data_2N17
# 
_entry.id   2N17 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
RCSB104292   RCSB  ?            ?                   
2N17         PDB   pdb_00002n17 10.2210/pdb2n17/pdb 
18896        BMRB  ?            10.13018/BMR18896   
D_1000104292 WWPDB ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-05-06 
2 'Structure model' 1 1 2015-05-27 
3 'Structure model' 1 2 2023-06-14 
4 'Structure model' 1 3 2024-11-06 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
4 3 'Structure model' Other                 
5 4 'Structure model' 'Data collection'     
6 4 'Structure model' 'Database references' 
7 4 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2                
2 3 'Structure model' pdbx_database_status      
3 3 'Structure model' pdbx_nmr_software         
4 3 'Structure model' struct_ref_seq_dif        
5 4 'Structure model' chem_comp_atom            
6 4 'Structure model' chem_comp_bond            
7 4 'Structure model' database_2                
8 4 'Structure model' pdbx_entry_details        
9 4 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                       
2 3 'Structure model' '_database_2.pdbx_database_accession'        
3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
4 3 'Structure model' '_pdbx_nmr_software.name'                    
5 3 'Structure model' '_struct_ref_seq_dif.details'                
6 4 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2015-05-06 
_pdbx_database_PDB_obs_spr.pdb_id           2N17 
_pdbx_database_PDB_obs_spr.replace_pdb_id   2M25 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2N17 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-23 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          18896 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'Chemical shift assignments' 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Negulescu, H.'     1 
'Guo, Y.'           2 
'Garner, T.P.'      3 
'Goodwin, O.Y.'     4 
'Henderson, G.'     5 
'Laine, R.A.'       6 
'Macnaughtan, M.A.' 7 
# 
_citation.id                        primary 
_citation.title                     
'A Kazal-Type Serine Protease Inhibitor from the Defense Gland Secretion of the Subterranean Termite Coptotermes formosanus Shiraki.' 
_citation.journal_abbrev            'Plos One' 
_citation.journal_volume            10 
_citation.page_first                e0125376 
_citation.page_last                 e0125376 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1932-6203 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25978745 
_citation.pdbx_database_id_DOI      10.1371/journal.pone.0125376 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Negulescu, H.'     1 ? 
primary 'Guo, Y.'           2 ? 
primary 'Garner, T.P.'      3 ? 
primary 'Goodwin, O.Y.'     4 ? 
primary 'Henderson, G.'     5 ? 
primary 'Laine, R.A.'       6 ? 
primary 'Macnaughtan, M.A.' 7 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Lysozyme-Protease Inhibitor Protein' 
_entity.formula_weight             8578.577 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MAHHHHHHVDDDDKPEDCQLFCPMIYAPICATDGVSQRTFSNPCDLKVYNCWNPDNPYKEVKVGECDDANKPVPI 
_entity_poly.pdbx_seq_one_letter_code_can   MAHHHHHHVDDDDKPEDCQLFCPMIYAPICATDGVSQRTFSNPCDLKVYNCWNPDNPYKEVKVGECDDANKPVPI 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  HIS n 
1 4  HIS n 
1 5  HIS n 
1 6  HIS n 
1 7  HIS n 
1 8  HIS n 
1 9  VAL n 
1 10 ASP n 
1 11 ASP n 
1 12 ASP n 
1 13 ASP n 
1 14 LYS n 
1 15 PRO n 
1 16 GLU n 
1 17 ASP n 
1 18 CYS n 
1 19 GLN n 
1 20 LEU n 
1 21 PHE n 
1 22 CYS n 
1 23 PRO n 
1 24 MET n 
1 25 ILE n 
1 26 TYR n 
1 27 ALA n 
1 28 PRO n 
1 29 ILE n 
1 30 CYS n 
1 31 ALA n 
1 32 THR n 
1 33 ASP n 
1 34 GLY n 
1 35 VAL n 
1 36 SER n 
1 37 GLN n 
1 38 ARG n 
1 39 THR n 
1 40 PHE n 
1 41 SER n 
1 42 ASN n 
1 43 PRO n 
1 44 CYS n 
1 45 ASP n 
1 46 LEU n 
1 47 LYS n 
1 48 VAL n 
1 49 TYR n 
1 50 ASN n 
1 51 CYS n 
1 52 TRP n 
1 53 ASN n 
1 54 PRO n 
1 55 ASP n 
1 56 ASN n 
1 57 PRO n 
1 58 TYR n 
1 59 LYS n 
1 60 GLU n 
1 61 VAL n 
1 62 LYS n 
1 63 VAL n 
1 64 GLY n 
1 65 GLU n 
1 66 CYS n 
1 67 ASP n 
1 68 ASP n 
1 69 ALA n 
1 70 ASN n 
1 71 LYS n 
1 72 PRO n 
1 73 VAL n 
1 74 PRO n 
1 75 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Formosan subterranean termite' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Coptotermes formosanus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     36987 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET46 Ek/LIC' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  ?  ?   ?   A . n 
A 1 2  ALA 2  2  ?  ?   ?   A . n 
A 1 3  HIS 3  3  ?  ?   ?   A . n 
A 1 4  HIS 4  4  ?  ?   ?   A . n 
A 1 5  HIS 5  5  ?  ?   ?   A . n 
A 1 6  HIS 6  6  ?  ?   ?   A . n 
A 1 7  HIS 7  7  ?  ?   ?   A . n 
A 1 8  HIS 8  8  ?  ?   ?   A . n 
A 1 9  VAL 9  9  ?  ?   ?   A . n 
A 1 10 ASP 10 10 ?  ?   ?   A . n 
A 1 11 ASP 11 11 ?  ?   ?   A . n 
A 1 12 ASP 12 12 ?  ?   ?   A . n 
A 1 13 ASP 13 13 ?  ?   ?   A . n 
A 1 14 LYS 14 14 ?  ?   ?   A . n 
A 1 15 PRO 15 15 ?  ?   ?   A . n 
A 1 16 GLU 16 16 ?  ?   ?   A . n 
A 1 17 ASP 17 17 ?  ?   ?   A . n 
A 1 18 CYS 18 18 18 CYS CYS A . n 
A 1 19 GLN 19 19 19 GLN GLN A . n 
A 1 20 LEU 20 20 20 LEU LEU A . n 
A 1 21 PHE 21 21 21 PHE PHE A . n 
A 1 22 CYS 22 22 22 CYS CYS A . n 
A 1 23 PRO 23 23 23 PRO PRO A . n 
A 1 24 MET 24 24 24 MET MET A . n 
A 1 25 ILE 25 25 25 ILE ILE A . n 
A 1 26 TYR 26 26 26 TYR TYR A . n 
A 1 27 ALA 27 27 27 ALA ALA A . n 
A 1 28 PRO 28 28 28 PRO PRO A . n 
A 1 29 ILE 29 29 29 ILE ILE A . n 
A 1 30 CYS 30 30 30 CYS CYS A . n 
A 1 31 ALA 31 31 31 ALA ALA A . n 
A 1 32 THR 32 32 32 THR THR A . n 
A 1 33 ASP 33 33 33 ASP ASP A . n 
A 1 34 GLY 34 34 34 GLY GLY A . n 
A 1 35 VAL 35 35 35 VAL VAL A . n 
A 1 36 SER 36 36 36 SER SER A . n 
A 1 37 GLN 37 37 37 GLN GLN A . n 
A 1 38 ARG 38 38 38 ARG ARG A . n 
A 1 39 THR 39 39 39 THR THR A . n 
A 1 40 PHE 40 40 40 PHE PHE A . n 
A 1 41 SER 41 41 41 SER SER A . n 
A 1 42 ASN 42 42 42 ASN ASN A . n 
A 1 43 PRO 43 43 43 PRO PRO A . n 
A 1 44 CYS 44 44 44 CYS CYS A . n 
A 1 45 ASP 45 45 45 ASP ASP A . n 
A 1 46 LEU 46 46 46 LEU LEU A . n 
A 1 47 LYS 47 47 47 LYS LYS A . n 
A 1 48 VAL 48 48 48 VAL VAL A . n 
A 1 49 TYR 49 49 49 TYR TYR A . n 
A 1 50 ASN 50 50 50 ASN ASN A . n 
A 1 51 CYS 51 51 51 CYS CYS A . n 
A 1 52 TRP 52 52 52 TRP TRP A . n 
A 1 53 ASN 53 53 53 ASN ASN A . n 
A 1 54 PRO 54 54 54 PRO PRO A . n 
A 1 55 ASP 55 55 55 ASP ASP A . n 
A 1 56 ASN 56 56 56 ASN ASN A . n 
A 1 57 PRO 57 57 57 PRO PRO A . n 
A 1 58 TYR 58 58 58 TYR TYR A . n 
A 1 59 LYS 59 59 59 LYS LYS A . n 
A 1 60 GLU 60 60 60 GLU GLU A . n 
A 1 61 VAL 61 61 61 VAL VAL A . n 
A 1 62 LYS 62 62 62 LYS LYS A . n 
A 1 63 VAL 63 63 63 VAL VAL A . n 
A 1 64 GLY 64 64 64 GLY GLY A . n 
A 1 65 GLU 65 65 65 GLU GLU A . n 
A 1 66 CYS 66 66 66 CYS CYS A . n 
A 1 67 ASP 67 67 67 ASP ASP A . n 
A 1 68 ASP 68 68 68 ASP ASP A . n 
A 1 69 ALA 69 69 69 ALA ALA A . n 
A 1 70 ASN 70 70 70 ASN ASN A . n 
A 1 71 LYS 71 71 71 LYS LYS A . n 
A 1 72 PRO 72 72 72 PRO PRO A . n 
A 1 73 VAL 73 73 73 VAL VAL A . n 
A 1 74 PRO 74 74 ?  ?   ?   A . n 
A 1 75 ILE 75 75 ?  ?   ?   A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2N17 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2N17 
_struct.title                     
;NMR structure of a Kazal-type serine protease inhibitor from the subterranean termite defense gland of Coptotermes formosanus Shiraki soldiers
;
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2N17 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'Kazal-type, serine protease inhibitor, chymotrypsin, elastase, termite, soldier, defense gland, secretion, hydrolase' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    V9GZ93_COPFO 
_struct_ref.pdbx_db_accession          V9GZ93 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MIYAPICATDGVSQRTFSNPCDLKVYNCWNPDNPYKEVKVGECDDANKPVPI 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2N17 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 24 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 75 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             V9GZ93 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  52 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       24 
_struct_ref_seq.pdbx_auth_seq_align_end       75 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2N17 MET A 1  ? UNP V9GZ93 ? ? 'expression tag' 1  1  
1 2N17 ALA A 2  ? UNP V9GZ93 ? ? 'expression tag' 2  2  
1 2N17 HIS A 3  ? UNP V9GZ93 ? ? 'expression tag' 3  3  
1 2N17 HIS A 4  ? UNP V9GZ93 ? ? 'expression tag' 4  4  
1 2N17 HIS A 5  ? UNP V9GZ93 ? ? 'expression tag' 5  5  
1 2N17 HIS A 6  ? UNP V9GZ93 ? ? 'expression tag' 6  6  
1 2N17 HIS A 7  ? UNP V9GZ93 ? ? 'expression tag' 7  7  
1 2N17 HIS A 8  ? UNP V9GZ93 ? ? 'expression tag' 8  8  
1 2N17 VAL A 9  ? UNP V9GZ93 ? ? 'expression tag' 9  9  
1 2N17 ASP A 10 ? UNP V9GZ93 ? ? 'expression tag' 10 10 
1 2N17 ASP A 11 ? UNP V9GZ93 ? ? 'expression tag' 11 11 
1 2N17 ASP A 12 ? UNP V9GZ93 ? ? 'expression tag' 12 12 
1 2N17 ASP A 13 ? UNP V9GZ93 ? ? 'expression tag' 13 13 
1 2N17 LYS A 14 ? UNP V9GZ93 ? ? 'expression tag' 14 14 
1 2N17 PRO A 15 ? UNP V9GZ93 ? ? 'expression tag' 15 15 
1 2N17 GLU A 16 ? UNP V9GZ93 ? ? 'expression tag' 16 16 
1 2N17 ASP A 17 ? UNP V9GZ93 ? ? 'expression tag' 17 17 
1 2N17 CYS A 18 ? UNP V9GZ93 ? ? 'expression tag' 18 18 
1 2N17 GLN A 19 ? UNP V9GZ93 ? ? 'expression tag' 19 19 
1 2N17 LEU A 20 ? UNP V9GZ93 ? ? 'expression tag' 20 20 
1 2N17 PHE A 21 ? UNP V9GZ93 ? ? 'expression tag' 21 21 
1 2N17 CYS A 22 ? UNP V9GZ93 ? ? 'expression tag' 22 22 
1 2N17 PRO A 23 ? UNP V9GZ93 ? ? 'expression tag' 23 23 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       ASN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        42 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        53 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        ASN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         42 
_struct_conf.end_auth_comp_id        ASN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         53 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 51 SG ? ? A CYS 18 A CYS 51 1_555 ? ? ? ? ? ? ? 2.032 ? ? 
disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 22 A CYS 44 1_555 ? ? ? ? ? ? ? 2.033 ? ? 
disulf3 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 66 SG ? ? A CYS 30 A CYS 66 1_555 ? ? ? ? ? ? ? 2.029 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 18 ? CYS A 51 ? CYS A 18 ? 1_555 CYS A 51 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 22 ? CYS A 44 ? CYS A 22 ? 1_555 CYS A 44 ? 1_555 SG SG . . . None 'Disulfide bridge' 
3 CYS A 30 ? CYS A 66 ? CYS A 30 ? 1_555 CYS A 66 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 38 ? PHE A 40 ? ARG A 38 PHE A 40 
A 2 ILE A 29 ? ALA A 31 ? ILE A 29 ALA A 31 
A 3 GLU A 60 ? LYS A 62 ? GLU A 60 LYS A 62 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O PHE A 40 ? O PHE A 40 N ILE A 29 ? N ILE A 29 
A 2 3 N CYS A 30 ? N CYS A 30 O LYS A 62 ? O LYS A 62 
# 
_pdbx_entry_details.entry_id                   2N17 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2N17 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2N17 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.contents         '1 mM [U-99% 13C; U-99% 15N] TFP4, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
_pdbx_nmr_exptl_sample.component             TFP4-1 
_pdbx_nmr_exptl_sample.concentration         1 
_pdbx_nmr_exptl_sample.concentration_range   ? 
_pdbx_nmr_exptl_sample.concentration_units   mM 
_pdbx_nmr_exptl_sample.isotopic_labeling     '[U-99% 13C; U-99% 15N]' 
_pdbx_nmr_exptl_sample.solution_id           1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.12 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  1 '2D 1H-13C HSQC'  
1 3  1 '2D 1H-1H NOESY'  
1 4  1 '2D 1H-1H TOCSY'  
1 5  1 '2D 1H-1H COSY'   
1 6  1 '3D 1H-15N NOESY' 
1 7  1 '3D 1H-15N TOCSY' 
1 8  1 '3D HNCACB'       
1 9  1 '3D HN(COCA)CB'   
1 10 1 '3D HNCO'         
1 11 1 '3D HCACO'        
1 12 1 '3D 1H-13C NOESY' 
1 13 1 '3D HCCH-TOCSY'   
1 14 1 '3D HNHB'         
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2N17 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         526 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  191 
_pdbx_nmr_constraints.NOE_long_range_total_count                    100 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  50 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    185 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     ? 
# 
_pdbx_nmr_refine.entry_id           2N17 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Agilent                                             collection                  VnmrJ   ?     1  
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe 7.8   2  
CCPN                                                'data analysis'             CCPNMR  2.2.2 3  
CCPN                                                'peak picking'              CCPNMR  2.2.2 4  
CCPN                                                'chemical shift assignment' CCPNMR  2.2.2 5  
CCPN                                                'noe assignment'            CCPNMR  2.2.2 6  
CCPN                                                'dihedral angle'            CCPNMR  2.2.2 7  
'Brunger, Adams, Clore, Gros, Nilges and Read'      'geometry optimization'     CNS     1.2   8  
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNS     1.2   9  
'Cornilescu, Delaglio and Bax'                      'dihedral angle'            TALOS   ?     10 
'Bhattacharya and Montelione'                       'structure validation'      PSVS    1.5   11 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1  Y 1 A MET 1  ? A MET 1  
2   1  Y 1 A ALA 2  ? A ALA 2  
3   1  Y 1 A HIS 3  ? A HIS 3  
4   1  Y 1 A HIS 4  ? A HIS 4  
5   1  Y 1 A HIS 5  ? A HIS 5  
6   1  Y 1 A HIS 6  ? A HIS 6  
7   1  Y 1 A HIS 7  ? A HIS 7  
8   1  Y 1 A HIS 8  ? A HIS 8  
9   1  Y 1 A VAL 9  ? A VAL 9  
10  1  Y 1 A ASP 10 ? A ASP 10 
11  1  Y 1 A ASP 11 ? A ASP 11 
12  1  Y 1 A ASP 12 ? A ASP 12 
13  1  Y 1 A ASP 13 ? A ASP 13 
14  1  Y 1 A LYS 14 ? A LYS 14 
15  1  Y 1 A PRO 15 ? A PRO 15 
16  1  Y 1 A GLU 16 ? A GLU 16 
17  1  Y 1 A ASP 17 ? A ASP 17 
18  1  Y 1 A PRO 74 ? A PRO 74 
19  1  Y 1 A ILE 75 ? A ILE 75 
20  2  Y 1 A MET 1  ? A MET 1  
21  2  Y 1 A ALA 2  ? A ALA 2  
22  2  Y 1 A HIS 3  ? A HIS 3  
23  2  Y 1 A HIS 4  ? A HIS 4  
24  2  Y 1 A HIS 5  ? A HIS 5  
25  2  Y 1 A HIS 6  ? A HIS 6  
26  2  Y 1 A HIS 7  ? A HIS 7  
27  2  Y 1 A HIS 8  ? A HIS 8  
28  2  Y 1 A VAL 9  ? A VAL 9  
29  2  Y 1 A ASP 10 ? A ASP 10 
30  2  Y 1 A ASP 11 ? A ASP 11 
31  2  Y 1 A ASP 12 ? A ASP 12 
32  2  Y 1 A ASP 13 ? A ASP 13 
33  2  Y 1 A LYS 14 ? A LYS 14 
34  2  Y 1 A PRO 15 ? A PRO 15 
35  2  Y 1 A GLU 16 ? A GLU 16 
36  2  Y 1 A ASP 17 ? A ASP 17 
37  2  Y 1 A PRO 74 ? A PRO 74 
38  2  Y 1 A ILE 75 ? A ILE 75 
39  3  Y 1 A MET 1  ? A MET 1  
40  3  Y 1 A ALA 2  ? A ALA 2  
41  3  Y 1 A HIS 3  ? A HIS 3  
42  3  Y 1 A HIS 4  ? A HIS 4  
43  3  Y 1 A HIS 5  ? A HIS 5  
44  3  Y 1 A HIS 6  ? A HIS 6  
45  3  Y 1 A HIS 7  ? A HIS 7  
46  3  Y 1 A HIS 8  ? A HIS 8  
47  3  Y 1 A VAL 9  ? A VAL 9  
48  3  Y 1 A ASP 10 ? A ASP 10 
49  3  Y 1 A ASP 11 ? A ASP 11 
50  3  Y 1 A ASP 12 ? A ASP 12 
51  3  Y 1 A ASP 13 ? A ASP 13 
52  3  Y 1 A LYS 14 ? A LYS 14 
53  3  Y 1 A PRO 15 ? A PRO 15 
54  3  Y 1 A GLU 16 ? A GLU 16 
55  3  Y 1 A ASP 17 ? A ASP 17 
56  3  Y 1 A PRO 74 ? A PRO 74 
57  3  Y 1 A ILE 75 ? A ILE 75 
58  4  Y 1 A MET 1  ? A MET 1  
59  4  Y 1 A ALA 2  ? A ALA 2  
60  4  Y 1 A HIS 3  ? A HIS 3  
61  4  Y 1 A HIS 4  ? A HIS 4  
62  4  Y 1 A HIS 5  ? A HIS 5  
63  4  Y 1 A HIS 6  ? A HIS 6  
64  4  Y 1 A HIS 7  ? A HIS 7  
65  4  Y 1 A HIS 8  ? A HIS 8  
66  4  Y 1 A VAL 9  ? A VAL 9  
67  4  Y 1 A ASP 10 ? A ASP 10 
68  4  Y 1 A ASP 11 ? A ASP 11 
69  4  Y 1 A ASP 12 ? A ASP 12 
70  4  Y 1 A ASP 13 ? A ASP 13 
71  4  Y 1 A LYS 14 ? A LYS 14 
72  4  Y 1 A PRO 15 ? A PRO 15 
73  4  Y 1 A GLU 16 ? A GLU 16 
74  4  Y 1 A ASP 17 ? A ASP 17 
75  4  Y 1 A PRO 74 ? A PRO 74 
76  4  Y 1 A ILE 75 ? A ILE 75 
77  5  Y 1 A MET 1  ? A MET 1  
78  5  Y 1 A ALA 2  ? A ALA 2  
79  5  Y 1 A HIS 3  ? A HIS 3  
80  5  Y 1 A HIS 4  ? A HIS 4  
81  5  Y 1 A HIS 5  ? A HIS 5  
82  5  Y 1 A HIS 6  ? A HIS 6  
83  5  Y 1 A HIS 7  ? A HIS 7  
84  5  Y 1 A HIS 8  ? A HIS 8  
85  5  Y 1 A VAL 9  ? A VAL 9  
86  5  Y 1 A ASP 10 ? A ASP 10 
87  5  Y 1 A ASP 11 ? A ASP 11 
88  5  Y 1 A ASP 12 ? A ASP 12 
89  5  Y 1 A ASP 13 ? A ASP 13 
90  5  Y 1 A LYS 14 ? A LYS 14 
91  5  Y 1 A PRO 15 ? A PRO 15 
92  5  Y 1 A GLU 16 ? A GLU 16 
93  5  Y 1 A ASP 17 ? A ASP 17 
94  5  Y 1 A PRO 74 ? A PRO 74 
95  5  Y 1 A ILE 75 ? A ILE 75 
96  6  Y 1 A MET 1  ? A MET 1  
97  6  Y 1 A ALA 2  ? A ALA 2  
98  6  Y 1 A HIS 3  ? A HIS 3  
99  6  Y 1 A HIS 4  ? A HIS 4  
100 6  Y 1 A HIS 5  ? A HIS 5  
101 6  Y 1 A HIS 6  ? A HIS 6  
102 6  Y 1 A HIS 7  ? A HIS 7  
103 6  Y 1 A HIS 8  ? A HIS 8  
104 6  Y 1 A VAL 9  ? A VAL 9  
105 6  Y 1 A ASP 10 ? A ASP 10 
106 6  Y 1 A ASP 11 ? A ASP 11 
107 6  Y 1 A ASP 12 ? A ASP 12 
108 6  Y 1 A ASP 13 ? A ASP 13 
109 6  Y 1 A LYS 14 ? A LYS 14 
110 6  Y 1 A PRO 15 ? A PRO 15 
111 6  Y 1 A GLU 16 ? A GLU 16 
112 6  Y 1 A ASP 17 ? A ASP 17 
113 6  Y 1 A PRO 74 ? A PRO 74 
114 6  Y 1 A ILE 75 ? A ILE 75 
115 7  Y 1 A MET 1  ? A MET 1  
116 7  Y 1 A ALA 2  ? A ALA 2  
117 7  Y 1 A HIS 3  ? A HIS 3  
118 7  Y 1 A HIS 4  ? A HIS 4  
119 7  Y 1 A HIS 5  ? A HIS 5  
120 7  Y 1 A HIS 6  ? A HIS 6  
121 7  Y 1 A HIS 7  ? A HIS 7  
122 7  Y 1 A HIS 8  ? A HIS 8  
123 7  Y 1 A VAL 9  ? A VAL 9  
124 7  Y 1 A ASP 10 ? A ASP 10 
125 7  Y 1 A ASP 11 ? A ASP 11 
126 7  Y 1 A ASP 12 ? A ASP 12 
127 7  Y 1 A ASP 13 ? A ASP 13 
128 7  Y 1 A LYS 14 ? A LYS 14 
129 7  Y 1 A PRO 15 ? A PRO 15 
130 7  Y 1 A GLU 16 ? A GLU 16 
131 7  Y 1 A ASP 17 ? A ASP 17 
132 7  Y 1 A PRO 74 ? A PRO 74 
133 7  Y 1 A ILE 75 ? A ILE 75 
134 8  Y 1 A MET 1  ? A MET 1  
135 8  Y 1 A ALA 2  ? A ALA 2  
136 8  Y 1 A HIS 3  ? A HIS 3  
137 8  Y 1 A HIS 4  ? A HIS 4  
138 8  Y 1 A HIS 5  ? A HIS 5  
139 8  Y 1 A HIS 6  ? A HIS 6  
140 8  Y 1 A HIS 7  ? A HIS 7  
141 8  Y 1 A HIS 8  ? A HIS 8  
142 8  Y 1 A VAL 9  ? A VAL 9  
143 8  Y 1 A ASP 10 ? A ASP 10 
144 8  Y 1 A ASP 11 ? A ASP 11 
145 8  Y 1 A ASP 12 ? A ASP 12 
146 8  Y 1 A ASP 13 ? A ASP 13 
147 8  Y 1 A LYS 14 ? A LYS 14 
148 8  Y 1 A PRO 15 ? A PRO 15 
149 8  Y 1 A GLU 16 ? A GLU 16 
150 8  Y 1 A ASP 17 ? A ASP 17 
151 8  Y 1 A PRO 74 ? A PRO 74 
152 8  Y 1 A ILE 75 ? A ILE 75 
153 9  Y 1 A MET 1  ? A MET 1  
154 9  Y 1 A ALA 2  ? A ALA 2  
155 9  Y 1 A HIS 3  ? A HIS 3  
156 9  Y 1 A HIS 4  ? A HIS 4  
157 9  Y 1 A HIS 5  ? A HIS 5  
158 9  Y 1 A HIS 6  ? A HIS 6  
159 9  Y 1 A HIS 7  ? A HIS 7  
160 9  Y 1 A HIS 8  ? A HIS 8  
161 9  Y 1 A VAL 9  ? A VAL 9  
162 9  Y 1 A ASP 10 ? A ASP 10 
163 9  Y 1 A ASP 11 ? A ASP 11 
164 9  Y 1 A ASP 12 ? A ASP 12 
165 9  Y 1 A ASP 13 ? A ASP 13 
166 9  Y 1 A LYS 14 ? A LYS 14 
167 9  Y 1 A PRO 15 ? A PRO 15 
168 9  Y 1 A GLU 16 ? A GLU 16 
169 9  Y 1 A ASP 17 ? A ASP 17 
170 9  Y 1 A PRO 74 ? A PRO 74 
171 9  Y 1 A ILE 75 ? A ILE 75 
172 10 Y 1 A MET 1  ? A MET 1  
173 10 Y 1 A ALA 2  ? A ALA 2  
174 10 Y 1 A HIS 3  ? A HIS 3  
175 10 Y 1 A HIS 4  ? A HIS 4  
176 10 Y 1 A HIS 5  ? A HIS 5  
177 10 Y 1 A HIS 6  ? A HIS 6  
178 10 Y 1 A HIS 7  ? A HIS 7  
179 10 Y 1 A HIS 8  ? A HIS 8  
180 10 Y 1 A VAL 9  ? A VAL 9  
181 10 Y 1 A ASP 10 ? A ASP 10 
182 10 Y 1 A ASP 11 ? A ASP 11 
183 10 Y 1 A ASP 12 ? A ASP 12 
184 10 Y 1 A ASP 13 ? A ASP 13 
185 10 Y 1 A LYS 14 ? A LYS 14 
186 10 Y 1 A PRO 15 ? A PRO 15 
187 10 Y 1 A GLU 16 ? A GLU 16 
188 10 Y 1 A ASP 17 ? A ASP 17 
189 10 Y 1 A PRO 74 ? A PRO 74 
190 10 Y 1 A ILE 75 ? A ILE 75 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLN N    N N N 88  
GLN CA   C N S 89  
GLN C    C N N 90  
GLN O    O N N 91  
GLN CB   C N N 92  
GLN CG   C N N 93  
GLN CD   C N N 94  
GLN OE1  O N N 95  
GLN NE2  N N N 96  
GLN OXT  O N N 97  
GLN H    H N N 98  
GLN H2   H N N 99  
GLN HA   H N N 100 
GLN HB2  H N N 101 
GLN HB3  H N N 102 
GLN HG2  H N N 103 
GLN HG3  H N N 104 
GLN HE21 H N N 105 
GLN HE22 H N N 106 
GLN HXT  H N N 107 
GLU N    N N N 108 
GLU CA   C N S 109 
GLU C    C N N 110 
GLU O    O N N 111 
GLU CB   C N N 112 
GLU CG   C N N 113 
GLU CD   C N N 114 
GLU OE1  O N N 115 
GLU OE2  O N N 116 
GLU OXT  O N N 117 
GLU H    H N N 118 
GLU H2   H N N 119 
GLU HA   H N N 120 
GLU HB2  H N N 121 
GLU HB3  H N N 122 
GLU HG2  H N N 123 
GLU HG3  H N N 124 
GLU HE2  H N N 125 
GLU HXT  H N N 126 
GLY N    N N N 127 
GLY CA   C N N 128 
GLY C    C N N 129 
GLY O    O N N 130 
GLY OXT  O N N 131 
GLY H    H N N 132 
GLY H2   H N N 133 
GLY HA2  H N N 134 
GLY HA3  H N N 135 
GLY HXT  H N N 136 
HIS N    N N N 137 
HIS CA   C N S 138 
HIS C    C N N 139 
HIS O    O N N 140 
HIS CB   C N N 141 
HIS CG   C Y N 142 
HIS ND1  N Y N 143 
HIS CD2  C Y N 144 
HIS CE1  C Y N 145 
HIS NE2  N Y N 146 
HIS OXT  O N N 147 
HIS H    H N N 148 
HIS H2   H N N 149 
HIS HA   H N N 150 
HIS HB2  H N N 151 
HIS HB3  H N N 152 
HIS HD1  H N N 153 
HIS HD2  H N N 154 
HIS HE1  H N N 155 
HIS HE2  H N N 156 
HIS HXT  H N N 157 
ILE N    N N N 158 
ILE CA   C N S 159 
ILE C    C N N 160 
ILE O    O N N 161 
ILE CB   C N S 162 
ILE CG1  C N N 163 
ILE CG2  C N N 164 
ILE CD1  C N N 165 
ILE OXT  O N N 166 
ILE H    H N N 167 
ILE H2   H N N 168 
ILE HA   H N N 169 
ILE HB   H N N 170 
ILE HG12 H N N 171 
ILE HG13 H N N 172 
ILE HG21 H N N 173 
ILE HG22 H N N 174 
ILE HG23 H N N 175 
ILE HD11 H N N 176 
ILE HD12 H N N 177 
ILE HD13 H N N 178 
ILE HXT  H N N 179 
LEU N    N N N 180 
LEU CA   C N S 181 
LEU C    C N N 182 
LEU O    O N N 183 
LEU CB   C N N 184 
LEU CG   C N N 185 
LEU CD1  C N N 186 
LEU CD2  C N N 187 
LEU OXT  O N N 188 
LEU H    H N N 189 
LEU H2   H N N 190 
LEU HA   H N N 191 
LEU HB2  H N N 192 
LEU HB3  H N N 193 
LEU HG   H N N 194 
LEU HD11 H N N 195 
LEU HD12 H N N 196 
LEU HD13 H N N 197 
LEU HD21 H N N 198 
LEU HD22 H N N 199 
LEU HD23 H N N 200 
LEU HXT  H N N 201 
LYS N    N N N 202 
LYS CA   C N S 203 
LYS C    C N N 204 
LYS O    O N N 205 
LYS CB   C N N 206 
LYS CG   C N N 207 
LYS CD   C N N 208 
LYS CE   C N N 209 
LYS NZ   N N N 210 
LYS OXT  O N N 211 
LYS H    H N N 212 
LYS H2   H N N 213 
LYS HA   H N N 214 
LYS HB2  H N N 215 
LYS HB3  H N N 216 
LYS HG2  H N N 217 
LYS HG3  H N N 218 
LYS HD2  H N N 219 
LYS HD3  H N N 220 
LYS HE2  H N N 221 
LYS HE3  H N N 222 
LYS HZ1  H N N 223 
LYS HZ2  H N N 224 
LYS HZ3  H N N 225 
LYS HXT  H N N 226 
MET N    N N N 227 
MET CA   C N S 228 
MET C    C N N 229 
MET O    O N N 230 
MET CB   C N N 231 
MET CG   C N N 232 
MET SD   S N N 233 
MET CE   C N N 234 
MET OXT  O N N 235 
MET H    H N N 236 
MET H2   H N N 237 
MET HA   H N N 238 
MET HB2  H N N 239 
MET HB3  H N N 240 
MET HG2  H N N 241 
MET HG3  H N N 242 
MET HE1  H N N 243 
MET HE2  H N N 244 
MET HE3  H N N 245 
MET HXT  H N N 246 
PHE N    N N N 247 
PHE CA   C N S 248 
PHE C    C N N 249 
PHE O    O N N 250 
PHE CB   C N N 251 
PHE CG   C Y N 252 
PHE CD1  C Y N 253 
PHE CD2  C Y N 254 
PHE CE1  C Y N 255 
PHE CE2  C Y N 256 
PHE CZ   C Y N 257 
PHE OXT  O N N 258 
PHE H    H N N 259 
PHE H2   H N N 260 
PHE HA   H N N 261 
PHE HB2  H N N 262 
PHE HB3  H N N 263 
PHE HD1  H N N 264 
PHE HD2  H N N 265 
PHE HE1  H N N 266 
PHE HE2  H N N 267 
PHE HZ   H N N 268 
PHE HXT  H N N 269 
PRO N    N N N 270 
PRO CA   C N S 271 
PRO C    C N N 272 
PRO O    O N N 273 
PRO CB   C N N 274 
PRO CG   C N N 275 
PRO CD   C N N 276 
PRO OXT  O N N 277 
PRO H    H N N 278 
PRO HA   H N N 279 
PRO HB2  H N N 280 
PRO HB3  H N N 281 
PRO HG2  H N N 282 
PRO HG3  H N N 283 
PRO HD2  H N N 284 
PRO HD3  H N N 285 
PRO HXT  H N N 286 
SER N    N N N 287 
SER CA   C N S 288 
SER C    C N N 289 
SER O    O N N 290 
SER CB   C N N 291 
SER OG   O N N 292 
SER OXT  O N N 293 
SER H    H N N 294 
SER H2   H N N 295 
SER HA   H N N 296 
SER HB2  H N N 297 
SER HB3  H N N 298 
SER HG   H N N 299 
SER HXT  H N N 300 
THR N    N N N 301 
THR CA   C N S 302 
THR C    C N N 303 
THR O    O N N 304 
THR CB   C N R 305 
THR OG1  O N N 306 
THR CG2  C N N 307 
THR OXT  O N N 308 
THR H    H N N 309 
THR H2   H N N 310 
THR HA   H N N 311 
THR HB   H N N 312 
THR HG1  H N N 313 
THR HG21 H N N 314 
THR HG22 H N N 315 
THR HG23 H N N 316 
THR HXT  H N N 317 
TRP N    N N N 318 
TRP CA   C N S 319 
TRP C    C N N 320 
TRP O    O N N 321 
TRP CB   C N N 322 
TRP CG   C Y N 323 
TRP CD1  C Y N 324 
TRP CD2  C Y N 325 
TRP NE1  N Y N 326 
TRP CE2  C Y N 327 
TRP CE3  C Y N 328 
TRP CZ2  C Y N 329 
TRP CZ3  C Y N 330 
TRP CH2  C Y N 331 
TRP OXT  O N N 332 
TRP H    H N N 333 
TRP H2   H N N 334 
TRP HA   H N N 335 
TRP HB2  H N N 336 
TRP HB3  H N N 337 
TRP HD1  H N N 338 
TRP HE1  H N N 339 
TRP HE3  H N N 340 
TRP HZ2  H N N 341 
TRP HZ3  H N N 342 
TRP HH2  H N N 343 
TRP HXT  H N N 344 
TYR N    N N N 345 
TYR CA   C N S 346 
TYR C    C N N 347 
TYR O    O N N 348 
TYR CB   C N N 349 
TYR CG   C Y N 350 
TYR CD1  C Y N 351 
TYR CD2  C Y N 352 
TYR CE1  C Y N 353 
TYR CE2  C Y N 354 
TYR CZ   C Y N 355 
TYR OH   O N N 356 
TYR OXT  O N N 357 
TYR H    H N N 358 
TYR H2   H N N 359 
TYR HA   H N N 360 
TYR HB2  H N N 361 
TYR HB3  H N N 362 
TYR HD1  H N N 363 
TYR HD2  H N N 364 
TYR HE1  H N N 365 
TYR HE2  H N N 366 
TYR HH   H N N 367 
TYR HXT  H N N 368 
VAL N    N N N 369 
VAL CA   C N S 370 
VAL C    C N N 371 
VAL O    O N N 372 
VAL CB   C N N 373 
VAL CG1  C N N 374 
VAL CG2  C N N 375 
VAL OXT  O N N 376 
VAL H    H N N 377 
VAL H2   H N N 378 
VAL HA   H N N 379 
VAL HB   H N N 380 
VAL HG11 H N N 381 
VAL HG12 H N N 382 
VAL HG13 H N N 383 
VAL HG21 H N N 384 
VAL HG22 H N N 385 
VAL HG23 H N N 386 
VAL HXT  H N N 387 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TRP N   CA   sing N N 304 
TRP N   H    sing N N 305 
TRP N   H2   sing N N 306 
TRP CA  C    sing N N 307 
TRP CA  CB   sing N N 308 
TRP CA  HA   sing N N 309 
TRP C   O    doub N N 310 
TRP C   OXT  sing N N 311 
TRP CB  CG   sing N N 312 
TRP CB  HB2  sing N N 313 
TRP CB  HB3  sing N N 314 
TRP CG  CD1  doub Y N 315 
TRP CG  CD2  sing Y N 316 
TRP CD1 NE1  sing Y N 317 
TRP CD1 HD1  sing N N 318 
TRP CD2 CE2  doub Y N 319 
TRP CD2 CE3  sing Y N 320 
TRP NE1 CE2  sing Y N 321 
TRP NE1 HE1  sing N N 322 
TRP CE2 CZ2  sing Y N 323 
TRP CE3 CZ3  doub Y N 324 
TRP CE3 HE3  sing N N 325 
TRP CZ2 CH2  doub Y N 326 
TRP CZ2 HZ2  sing N N 327 
TRP CZ3 CH2  sing Y N 328 
TRP CZ3 HZ3  sing N N 329 
TRP CH2 HH2  sing N N 330 
TRP OXT HXT  sing N N 331 
TYR N   CA   sing N N 332 
TYR N   H    sing N N 333 
TYR N   H2   sing N N 334 
TYR CA  C    sing N N 335 
TYR CA  CB   sing N N 336 
TYR CA  HA   sing N N 337 
TYR C   O    doub N N 338 
TYR C   OXT  sing N N 339 
TYR CB  CG   sing N N 340 
TYR CB  HB2  sing N N 341 
TYR CB  HB3  sing N N 342 
TYR CG  CD1  doub Y N 343 
TYR CG  CD2  sing Y N 344 
TYR CD1 CE1  sing Y N 345 
TYR CD1 HD1  sing N N 346 
TYR CD2 CE2  doub Y N 347 
TYR CD2 HD2  sing N N 348 
TYR CE1 CZ   doub Y N 349 
TYR CE1 HE1  sing N N 350 
TYR CE2 CZ   sing Y N 351 
TYR CE2 HE2  sing N N 352 
TYR CZ  OH   sing N N 353 
TYR OH  HH   sing N N 354 
TYR OXT HXT  sing N N 355 
VAL N   CA   sing N N 356 
VAL N   H    sing N N 357 
VAL N   H2   sing N N 358 
VAL CA  C    sing N N 359 
VAL CA  CB   sing N N 360 
VAL CA  HA   sing N N 361 
VAL C   O    doub N N 362 
VAL C   OXT  sing N N 363 
VAL CB  CG1  sing N N 364 
VAL CB  CG2  sing N N 365 
VAL CB  HB   sing N N 366 
VAL CG1 HG11 sing N N 367 
VAL CG1 HG12 sing N N 368 
VAL CG1 HG13 sing N N 369 
VAL CG2 HG21 sing N N 370 
VAL CG2 HG22 sing N N 371 
VAL CG2 HG23 sing N N 372 
VAL OXT HXT  sing N N 373 
# 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.manufacturer      Varian 
_pdbx_nmr_spectrometer.model             VS-700 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Varian VS-700' 
# 
_atom_sites.entry_id                    2N17 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_