARG 23 967 967 ARG ARG A . n A 1 24 LYS 24 968 968 LYS LYS A . n A 1 25 GLU 25 969 969 GLU GLU A . n A 1 26 MET 26 970 970 MET MET A . n A 1 27 THR 27 971 971 THR THR A . n A 1 28 VAL 28 972 972 VAL VAL A . n A 1 29 GLN 29 973 973 GLN GLN A . n A 1 30 GLN 30 974 974 GLN GLN A . n A 1 31 PHE 31 975 975 PHE PHE A . n A 1 32 LEU 32 976 976 LEU LEU A . n A 1 33 ASP 33 977 977 ASP ASP A . n A 1 34 LEU 34 978 978 LEU LEU A . n A 1 35 LYS 35 979 979 LYS LYS A . n A 1 36 GLU 36 980 980 GLU GLU A . n A 1 37 ARG 37 981 981 ARG ARG A . n A 1 38 ALA 38 982 982 ALA ALA A . n A 1 39 LEU 39 983 983 LEU LEU A . n A 1 40 SER 40 984 984 SER SER A . n A 1 41 GLY 41 985 985 GLY GLY A . n A 1 42 ALA 42 986 986 ALA ALA A . n A 1 43 SER 43 987 987 SER SER A . n A 1 44 ASP 44 988 988 ASP ASP A . n A 1 45 PRO 45 989 989 PRO PRO A . n A 1 46 ASP 46 990 990 ASP ASP A . n A 1 47 SER 47 991 991 SER SER A . n A 1 48 GLN 48 992 992 GLN GLN A . n A 1 49 ARG 49 993 993 ARG ARG A . n A 1 50 TYR 50 994 994 TYR TYR A . n A 1 51 ASN 51 995 995 ASN ASN A . n A 1 52 ALA 52 996 996 ALA ALA A . n A 1 53 TRP 53 997 997 TRP TRP A . n A 1 54 LEU 54 998 998 LEU LEU A . n A 1 55 GLU 55 999 999 GLU GLU A . n A 1 56 LEU 56 1000 1000 LEU LEU A . n A 1 57 ARG 57 1001 1001 ARG ARG A . n A 1 58 ALA 58 1002 1002 ALA ALA A . n A 1 59 LYS 59 1003 1003 LYS LYS A . n A 1 60 ARG 60 1004 1004 ARG ARG A . n A 1 61 LEU 61 1005 1005 LEU LEU A . n A 1 62 SER 62 1006 1006 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-04-15 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id entity-1 1 ? mM '[U-99% 13C; U-99% 15N]' 1 'potassium phosphate-2' 10 ? mM ? 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 946 ? ? 51.64 -173.54 2 1 MET A 947 ? ? 42.64 24.13 3 1 ARG A 967 ? ? 50.88 15.80 4 2 MET A 947 ? ? 41.85 24.01 5 2 LEU A 951 ? ? 54.18 167.04 6 2 LYS A 968 ? ? -162.48 -157.48 7 2 ASP A 988 ? ? -48.82 152.41 8 2 ARG A 1004 ? ? -85.29 30.86 9 2 LEU A 1005 ? ? -56.93 99.29 10 3 LEU A 951 ? ? 55.24 157.99 11 4 ALA A 948 ? ? 42.40 -174.52 12 4 ALA A 950 ? ? -151.00 42.49 13 4 LEU A 951 ? ? 55.68 157.18 14 4 LYS A 968 ? ? -146.10 -149.91 15 4 ASP A 988 ? ? -42.37 151.21 16 5 ARG A 967 ? ? 55.52 14.74 17 5 ASP A 988 ? ? -45.41 151.04 18 6 ALA A 946 ? ? -171.46 109.51 19 6 LYS A 968 ? ? -152.78 -132.55 20 7 ALA A 950 ? ? -153.62 45.17 21 7 ARG A 967 ? ? 56.36 17.25 22 7 LYS A 968 ? ? -132.44 -141.90 23 7 ASP A 988 ? ? -43.18 150.04 24 8 ALA A 946 ? ? -170.23 -36.45 25 8 ALA A 948 ? ? -159.34 -90.95 26 8 LEU A 951 ? ? 52.63 171.50 27 8 ARG A 967 ? ? 52.76 14.92 28 8 ASP A 988 ? ? -42.17 150.22 29 8 LEU A 1005 ? ? 61.09 146.94 30 9 ALA A 946 ? ? -79.55 -160.85 31 9 ALA A 948 ? ? 50.53 -165.51 32 9 ALA A 950 ? ? 74.15 -24.06 33 9 ARG A 967 ? ? 54.32 19.48 34 10 ALA A 946 ? ? 44.31 -170.75 35 10 ALA A 948 ? ? -43.74 -83.11 36 10 ALA A 950 ? ? -163.98 28.55 37 10 LYS A 968 ? ? -153.39 -146.82 38 10 ARG A 1004 ? ? -57.43 70.96 39 11 ALA A 948 ? ? -72.99 32.36 40 11 ALA A 950 ? ? 38.63 36.61 41 11 LEU A 951 ? ? 54.72 170.80 42 11 ARG A 967 ? ? 54.34 15.07 43 11 ARG A 1004 ? ? -82.54 41.65 44 12 ILE A 949 ? ? -44.91 171.21 45 12 ALA A 950 ? ? -142.83 -2.72 46 12 ARG A 967 ? ? 58.76 15.59 47 13 ALA A 946 ? ? -164.79 -62.77 48 13 MET A 947 ? ? 47.24 17.27 49 13 ARG A 967 ? ? 53.52 14.44 50 14 ALA A 950 ? ? 70.69 -46.97 51 14 ARG A 967 ? ? 56.60 14.77 52 14 ARG A 1004 ? ? -49.83 -108.46 53 14 LEU A 1005 ? ? 35.27 33.08 54 15 ALA A 948 ? ? -46.18 -89.14 55 15 ASP A 988 ? ? -44.67 150.10 56 16 ALA A 948 ? ? 51.26 96.74 57 16 ALA A 950 ? ? -46.33 -16.28 58 16 ARG A 967 ? ? 49.92 20.71 59 16 ASP A 988 ? ? -43.48 150.85 60 17 ARG A 967 ? ? 53.49 17.45 61 17 ASP A 988 ? ? -48.71 150.51 62 18 ALA A 950 ? ? 69.15 -45.03 63 18 ARG A 967 ? ? 49.88 20.25 64 19 ALA A 946 ? ? 46.00 -174.17 65 19 MET A 947 ? ? 66.79 -34.11 66 19 ALA A 950 ? ? 46.23 19.10 67 19 LEU A 951 ? ? 56.24 152.29 68 19 LYS A 968 ? ? -134.86 -137.32 69 19 ASP A 988 ? ? -46.89 150.32 70 20 ILE A 949 ? ? 34.98 -162.51 71 20 ALA A 950 ? ? -168.59 3.86 72 20 LYS A 968 ? ? -147.30 -152.86 #