data_2N0Z # _entry.id 2N0Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB RCSB104284 ? ? PDB 2N0Z pdb_00002n0z 10.2210/pdb2n0z/pdb BMRB 25541 ? 10.13018/BMR25541 WWPDB D_1000104284 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-09 2 'Structure model' 1 1 2016-03-30 3 'Structure model' 1 2 2016-04-06 4 'Structure model' 1 3 2016-04-27 5 'Structure model' 1 4 2021-10-13 6 'Structure model' 2 0 2021-10-20 7 'Structure model' 2 1 2023-06-14 8 'Structure model' 2 2 2024-05-15 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 6 'Structure model' author 'Coordinate replacement' 'Atoms with unrealistic or zero occupancies' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 6 'Structure model' Advisory 7 6 'Structure model' 'Atomic model' 8 6 'Structure model' 'Author supporting evidence' 9 6 'Structure model' 'Data collection' 10 6 'Structure model' 'Database references' 11 6 'Structure model' 'Derived calculations' 12 6 'Structure model' 'Experimental preparation' 13 6 'Structure model' Other 14 6 'Structure model' 'Refinement description' 15 6 'Structure model' 'Source and taxonomy' 16 6 'Structure model' 'Structure summary' 17 7 'Structure model' Other 18 8 'Structure model' 'Data collection' 19 8 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_nmr_software 3 5 'Structure model' pdbx_nmr_spectrometer 4 5 'Structure model' struct_ref_seq_dif 5 6 'Structure model' atom_site 6 6 'Structure model' entity_name_com 7 6 'Structure model' entity_src_gen 8 6 'Structure model' pdbx_audit_support 9 6 'Structure model' pdbx_database_related 10 6 'Structure model' pdbx_database_status 11 6 'Structure model' pdbx_nmr_ensemble 12 6 'Structure model' pdbx_nmr_exptl 13 6 'Structure model' pdbx_nmr_exptl_sample 14 6 'Structure model' pdbx_nmr_exptl_sample_conditions 15 6 'Structure model' pdbx_nmr_refine 16 6 'Structure model' pdbx_nmr_sample_details 17 6 'Structure model' pdbx_nmr_software 18 6 'Structure model' pdbx_nmr_spectrometer 19 6 'Structure model' pdbx_poly_seq_scheme 20 6 'Structure model' pdbx_unobs_or_zero_occ_residues 21 6 'Structure model' pdbx_validate_close_contact 22 6 'Structure model' pdbx_validate_torsion 23 6 'Structure model' struct 24 6 'Structure model' struct_conf 25 6 'Structure model' struct_ref 26 6 'Structure model' struct_ref_seq 27 6 'Structure model' struct_ref_seq_dif 28 7 'Structure model' pdbx_database_status 29 8 'Structure model' chem_comp_atom 30 8 'Structure model' chem_comp_bond 31 8 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_nmr_software.name' 4 5 'Structure model' '_pdbx_nmr_spectrometer.model' 5 5 'Structure model' '_struct_ref_seq_dif.details' 6 6 'Structure model' '_entity_src_gen.gene_src_common_name' 7 6 'Structure model' '_entity_src_gen.pdbx_beg_seq_num' 8 6 'Structure model' '_entity_src_gen.pdbx_end_seq_num' 9 6 'Structure model' '_entity_src_gen.pdbx_gene_src_gene' 10 6 'Structure model' '_entity_src_gen.pdbx_seq_type' 11 6 'Structure model' '_pdbx_database_status.SG_entry' 12 6 'Structure model' '_pdbx_database_status.deposit_site' 13 6 'Structure model' '_pdbx_nmr_ensemble.conformer_selection_criteria' 14 6 'Structure model' '_pdbx_nmr_ensemble.conformers_calculated_total_number' 15 6 'Structure model' '_pdbx_nmr_exptl.sample_state' 16 6 'Structure model' '_pdbx_nmr_exptl.spectrometer_id' 17 6 'Structure model' '_pdbx_nmr_exptl_sample.component' 18 6 'Structure model' '_pdbx_nmr_exptl_sample_conditions.ionic_strength_units' 19 6 'Structure model' '_pdbx_nmr_exptl_sample_conditions.label' 20 6 'Structure model' '_pdbx_nmr_exptl_sample_conditions.pH_units' 21 6 'Structure model' '_pdbx_nmr_refine.software_ordinal' 22 6 'Structure model' '_pdbx_nmr_sample_details.contents' 23 6 'Structure model' '_pdbx_nmr_sample_details.label' 24 6 'Structure model' '_pdbx_nmr_sample_details.type' 25 6 'Structure model' '_pdbx_nmr_software.authors' 26 6 'Structure model' '_pdbx_nmr_software.classification' 27 6 'Structure model' '_pdbx_nmr_software.name' 28 6 'Structure model' '_pdbx_nmr_software.ordinal' 29 6 'Structure model' '_pdbx_nmr_software.version' 30 6 'Structure model' '_pdbx_nmr_spectrometer.type' 31 6 'Structure model' '_pdbx_poly_seq_scheme.auth_mon_id' 32 6 'Structure model' '_pdbx_poly_seq_scheme.auth_seq_num' 33 6 'Structure model' '_pdbx_poly_seq_scheme.pdb_mon_id' 34 6 'Structure model' '_struct.pdbx_CASP_flag' 35 6 'Structure model' '_struct_conf.beg_auth_comp_id' 36 6 'Structure model' '_struct_conf.beg_auth_seq_id' 37 6 'Structure model' '_struct_conf.beg_label_comp_id' 38 6 'Structure model' '_struct_conf.beg_label_seq_id' 39 6 'Structure model' '_struct_conf.end_auth_comp_id' 40 6 'Structure model' '_struct_conf.end_auth_seq_id' 41 6 'Structure model' '_struct_conf.end_label_comp_id' 42 6 'Structure model' '_struct_conf.end_label_seq_id' 43 6 'Structure model' '_struct_conf.pdbx_PDB_helix_id' 44 6 'Structure model' '_struct_conf.pdbx_PDB_helix_length' 45 6 'Structure model' '_struct_ref.db_code' 46 6 'Structure model' '_struct_ref.pdbx_align_begin' 47 6 'Structure model' '_struct_ref.pdbx_db_accession' 48 6 'Structure model' '_struct_ref_seq.db_align_beg' 49 6 'Structure model' '_struct_ref_seq.db_align_end' 50 6 'Structure model' '_struct_ref_seq.pdbx_db_accession' 51 6 'Structure model' '_struct_ref_seq_dif.pdbx_seq_db_accession_code' 52 7 'Structure model' '_pdbx_database_status.status_code_nmr_data' 53 8 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.entry_id 2N0Z _pdbx_database_status.recvd_initial_deposition_date 2015-03-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type BMRB . 25541 unspecified PDB . 2N10 unspecified PDB . 2N11 unspecified PDB . 2N12 unspecified PDB . 2N13 unspecified PDB . 6E5N unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email kylie.walters@nih.gov _pdbx_contact_author.name_first Kylie _pdbx_contact_author.name_last Walters _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-7590-2891 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'He, F.' 1 ? 'Walters, K.' 2 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Cell Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2211-1247 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 14 _citation.language ? _citation.page_first 2683 _citation.page_last 2694 _citation.title 'Myosin VI Contains a Compact Structural Motif that Binds to Ubiquitin Chains.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.celrep.2016.01.079 _citation.pdbx_database_id_PubMed 26971995 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'He, F.' 1 ? primary 'Wollscheid, H.P.' 2 ? primary 'Nowicka, U.' 3 ? primary 'Biancospino, M.' 4 ? primary 'Valentini, E.' 5 ? primary 'Ehlinger, A.' 6 ? primary 'Acconcia, F.' 7 ? primary 'Magistrati, E.' 8 ? primary 'Polo, S.' 9 ? primary 'Walters, K.J.' 10 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Unconventional myosin-VI' _entity.formula_weight 5922.730 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'residues 1080-1122' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GPLGSPNSGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYH _entity_poly.pdbx_seq_one_letter_code_can GPLGSPNSGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYH _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 PRO n 1 7 ASN n 1 8 SER n 1 9 GLY n 1 10 THR n 1 11 LYS n 1 12 LYS n 1 13 TYR n 1 14 ASP n 1 15 LEU n 1 16 SER n 1 17 LYS n 1 18 TRP n 1 19 LYS n 1 20 TYR n 1 21 ALA n 1 22 GLU n 1 23 LEU n 1 24 ARG n 1 25 ASP n 1 26 THR n 1 27 ILE n 1 28 ASN n 1 29 THR n 1 30 SER n 1 31 CYS n 1 32 ASP n 1 33 ILE n 1 34 GLU n 1 35 LEU n 1 36 LEU n 1 37 ALA n 1 38 ALA n 1 39 CYS n 1 40 ARG n 1 41 GLU n 1 42 GLU n 1 43 PHE n 1 44 HIS n 1 45 ARG n 1 46 ARG n 1 47 LEU n 1 48 LYS n 1 49 VAL n 1 50 TYR n 1 51 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 51 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MYO6 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector pGEX6p _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 LEU 3 3 3 LEU LEU A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 ASN 7 7 7 ASN ASN A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 TRP 18 18 18 TRP TRP A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 ALA 21 21 21 ALA ALA A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 ASP 32 32 32 ASP ASP A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 HIS 44 44 44 HIS HIS A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 HIS 51 51 51 HIS HIS A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 2N0Z _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N0Z _struct.title 'Solution structure of MyUb (1080-1122) of human Myosin VI' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 2N0Z _struct_keywords.text 'MOTOR PROTEIN, PROTEIN TRANSPORT' _struct_keywords.pdbx_keywords 'MOTOR PROTEIN,PROTEIN TRANSPORT' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5JVM0_HUMAN _struct_ref.pdbx_db_accession Q5JVM0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYH _struct_ref.pdbx_align_begin 130 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N0Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 9 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 51 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5JVM0 _struct_ref_seq.db_align_beg 130 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 172 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 9 _struct_ref_seq.pdbx_auth_seq_align_end 51 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N0Z GLY A 1 ? UNP Q5JVM0 ? ? 'expression tag' 1 1 1 2N0Z PRO A 2 ? UNP Q5JVM0 ? ? 'expression tag' 2 2 1 2N0Z LEU A 3 ? UNP Q5JVM0 ? ? 'expression tag' 3 3 1 2N0Z GLY A 4 ? UNP Q5JVM0 ? ? 'expression tag' 4 4 1 2N0Z SER A 5 ? UNP Q5JVM0 ? ? 'expression tag' 5 5 1 2N0Z PRO A 6 ? UNP Q5JVM0 ? ? 'expression tag' 6 6 1 2N0Z ASN A 7 ? UNP Q5JVM0 ? ? 'expression tag' 7 7 1 2N0Z SER A 8 ? UNP Q5JVM0 ? ? 'expression tag' 8 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LYS A 19 ? SER A 30 ? LYS A 19 SER A 30 1 ? 12 HELX_P HELX_P2 AA2 ASP A 32 ? LYS A 48 ? ASP A 32 LYS A 48 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -46.76 99.16 2 1 LEU A 3 ? ? 58.38 3.60 3 1 SER A 5 ? ? -167.35 60.24 4 1 SER A 8 ? ? 45.73 -101.95 5 1 THR A 10 ? ? -74.85 -158.58 6 1 LYS A 12 ? ? -79.35 -111.61 7 1 LEU A 15 ? ? -107.89 56.13 8 1 THR A 29 ? ? -87.70 -76.26 9 1 ASP A 32 ? ? -173.32 122.42 10 1 TYR A 50 ? ? 52.65 103.29 11 2 PRO A 2 ? ? -74.20 31.48 12 2 LEU A 3 ? ? -45.81 107.28 13 2 SER A 5 ? ? 53.35 76.55 14 2 PRO A 6 ? ? -46.72 -14.24 15 2 SER A 8 ? ? -59.31 -8.56 16 2 LYS A 12 ? ? -78.84 21.28 17 2 THR A 29 ? ? -90.33 -71.39 18 2 ASP A 32 ? ? -173.55 119.03 19 2 TYR A 50 ? ? 69.11 149.21 20 3 SER A 5 ? ? -166.82 60.29 21 3 THR A 10 ? ? -170.92 32.70 22 3 LEU A 15 ? ? -111.85 59.30 23 3 THR A 29 ? ? -129.19 -76.41 24 3 ASP A 32 ? ? -170.63 115.79 25 3 TYR A 50 ? ? -157.14 39.30 26 4 PRO A 2 ? ? -74.02 27.65 27 4 LEU A 3 ? ? 44.42 -136.11 28 4 SER A 5 ? ? 56.24 162.83 29 4 SER A 8 ? ? -161.62 66.70 30 4 LYS A 12 ? ? -69.21 -130.89 31 4 LEU A 15 ? ? -106.17 54.84 32 4 THR A 29 ? ? -130.58 -75.36 33 4 ASP A 32 ? ? -173.42 119.12 34 4 TYR A 50 ? ? -170.56 -178.56 35 5 PRO A 2 ? ? -47.73 157.64 36 5 SER A 5 ? ? -166.99 66.74 37 5 PRO A 6 ? ? -46.55 82.86 38 5 SER A 8 ? ? -170.46 -65.83 39 5 THR A 10 ? ? -106.08 58.57 40 5 LYS A 12 ? ? 55.05 -144.54 41 5 LEU A 15 ? ? -101.03 51.88 42 5 THR A 29 ? ? -92.11 -72.73 43 5 ASP A 32 ? ? -173.70 120.25 44 5 VAL A 49 ? ? -151.78 -82.68 45 6 SER A 5 ? ? -164.17 60.52 46 6 PRO A 6 ? ? -74.46 30.49 47 6 ASN A 7 ? ? -159.48 -70.06 48 6 LYS A 12 ? ? 46.53 -104.07 49 6 ASP A 32 ? ? -171.89 116.08 50 6 GLU A 34 ? ? -73.65 -70.53 51 6 TYR A 50 ? ? -78.05 -93.99 52 7 LEU A 3 ? ? -152.66 14.81 53 7 SER A 5 ? ? -161.08 58.56 54 7 THR A 10 ? ? 48.11 -178.23 55 7 LYS A 11 ? ? -86.14 -138.07 56 7 LEU A 15 ? ? -109.63 53.18 57 7 THR A 29 ? ? -89.02 -71.94 58 7 ASP A 32 ? ? -174.18 121.51 59 7 VAL A 49 ? ? -44.90 -85.62 60 8 PRO A 2 ? ? -47.58 166.40 61 8 LEU A 3 ? ? -72.95 -138.47 62 8 SER A 8 ? ? -60.20 -150.61 63 8 THR A 10 ? ? -152.12 -120.30 64 8 LYS A 11 ? ? 46.29 78.33 65 8 LYS A 12 ? ? -50.00 -178.13 66 8 LEU A 15 ? ? -101.89 53.64 67 8 THR A 29 ? ? -127.07 -78.31 68 8 ASP A 32 ? ? -174.17 115.66 69 8 LYS A 48 ? ? -45.57 -74.26 70 8 TYR A 50 ? ? -78.08 45.16 71 9 SER A 5 ? ? -160.94 59.00 72 9 PRO A 6 ? ? -74.45 -161.95 73 9 ASN A 7 ? ? -154.88 24.74 74 9 SER A 8 ? ? -62.47 97.24 75 9 LYS A 12 ? ? -67.73 -105.67 76 9 THR A 29 ? ? -86.12 -76.19 77 9 ASP A 32 ? ? -174.01 122.22 78 10 PRO A 6 ? ? -39.33 137.58 79 10 SER A 8 ? ? 179.96 157.26 80 10 LYS A 12 ? ? -151.52 25.04 81 10 LEU A 15 ? ? -102.29 49.73 82 10 THR A 29 ? ? -86.41 -76.95 83 10 ASP A 32 ? ? -173.81 122.21 84 10 LYS A 48 ? ? -154.20 84.39 85 10 TYR A 50 ? ? -67.34 73.77 86 11 PRO A 2 ? ? -74.38 35.78 87 11 LEU A 3 ? ? -137.39 -57.30 88 11 SER A 5 ? ? -162.32 59.81 89 11 SER A 8 ? ? -170.15 118.63 90 11 THR A 10 ? ? -97.62 59.78 91 11 LYS A 12 ? ? 44.75 -168.53 92 11 LEU A 15 ? ? -106.04 55.73 93 11 THR A 29 ? ? -89.87 -72.02 94 11 ASP A 32 ? ? -174.25 122.95 95 12 LEU A 3 ? ? -72.08 -74.44 96 12 LYS A 12 ? ? 51.26 -136.67 97 12 LEU A 15 ? ? -103.54 45.62 98 12 ASP A 32 ? ? -174.09 118.20 99 12 GLU A 34 ? ? -76.28 -70.60 100 13 PRO A 2 ? ? -46.51 167.63 101 13 ASN A 7 ? ? -160.53 74.80 102 13 LYS A 12 ? ? -45.05 -15.02 103 13 THR A 29 ? ? -80.58 -76.09 104 13 ASP A 32 ? ? -168.66 117.28 105 13 VAL A 49 ? ? -83.67 -155.69 106 13 TYR A 50 ? ? -61.76 -99.53 107 14 PRO A 2 ? ? -46.83 -15.99 108 14 LEU A 3 ? ? -77.88 -89.20 109 14 SER A 5 ? ? 46.06 71.92 110 14 PRO A 6 ? ? -47.36 98.20 111 14 ASN A 7 ? ? 55.38 108.83 112 14 THR A 10 ? ? -162.12 53.51 113 14 LYS A 11 ? ? 64.39 -135.97 114 14 LYS A 12 ? ? -146.92 24.37 115 14 LEU A 15 ? ? -117.20 56.23 116 14 THR A 29 ? ? -83.95 -72.77 117 14 ASP A 32 ? ? -173.33 116.11 118 14 VAL A 49 ? ? -91.62 49.48 119 14 TYR A 50 ? ? -45.19 105.62 120 15 LEU A 3 ? ? 54.85 8.38 121 15 SER A 5 ? ? 59.79 72.56 122 15 PRO A 6 ? ? -48.11 -177.93 123 15 ASN A 7 ? ? 59.36 -77.43 124 15 THR A 10 ? ? -158.73 19.58 125 15 LYS A 11 ? ? 51.88 173.59 126 15 LEU A 15 ? ? -104.88 45.83 127 15 THR A 29 ? ? -88.51 -72.66 128 15 ASP A 32 ? ? -173.28 122.66 129 15 TYR A 50 ? ? -76.94 32.85 130 16 LEU A 3 ? ? 49.67 -178.54 131 16 SER A 5 ? ? -167.09 71.99 132 16 THR A 10 ? ? -68.83 61.49 133 16 LYS A 11 ? ? -64.42 91.32 134 16 LYS A 12 ? ? 51.72 -146.68 135 16 THR A 29 ? ? -76.44 -77.19 136 16 ASP A 32 ? ? -173.96 120.79 137 17 SER A 8 ? ? -163.43 100.92 138 17 LYS A 12 ? ? 54.30 -179.45 139 17 LEU A 15 ? ? -107.77 57.22 140 17 THR A 29 ? ? -87.78 -77.18 141 17 ASP A 32 ? ? -171.04 125.04 142 17 TYR A 50 ? ? 46.50 -174.32 143 18 ASN A 7 ? ? -172.71 -159.57 144 18 SER A 8 ? ? -166.33 -78.19 145 18 THR A 10 ? ? -65.46 74.65 146 18 LYS A 11 ? ? 50.40 83.61 147 18 LYS A 12 ? ? -74.74 22.39 148 18 LEU A 15 ? ? -99.70 54.16 149 18 ASP A 32 ? ? -174.14 117.75 150 19 PRO A 2 ? ? -47.62 -179.93 151 19 SER A 5 ? ? 45.20 72.36 152 19 PRO A 6 ? ? -47.63 99.77 153 19 LYS A 11 ? ? -163.20 21.95 154 19 LEU A 15 ? ? -105.57 54.03 155 19 THR A 29 ? ? -89.21 -77.15 156 19 ASP A 32 ? ? -174.04 120.08 157 20 SER A 5 ? ? -169.17 69.77 158 20 PRO A 6 ? ? -47.63 -11.82 159 20 ASN A 7 ? ? -173.99 142.76 160 20 LYS A 11 ? ? -147.12 -120.59 161 20 LYS A 12 ? ? -87.42 33.62 162 20 LEU A 15 ? ? -115.48 50.92 163 20 THR A 29 ? ? -84.90 -76.73 164 20 ASP A 32 ? ? -171.85 122.52 165 20 TYR A 50 ? ? 51.48 -89.44 # _pdbx_nmr_ensemble.entry_id 2N0Z _pdbx_nmr_ensemble.conformers_calculated_total_number 98 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2N0Z _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.3 mM [U-13C; U-15N] Unconventional myosin-VI, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details ? # _pdbx_nmr_exptl_sample.solution_id 1 _pdbx_nmr_exptl_sample.component 'Unconventional myosin-VI' _pdbx_nmr_exptl_sample.concentration 0.3 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-13C; U-15N]' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 283 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.ionic_strength 50 _pdbx_nmr_exptl_sample_conditions.details ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '3D 1H-15N NOESY' 1 isotropic 2 1 1 '3D 1H-13C NOESY' 1 isotropic # _pdbx_nmr_refine.entry_id 2N0Z _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 2 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 2 refinement 'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'chemical shift assignment' KUJIRA ? 'Naohiro Kobayashi' 5 'structure calculation' CYANA 2.1 'Guntert, Mumenthaler and Wuthrich' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLU N N N N 88 GLU CA C N S 89 GLU C C N N 90 GLU O O N N 91 GLU CB C N N 92 GLU CG C N N 93 GLU CD C N N 94 GLU OE1 O N N 95 GLU OE2 O N N 96 GLU OXT O N N 97 GLU H H N N 98 GLU H2 H N N 99 GLU HA H N N 100 GLU HB2 H N N 101 GLU HB3 H N N 102 GLU HG2 H N N 103 GLU HG3 H N N 104 GLU HE2 H N N 105 GLU HXT H N N 106 GLY N N N N 107 GLY CA C N N 108 GLY C C N N 109 GLY O O N N 110 GLY OXT O N N 111 GLY H H N N 112 GLY H2 H N N 113 GLY HA2 H N N 114 GLY HA3 H N N 115 GLY HXT H N N 116 HIS N N N N 117 HIS CA C N S 118 HIS C C N N 119 HIS O O N N 120 HIS CB C N N 121 HIS CG C Y N 122 HIS ND1 N Y N 123 HIS CD2 C Y N 124 HIS CE1 C Y N 125 HIS NE2 N Y N 126 HIS OXT O N N 127 HIS H H N N 128 HIS H2 H N N 129 HIS HA H N N 130 HIS HB2 H N N 131 HIS HB3 H N N 132 HIS HD1 H N N 133 HIS HD2 H N N 134 HIS HE1 H N N 135 HIS HE2 H N N 136 HIS HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 PHE N N N N 207 PHE CA C N S 208 PHE C C N N 209 PHE O O N N 210 PHE CB C N N 211 PHE CG C Y N 212 PHE CD1 C Y N 213 PHE CD2 C Y N 214 PHE CE1 C Y N 215 PHE CE2 C Y N 216 PHE CZ C Y N 217 PHE OXT O N N 218 PHE H H N N 219 PHE H2 H N N 220 PHE HA H N N 221 PHE HB2 H N N 222 PHE HB3 H N N 223 PHE HD1 H N N 224 PHE HD2 H N N 225 PHE HE1 H N N 226 PHE HE2 H N N 227 PHE HZ H N N 228 PHE HXT H N N 229 PRO N N N N 230 PRO CA C N S 231 PRO C C N N 232 PRO O O N N 233 PRO CB C N N 234 PRO CG C N N 235 PRO CD C N N 236 PRO OXT O N N 237 PRO H H N N 238 PRO HA H N N 239 PRO HB2 H N N 240 PRO HB3 H N N 241 PRO HG2 H N N 242 PRO HG3 H N N 243 PRO HD2 H N N 244 PRO HD3 H N N 245 PRO HXT H N N 246 SER N N N N 247 SER CA C N S 248 SER C C N N 249 SER O O N N 250 SER CB C N N 251 SER OG O N N 252 SER OXT O N N 253 SER H H N N 254 SER H2 H N N 255 SER HA H N N 256 SER HB2 H N N 257 SER HB3 H N N 258 SER HG H N N 259 SER HXT H N N 260 THR N N N N 261 THR CA C N S 262 THR C C N N 263 THR O O N N 264 THR CB C N R 265 THR OG1 O N N 266 THR CG2 C N N 267 THR OXT O N N 268 THR H H N N 269 THR H2 H N N 270 THR HA H N N 271 THR HB H N N 272 THR HG1 H N N 273 THR HG21 H N N 274 THR HG22 H N N 275 THR HG23 H N N 276 THR HXT H N N 277 TRP N N N N 278 TRP CA C N S 279 TRP C C N N 280 TRP O O N N 281 TRP CB C N N 282 TRP CG C Y N 283 TRP CD1 C Y N 284 TRP CD2 C Y N 285 TRP NE1 N Y N 286 TRP CE2 C Y N 287 TRP CE3 C Y N 288 TRP CZ2 C Y N 289 TRP CZ3 C Y N 290 TRP CH2 C Y N 291 TRP OXT O N N 292 TRP H H N N 293 TRP H2 H N N 294 TRP HA H N N 295 TRP HB2 H N N 296 TRP HB3 H N N 297 TRP HD1 H N N 298 TRP HE1 H N N 299 TRP HE3 H N N 300 TRP HZ2 H N N 301 TRP HZ3 H N N 302 TRP HH2 H N N 303 TRP HXT H N N 304 TYR N N N N 305 TYR CA C N S 306 TYR C C N N 307 TYR O O N N 308 TYR CB C N N 309 TYR CG C Y N 310 TYR CD1 C Y N 311 TYR CD2 C Y N 312 TYR CE1 C Y N 313 TYR CE2 C Y N 314 TYR CZ C Y N 315 TYR OH O N N 316 TYR OXT O N N 317 TYR H H N N 318 TYR H2 H N N 319 TYR HA H N N 320 TYR HB2 H N N 321 TYR HB3 H N N 322 TYR HD1 H N N 323 TYR HD2 H N N 324 TYR HE1 H N N 325 TYR HE2 H N N 326 TYR HH H N N 327 TYR HXT H N N 328 VAL N N N N 329 VAL CA C N S 330 VAL C C N N 331 VAL O O N N 332 VAL CB C N N 333 VAL CG1 C N N 334 VAL CG2 C N N 335 VAL OXT O N N 336 VAL H H N N 337 VAL H2 H N N 338 VAL HA H N N 339 VAL HB H N N 340 VAL HG11 H N N 341 VAL HG12 H N N 342 VAL HG13 H N N 343 VAL HG21 H N N 344 VAL HG22 H N N 345 VAL HG23 H N N 346 VAL HXT H N N 347 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 ILE N CA sing N N 131 ILE N H sing N N 132 ILE N H2 sing N N 133 ILE CA C sing N N 134 ILE CA CB sing N N 135 ILE CA HA sing N N 136 ILE C O doub N N 137 ILE C OXT sing N N 138 ILE CB CG1 sing N N 139 ILE CB CG2 sing N N 140 ILE CB HB sing N N 141 ILE CG1 CD1 sing N N 142 ILE CG1 HG12 sing N N 143 ILE CG1 HG13 sing N N 144 ILE CG2 HG21 sing N N 145 ILE CG2 HG22 sing N N 146 ILE CG2 HG23 sing N N 147 ILE CD1 HD11 sing N N 148 ILE CD1 HD12 sing N N 149 ILE CD1 HD13 sing N N 150 ILE OXT HXT sing N N 151 LEU N CA sing N N 152 LEU N H sing N N 153 LEU N H2 sing N N 154 LEU CA C sing N N 155 LEU CA CB sing N N 156 LEU CA HA sing N N 157 LEU C O doub N N 158 LEU C OXT sing N N 159 LEU CB CG sing N N 160 LEU CB HB2 sing N N 161 LEU CB HB3 sing N N 162 LEU CG CD1 sing N N 163 LEU CG CD2 sing N N 164 LEU CG HG sing N N 165 LEU CD1 HD11 sing N N 166 LEU CD1 HD12 sing N N 167 LEU CD1 HD13 sing N N 168 LEU CD2 HD21 sing N N 169 LEU CD2 HD22 sing N N 170 LEU CD2 HD23 sing N N 171 LEU OXT HXT sing N N 172 LYS N CA sing N N 173 LYS N H sing N N 174 LYS N H2 sing N N 175 LYS CA C sing N N 176 LYS CA CB sing N N 177 LYS CA HA sing N N 178 LYS C O doub N N 179 LYS C OXT sing N N 180 LYS CB CG sing N N 181 LYS CB HB2 sing N N 182 LYS CB HB3 sing N N 183 LYS CG CD sing N N 184 LYS CG HG2 sing N N 185 LYS CG HG3 sing N N 186 LYS CD CE sing N N 187 LYS CD HD2 sing N N 188 LYS CD HD3 sing N N 189 LYS CE NZ sing N N 190 LYS CE HE2 sing N N 191 LYS CE HE3 sing N N 192 LYS NZ HZ1 sing N N 193 LYS NZ HZ2 sing N N 194 LYS NZ HZ3 sing N N 195 LYS OXT HXT sing N N 196 PHE N CA sing N N 197 PHE N H sing N N 198 PHE N H2 sing N N 199 PHE CA C sing N N 200 PHE CA CB sing N N 201 PHE CA HA sing N N 202 PHE C O doub N N 203 PHE C OXT sing N N 204 PHE CB CG sing N N 205 PHE CB HB2 sing N N 206 PHE CB HB3 sing N N 207 PHE CG CD1 doub Y N 208 PHE CG CD2 sing Y N 209 PHE CD1 CE1 sing Y N 210 PHE CD1 HD1 sing N N 211 PHE CD2 CE2 doub Y N 212 PHE CD2 HD2 sing N N 213 PHE CE1 CZ doub Y N 214 PHE CE1 HE1 sing N N 215 PHE CE2 CZ sing Y N 216 PHE CE2 HE2 sing N N 217 PHE CZ HZ sing N N 218 PHE OXT HXT sing N N 219 PRO N CA sing N N 220 PRO N CD sing N N 221 PRO N H sing N N 222 PRO CA C sing N N 223 PRO CA CB sing N N 224 PRO CA HA sing N N 225 PRO C O doub N N 226 PRO C OXT sing N N 227 PRO CB CG sing N N 228 PRO CB HB2 sing N N 229 PRO CB HB3 sing N N 230 PRO CG CD sing N N 231 PRO CG HG2 sing N N 232 PRO CG HG3 sing N N 233 PRO CD HD2 sing N N 234 PRO CD HD3 sing N N 235 PRO OXT HXT sing N N 236 SER N CA sing N N 237 SER N H sing N N 238 SER N H2 sing N N 239 SER CA C sing N N 240 SER CA CB sing N N 241 SER CA HA sing N N 242 SER C O doub N N 243 SER C OXT sing N N 244 SER CB OG sing N N 245 SER CB HB2 sing N N 246 SER CB HB3 sing N N 247 SER OG HG sing N N 248 SER OXT HXT sing N N 249 THR N CA sing N N 250 THR N H sing N N 251 THR N H2 sing N N 252 THR CA C sing N N 253 THR CA CB sing N N 254 THR CA HA sing N N 255 THR C O doub N N 256 THR C OXT sing N N 257 THR CB OG1 sing N N 258 THR CB CG2 sing N N 259 THR CB HB sing N N 260 THR OG1 HG1 sing N N 261 THR CG2 HG21 sing N N 262 THR CG2 HG22 sing N N 263 THR CG2 HG23 sing N N 264 THR OXT HXT sing N N 265 TRP N CA sing N N 266 TRP N H sing N N 267 TRP N H2 sing N N 268 TRP CA C sing N N 269 TRP CA CB sing N N 270 TRP CA HA sing N N 271 TRP C O doub N N 272 TRP C OXT sing N N 273 TRP CB CG sing N N 274 TRP CB HB2 sing N N 275 TRP CB HB3 sing N N 276 TRP CG CD1 doub Y N 277 TRP CG CD2 sing Y N 278 TRP CD1 NE1 sing Y N 279 TRP CD1 HD1 sing N N 280 TRP CD2 CE2 doub Y N 281 TRP CD2 CE3 sing Y N 282 TRP NE1 CE2 sing Y N 283 TRP NE1 HE1 sing N N 284 TRP CE2 CZ2 sing Y N 285 TRP CE3 CZ3 doub Y N 286 TRP CE3 HE3 sing N N 287 TRP CZ2 CH2 doub Y N 288 TRP CZ2 HZ2 sing N N 289 TRP CZ3 CH2 sing Y N 290 TRP CZ3 HZ3 sing N N 291 TRP CH2 HH2 sing N N 292 TRP OXT HXT sing N N 293 TYR N CA sing N N 294 TYR N H sing N N 295 TYR N H2 sing N N 296 TYR CA C sing N N 297 TYR CA CB sing N N 298 TYR CA HA sing N N 299 TYR C O doub N N 300 TYR C OXT sing N N 301 TYR CB CG sing N N 302 TYR CB HB2 sing N N 303 TYR CB HB3 sing N N 304 TYR CG CD1 doub Y N 305 TYR CG CD2 sing Y N 306 TYR CD1 CE1 sing Y N 307 TYR CD1 HD1 sing N N 308 TYR CD2 CE2 doub Y N 309 TYR CD2 HD2 sing N N 310 TYR CE1 CZ doub Y N 311 TYR CE1 HE1 sing N N 312 TYR CE2 CZ sing Y N 313 TYR CE2 HE2 sing N N 314 TYR CZ OH sing N N 315 TYR OH HH sing N N 316 TYR OXT HXT sing N N 317 VAL N CA sing N N 318 VAL N H sing N N 319 VAL N H2 sing N N 320 VAL CA C sing N N 321 VAL CA CB sing N N 322 VAL CA HA sing N N 323 VAL C O doub N N 324 VAL C OXT sing N N 325 VAL CB CG1 sing N N 326 VAL CB CG2 sing N N 327 VAL CB HB sing N N 328 VAL CG1 HG11 sing N N 329 VAL CG1 HG12 sing N N 330 VAL CG1 HG13 sing N N 331 VAL CG2 HG21 sing N N 332 VAL CG2 HG22 sing N N 333 VAL CG2 HG23 sing N N 334 VAL OXT HXT sing N N 335 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' CA136472 1 'National Institutes of Health/National Cancer Institute (NIH/NCI)' 'United States' 1ZIABC011627 2 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.type ? _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.details ? # _atom_sites.entry_id 2N0Z _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O Q S # loop_