data_2MXT # _entry.id 2MXT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104178 RCSB ? ? 2MXT PDB pdb_00002mxt 10.2210/pdb2mxt/pdb 25428 BMRB ? ? D_1000104178 WWPDB ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25428 BMRB unspecified . JCSG-430710 TargetTrack unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2MXT _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-01-14 _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Serrano, P.' 1 'Wuthrich, K.' 2 'Beuck, C.' 3 'Joint Center for Structural Genomics (JCSG)' 4 'Partnership for T-Cell Biology (TCELL)' 5 # _citation.id primary _citation.title 'NMR structure of the acidic domain of SYNCRIP' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Serrano, P.' 1 ? primary 'Beuck, C.' 2 ? primary 'Wuthrich, K.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Heterogeneous nuclear ribonucleoprotein Q' _entity.formula_weight 9494.643 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'acidic domain (UNP residues 24-107)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;hnRNP Q, Glycine- and tyrosine-rich RNA-binding protein, GRY-RBP, NS1-associated protein 1, Synaptotagmin-binding, cytoplasmic RNA-interacting protein ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTY RQREK ; _entity_poly.pdbx_seq_one_letter_code_can ;GSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTY RQREK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier JCSG-430710 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 GLU n 1 4 ASN n 1 5 PHE n 1 6 GLN n 1 7 THR n 1 8 LEU n 1 9 LEU n 1 10 ASP n 1 11 ALA n 1 12 GLY n 1 13 LEU n 1 14 PRO n 1 15 GLN n 1 16 LYS n 1 17 VAL n 1 18 ALA n 1 19 GLU n 1 20 LYS n 1 21 LEU n 1 22 ASP n 1 23 GLU n 1 24 ILE n 1 25 TYR n 1 26 VAL n 1 27 ALA n 1 28 GLY n 1 29 LEU n 1 30 VAL n 1 31 ALA n 1 32 HIS n 1 33 SER n 1 34 ASP n 1 35 LEU n 1 36 ASP n 1 37 GLU n 1 38 ARG n 1 39 ALA n 1 40 ILE n 1 41 GLU n 1 42 ALA n 1 43 LEU n 1 44 LYS n 1 45 GLU n 1 46 PHE n 1 47 ASN n 1 48 GLU n 1 49 ASP n 1 50 GLY n 1 51 ALA n 1 52 LEU n 1 53 ALA n 1 54 VAL n 1 55 LEU n 1 56 GLN n 1 57 GLN n 1 58 PHE n 1 59 LYS n 1 60 ASP n 1 61 SER n 1 62 ASP n 1 63 LEU n 1 64 SER n 1 65 HIS n 1 66 VAL n 1 67 GLN n 1 68 ASN n 1 69 LYS n 1 70 SER n 1 71 ALA n 1 72 PHE n 1 73 LEU n 1 74 CYS n 1 75 GLY n 1 76 VAL n 1 77 MET n 1 78 LYS n 1 79 THR n 1 80 TYR n 1 81 ARG n 1 82 GLN n 1 83 ARG n 1 84 GLU n 1 85 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SYNCRIP, HNRPQ, NSAP1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code HNRPQ_HUMAN _struct_ref.pdbx_db_accession O60506 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;SENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDERAIEALKEFNEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYR QREK ; _struct_ref.pdbx_align_begin 24 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2MXT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 85 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O60506 _struct_ref_seq.db_align_beg 24 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 107 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 85 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2MXT _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O60506 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 'APSY 4D-HACANH' 1 2 1 'APSY 5D-HACACONH' 1 3 1 'APSY 5D-CBCACONH' 1 4 1 '2D 1H-15N HSQC' 1 5 1 '3D 1H-15N NOESY' 1 6 1 '3D 1H-13C NOESY aliphatic' 1 7 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.0798 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.2 mM [U-99% 13C; U-98% 15N] protein, 20 mM sodium phosphate, 50 mM sodium chloride, 5 mM sodium azide, 95% H2O/5% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '95% H2O/5% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker AVANCE 1 'Bruker Avance' 800 Bruker AVANCE 2 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2MXT _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 19 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2MXT _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2MXT _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_software.authors ? _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name OPALp _pdbx_nmr_software.version ? _pdbx_nmr_software.ordinal 1 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2MXT _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2MXT _struct.title 'NMR structure of the acidic domain of SYNCRIP (hnRNPQ)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2MXT _struct_keywords.pdbx_keywords SPLICING _struct_keywords.text ;Structural Genomics, PSI-Biology, Acidic domain, SYNCRIP, Splicing factor, SPLICING, Joint Center for Structural Genomics, JCSG, Partnership for T-Cell Biology, TCELL ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 2 ? ALA A 11 ? SER A 2 ALA A 11 1 ? 10 HELX_P HELX_P2 2 PRO A 14 ? ALA A 27 ? PRO A 14 ALA A 27 1 ? 14 HELX_P HELX_P3 3 ASP A 36 ? GLU A 45 ? ASP A 36 GLU A 45 1 ? 10 HELX_P HELX_P4 4 ASN A 47 ? ASP A 60 ? ASN A 47 ASP A 60 1 ? 14 HELX_P HELX_P5 5 ASN A 68 ? GLN A 82 ? ASN A 68 GLN A 82 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2MXT _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ASN 4 4 4 ASN ASN A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 LEU 9 9 9 LEU LEU A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 GLY 12 12 12 GLY GLY A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 LYS 44 44 44 LYS LYS A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 ASN 47 47 47 ASN ASN A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 GLN 57 57 57 GLN GLN A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 SER 61 61 61 SER SER A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ARG 81 81 81 ARG ARG A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LYS 85 85 85 LYS LYS A . n # loop_ _pdbx_SG_project.full_name_of_center _pdbx_SG_project.id _pdbx_SG_project.initial_of_center _pdbx_SG_project.project_name 'Joint Center for Structural Genomics' 1 JCSG PSI:Biology 'Partnership for T-Cell Biology' 2 TCELL PSI:Biology # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-01-21 2 'Structure model' 1 1 2015-06-10 3 'Structure model' 1 2 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Other 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_software 4 3 'Structure model' pdbx_nmr_spectrometer 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 3 'Structure model' '_pdbx_nmr_software.name' 5 3 'Structure model' '_pdbx_nmr_spectrometer.model' 6 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id protein-1 1.2 ? mM '[U-99% 13C; U-98% 15N]' 1 'sodium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 'sodium azide-4' 5 ? mM ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2MXT _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 1516 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 401 _pdbx_nmr_constraints.NOE_long_range_total_count 274 _pdbx_nmr_constraints.NOE_medium_range_total_count 471 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 370 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_other_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count ? _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 15 OD2 A ASP 62 ? ? HG A SER 64 ? ? 1.57 2 15 O A ASP 34 ? ? HG A SER 70 ? ? 1.59 3 18 OD2 A ASP 36 ? ? HG A SER 70 ? ? 1.50 4 19 OD1 A ASP 36 ? ? HG A SER 70 ? ? 1.56 5 19 OD1 A ASP 62 ? ? HG A SER 64 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 29 ? ? -94.48 -75.03 2 1 GLU A 45 ? ? -76.84 34.60 3 1 ASP A 60 ? ? -76.96 46.49 4 1 LEU A 63 ? ? -95.59 30.20 5 1 HIS A 65 ? ? -80.19 39.22 6 1 GLN A 67 ? ? -142.68 -70.52 7 1 ASN A 68 ? ? -56.99 75.80 8 1 GLN A 82 ? ? -101.03 69.37 9 2 GLU A 45 ? ? -77.12 38.45 10 3 LEU A 29 ? ? -82.09 -74.59 11 3 ALA A 31 ? ? -73.17 26.89 12 3 HIS A 32 ? ? 55.46 -21.24 13 4 LEU A 29 ? ? -71.36 -81.94 14 4 ASP A 60 ? ? -74.99 49.01 15 4 LEU A 63 ? ? -76.76 46.33 16 4 GLU A 84 ? ? -90.63 49.87 17 5 SER A 2 ? ? -127.16 -165.37 18 6 ALA A 11 ? ? -68.16 15.81 19 6 GLU A 48 ? ? -52.14 -70.86 20 6 ARG A 83 ? ? -140.29 24.69 21 7 ASP A 60 ? ? -76.55 33.81 22 7 ARG A 83 ? ? -119.99 64.33 23 7 GLU A 84 ? ? -115.17 -164.38 24 8 HIS A 65 ? ? -88.05 31.15 25 9 GLU A 48 ? ? -44.77 -70.87 26 9 ASP A 60 ? ? -79.46 46.51 27 10 ALA A 11 ? ? -86.32 30.29 28 10 ASP A 60 ? ? -72.75 28.14 29 10 ASP A 62 ? ? -116.16 79.49 30 10 HIS A 65 ? ? -106.44 64.08 31 10 ASN A 68 ? ? -115.18 71.88 32 11 SER A 2 ? ? -107.65 -167.20 33 11 GLU A 45 ? ? -69.30 11.99 34 11 ASN A 47 ? ? -57.18 176.90 35 11 ASP A 60 ? ? -75.49 48.23 36 11 ARG A 83 ? ? -105.24 76.11 37 12 ALA A 27 ? ? -95.06 36.42 38 12 GLU A 45 ? ? -85.42 43.70 39 12 HIS A 65 ? ? 59.39 10.26 40 12 GLN A 67 ? ? -54.17 -85.00 41 12 GLU A 84 ? ? -83.15 30.59 42 13 GLU A 3 ? ? -74.04 23.52 43 14 LEU A 29 ? ? -77.59 -85.20 44 14 ASP A 60 ? ? -80.18 45.22 45 15 SER A 2 ? ? -140.83 -154.55 46 15 PRO A 14 ? ? -62.01 -164.42 47 15 LEU A 29 ? ? -79.70 -83.75 48 15 SER A 64 ? ? -61.94 83.71 49 15 GLN A 82 ? ? -107.08 69.44 50 16 GLN A 67 ? ? -122.32 -85.68 51 17 ASP A 34 ? ? -73.84 30.66 52 17 GLU A 45 ? ? -76.73 43.51 53 17 GLU A 48 ? ? -47.83 -70.99 54 17 ASP A 62 ? ? -108.46 77.40 55 17 LEU A 63 ? ? -77.17 49.53 56 17 ARG A 81 ? ? -72.78 24.71 57 18 GLN A 67 ? ? -66.82 -83.35 58 19 HIS A 32 ? ? 56.11 -21.77 59 19 SER A 64 ? ? -59.08 95.58 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 9 VAL A 26 ? ? ALA A 27 ? ? -144.00 2 14 SER A 61 ? ? ASP A 62 ? ? -146.94 3 16 GLU A 84 ? ? LYS A 85 ? ? -146.39 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 38 ? ? 0.107 'SIDE CHAIN' 2 2 ARG A 83 ? ? 0.095 'SIDE CHAIN' 3 3 ARG A 83 ? ? 0.104 'SIDE CHAIN' 4 6 ARG A 81 ? ? 0.090 'SIDE CHAIN' 5 6 ARG A 83 ? ? 0.088 'SIDE CHAIN' 6 7 TYR A 25 ? ? 0.081 'SIDE CHAIN' 7 8 TYR A 25 ? ? 0.105 'SIDE CHAIN' 8 11 ARG A 38 ? ? 0.081 'SIDE CHAIN' 9 12 TYR A 25 ? ? 0.062 'SIDE CHAIN' 10 13 TYR A 25 ? ? 0.093 'SIDE CHAIN' 11 14 ARG A 38 ? ? 0.144 'SIDE CHAIN' 12 15 TYR A 25 ? ? 0.106 'SIDE CHAIN' 13 16 ARG A 38 ? ? 0.096 'SIDE CHAIN' 14 16 ARG A 81 ? ? 0.185 'SIDE CHAIN' #