data_2N2J # _entry.id 2N2J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104340 RCSB ? ? 2N2J PDB pdb_00002n2j 10.2210/pdb2n2j/pdb 19390 BMRB ? 10.13018/BMR19390 D_1000104340 WWPDB ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-06-10 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N2J _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-05-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.db_id 19390 _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Friberg, A.' 1 'Sattler, M.' 2 # _citation.id primary _citation.title 'The EBNA-2 N-Terminal Transactivation Domain Folds into a Dimeric Structure Required for Target Gene Activation.' _citation.journal_abbrev 'Plos Pathog.' _citation.journal_volume 11 _citation.page_first e1004910 _citation.page_last e1004910 _citation.year 2015 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1553-7366 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26024477 _citation.pdbx_database_id_DOI 10.1371/journal.ppat.1004910 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Friberg, A.' 1 ? primary 'Thumann, S.' 2 ? primary 'Hennig, J.' 3 ? primary 'Zou, P.' 4 ? primary 'Nossner, E.' 5 ? primary 'Ling, P.D.' 6 ? primary 'Sattler, M.' 7 ? primary 'Kempkes, B.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Epstein-Barr nuclear antigen 2' _entity.formula_weight 6663.451 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'END DOMAIN (UNP RESIDUES 1-58)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EBNA-2, EBV nuclear antigen 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GAMEMPTFYLALHGGQTYHLIVDTDSLGNPSLSVIPSNPYQEQLSDTPLIPLTIFVGENTGV _entity_poly.pdbx_seq_one_letter_code_can GAMEMPTFYLALHGGQTYHLIVDTDSLGNPSLSVIPSNPYQEQLSDTPLIPLTIFVGENTGV _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLU n 1 5 MET n 1 6 PRO n 1 7 THR n 1 8 PHE n 1 9 TYR n 1 10 LEU n 1 11 ALA n 1 12 LEU n 1 13 HIS n 1 14 GLY n 1 15 GLY n 1 16 GLN n 1 17 THR n 1 18 TYR n 1 19 HIS n 1 20 LEU n 1 21 ILE n 1 22 VAL n 1 23 ASP n 1 24 THR n 1 25 ASP n 1 26 SER n 1 27 LEU n 1 28 GLY n 1 29 ASN n 1 30 PRO n 1 31 SER n 1 32 LEU n 1 33 SER n 1 34 VAL n 1 35 ILE n 1 36 PRO n 1 37 SER n 1 38 ASN n 1 39 PRO n 1 40 TYR n 1 41 GLN n 1 42 GLU n 1 43 GLN n 1 44 LEU n 1 45 SER n 1 46 ASP n 1 47 THR n 1 48 PRO n 1 49 LEU n 1 50 ILE n 1 51 PRO n 1 52 LEU n 1 53 THR n 1 54 ILE n 1 55 PHE n 1 56 VAL n 1 57 GLY n 1 58 GLU n 1 59 ASN n 1 60 THR n 1 61 GLY n 1 62 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name HHV-4 _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BYRF1, EBNA2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain B95-8 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human herpesvirus 4' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10377 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-24D _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 MET 3 3 3 MET MET A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 PRO 6 6 6 PRO PRO A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 TYR 9 9 9 TYR TYR A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 TYR 18 18 18 TYR TYR A . n A 1 19 HIS 19 19 19 HIS HIS A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 GLY 28 28 28 GLY GLY A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 PHE 55 55 55 PHE PHE A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 VAL 62 62 62 VAL VAL A . n B 1 1 GLY 1 1 1 GLY GLY B . n B 1 2 ALA 2 2 2 ALA ALA B . n B 1 3 MET 3 3 3 MET MET B . n B 1 4 GLU 4 4 4 GLU GLU B . n B 1 5 MET 5 5 5 MET MET B . n B 1 6 PRO 6 6 6 PRO PRO B . n B 1 7 THR 7 7 7 THR THR B . n B 1 8 PHE 8 8 8 PHE PHE B . n B 1 9 TYR 9 9 9 TYR TYR B . n B 1 10 LEU 10 10 10 LEU LEU B . n B 1 11 ALA 11 11 11 ALA ALA B . n B 1 12 LEU 12 12 12 LEU LEU B . n B 1 13 HIS 13 13 13 HIS HIS B . n B 1 14 GLY 14 14 14 GLY GLY B . n B 1 15 GLY 15 15 15 GLY GLY B . n B 1 16 GLN 16 16 16 GLN GLN B . n B 1 17 THR 17 17 17 THR THR B . n B 1 18 TYR 18 18 18 TYR TYR B . n B 1 19 HIS 19 19 19 HIS HIS B . n B 1 20 LEU 20 20 20 LEU LEU B . n B 1 21 ILE 21 21 21 ILE ILE B . n B 1 22 VAL 22 22 22 VAL VAL B . n B 1 23 ASP 23 23 23 ASP ASP B . n B 1 24 THR 24 24 24 THR THR B . n B 1 25 ASP 25 25 25 ASP ASP B . n B 1 26 SER 26 26 26 SER SER B . n B 1 27 LEU 27 27 27 LEU LEU B . n B 1 28 GLY 28 28 28 GLY GLY B . n B 1 29 ASN 29 29 29 ASN ASN B . n B 1 30 PRO 30 30 30 PRO PRO B . n B 1 31 SER 31 31 31 SER SER B . n B 1 32 LEU 32 32 32 LEU LEU B . n B 1 33 SER 33 33 33 SER SER B . n B 1 34 VAL 34 34 34 VAL VAL B . n B 1 35 ILE 35 35 35 ILE ILE B . n B 1 36 PRO 36 36 36 PRO PRO B . n B 1 37 SER 37 37 37 SER SER B . n B 1 38 ASN 38 38 38 ASN ASN B . n B 1 39 PRO 39 39 39 PRO PRO B . n B 1 40 TYR 40 40 40 TYR TYR B . n B 1 41 GLN 41 41 41 GLN GLN B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 GLN 43 43 43 GLN GLN B . n B 1 44 LEU 44 44 44 LEU LEU B . n B 1 45 SER 45 45 45 SER SER B . n B 1 46 ASP 46 46 46 ASP ASP B . n B 1 47 THR 47 47 47 THR THR B . n B 1 48 PRO 48 48 48 PRO PRO B . n B 1 49 LEU 49 49 49 LEU LEU B . n B 1 50 ILE 50 50 50 ILE ILE B . n B 1 51 PRO 51 51 51 PRO PRO B . n B 1 52 LEU 52 52 52 LEU LEU B . n B 1 53 THR 53 53 53 THR THR B . n B 1 54 ILE 54 54 54 ILE ILE B . n B 1 55 PHE 55 55 55 PHE PHE B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 GLY 57 57 57 GLY GLY B . n B 1 58 GLU 58 58 58 GLU GLU B . n B 1 59 ASN 59 59 59 ASN ASN B . n B 1 60 THR 60 60 60 THR THR B . n B 1 61 GLY 61 61 61 GLY GLY B . n B 1 62 VAL 62 62 62 VAL VAL B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N2J _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N2J _struct.title 'Solution structure of the EBNA-2 N-terminal Dimerization (END) domain from the Epstein-barr virus' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N2J _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'HOMODIMER, END DOMAIN, VIRAL PROTEIN, EBNA-2' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EBNA2_EBVB9 _struct_ref.pdbx_db_accession P12978 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MPTFYLALHGGQTYHLIVDTDSLGNPSLSVIPSNPYQEQLSDTPLIPLTIFVGENTGV _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2N2J A 5 ? 62 ? P12978 1 ? 58 ? 5 62 2 1 2N2J B 5 ? 62 ? P12978 1 ? 58 ? 5 62 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N2J GLY A 1 ? UNP P12978 ? ? 'expression tag' 1 1 1 2N2J ALA A 2 ? UNP P12978 ? ? 'expression tag' 2 2 1 2N2J MET A 3 ? UNP P12978 ? ? 'expression tag' 3 3 1 2N2J GLU A 4 ? UNP P12978 ? ? 'expression tag' 4 4 2 2N2J GLY B 1 ? UNP P12978 ? ? 'expression tag' 1 5 2 2N2J ALA B 2 ? UNP P12978 ? ? 'expression tag' 2 6 2 2N2J MET B 3 ? UNP P12978 ? ? 'expression tag' 3 7 2 2N2J GLU B 4 ? UNP P12978 ? ? 'expression tag' 4 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2210 ? 1 MORE -19 ? 1 'SSA (A^2)' 7730 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 39 ? LEU A 44 ? PRO A 39 LEU A 44 1 ? 6 HELX_P HELX_P2 2 PRO B 39 ? LEU B 44 ? PRO B 39 LEU B 44 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 7 ? HIS A 13 ? THR A 7 HIS A 13 A 2 LEU A 49 ? VAL A 56 ? LEU A 49 VAL A 56 A 3 LEU B 49 ? VAL B 56 ? LEU B 49 VAL B 56 A 4 THR B 7 ? HIS B 13 ? THR B 7 HIS B 13 B 1 PRO A 30 ? PRO A 36 ? PRO A 30 PRO A 36 B 2 GLN A 16 ? THR A 24 ? GLN A 16 THR A 24 B 3 GLN B 16 ? THR B 24 ? GLN B 16 THR B 24 B 4 PRO B 30 ? PRO B 36 ? PRO B 30 PRO B 36 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 10 ? N LEU A 10 O LEU A 52 ? O LEU A 52 A 2 3 N PHE A 55 ? N PHE A 55 O THR B 53 ? O THR B 53 A 3 4 O LEU B 52 ? O LEU B 52 N LEU B 10 ? N LEU B 10 B 1 2 O SER A 31 ? O SER A 31 N ASP A 23 ? N ASP A 23 B 2 3 N LEU A 20 ? N LEU A 20 O TYR B 18 ? O TYR B 18 B 3 4 N ASP B 23 ? N ASP B 23 O SER B 31 ? O SER B 31 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 H B HIS 19 ? ? O B ILE 35 ? ? 1.59 2 1 H A HIS 19 ? ? O A ILE 35 ? ? 1.59 3 1 H2 A GLY 1 ? ? OE2 A GLU 58 ? ? 1.59 4 1 H2 B GLY 1 ? ? OE2 B GLU 58 ? ? 1.60 5 2 H2 A GLY 1 ? ? OE1 A GLU 4 ? ? 1.57 6 2 H2 B GLY 1 ? ? OE1 B GLU 4 ? ? 1.58 7 2 H A HIS 19 ? ? O A ILE 35 ? ? 1.59 8 2 H B HIS 19 ? ? O B ILE 35 ? ? 1.60 9 5 H B HIS 19 ? ? O B ILE 35 ? ? 1.58 10 5 H A HIS 19 ? ? O A ILE 35 ? ? 1.58 11 6 H A HIS 19 ? ? O A ILE 35 ? ? 1.58 12 6 H B HIS 19 ? ? O B ILE 35 ? ? 1.60 13 8 H B HIS 19 ? ? O B ILE 35 ? ? 1.59 14 8 H A LEU 20 ? ? O B TYR 18 ? ? 1.59 15 8 H A HIS 19 ? ? O A ILE 35 ? ? 1.59 16 9 H A HIS 19 ? ? O A ILE 35 ? ? 1.59 17 9 H B HIS 19 ? ? O B ILE 35 ? ? 1.59 18 10 H B HIS 19 ? ? O B ILE 35 ? ? 1.59 19 10 O A TYR 18 ? ? H B LEU 20 ? ? 1.59 20 10 H A LEU 20 ? ? O B TYR 18 ? ? 1.59 21 10 H A HIS 19 ? ? O A ILE 35 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 3 ? ? -131.94 -31.67 2 1 MET B 3 ? ? -132.42 -31.31 3 2 ALA A 2 ? ? -161.74 86.57 4 2 LEU A 44 ? ? -102.11 56.30 5 2 ASN A 59 ? ? 71.13 -26.53 6 2 THR A 60 ? ? 83.87 -16.90 7 2 ALA B 2 ? ? -161.10 86.99 8 2 LEU B 44 ? ? -102.37 56.22 9 2 ASN B 59 ? ? 71.38 -26.60 10 2 THR B 60 ? ? 83.65 -16.61 11 3 ALA A 2 ? ? 62.72 -89.95 12 3 GLU A 58 ? ? -116.63 54.54 13 3 ASN A 59 ? ? 60.74 81.72 14 3 ALA B 2 ? ? 62.10 -90.00 15 3 GLU B 58 ? ? -116.68 55.32 16 3 ASN B 59 ? ? 60.02 81.54 17 4 MET A 3 ? ? -97.17 -66.90 18 4 ASN A 59 ? ? -54.49 110.00 19 4 MET B 3 ? ? -97.09 -67.02 20 4 ASN B 59 ? ? -54.09 109.92 21 5 ALA A 2 ? ? -93.59 48.99 22 5 LEU A 44 ? ? -88.00 43.49 23 5 ALA B 2 ? ? -93.35 48.57 24 5 LEU B 44 ? ? -87.56 43.10 25 6 ALA A 2 ? ? -163.64 69.40 26 6 ASP A 46 ? ? 44.72 25.59 27 6 ASN A 59 ? ? -170.41 117.97 28 6 ALA B 2 ? ? -163.49 70.28 29 6 ASP B 46 ? ? 44.97 25.72 30 6 ASN B 59 ? ? -170.29 116.91 31 7 ASN A 59 ? ? 72.00 -52.58 32 7 ASN B 59 ? ? 72.11 -52.41 33 8 MET A 3 ? ? -160.32 110.15 34 8 LEU A 44 ? ? -92.16 55.27 35 8 MET B 3 ? ? -160.50 109.66 36 8 LEU B 44 ? ? -92.31 55.37 37 9 ALA A 2 ? ? -130.14 -57.43 38 9 LEU A 44 ? ? -99.42 58.09 39 9 GLU A 58 ? ? -108.97 -160.04 40 9 ALA B 2 ? ? -130.08 -56.90 41 9 LEU B 44 ? ? -99.48 58.33 42 9 GLU B 58 ? ? -108.83 -159.93 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N2J _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N2J _pdbx_nmr_representative.selection_criteria 'low energy and fewest violations' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-13C; U-15N] EPSTEIN-BARR NUCLEAR ANTIGEN 2, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.1-0.5 mM [U-15N] EPSTEIN-BARR NUCLEAR ANTIGEN 2, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'EPSTEIN-BARR NUCLEAR ANTIGEN 2-1' 1 ? mM '[U-13C; U-15N]' 1 'EPSTEIN-BARR NUCLEAR ANTIGEN 2-2' ? 0.1-0.5 mM '[U-15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.pH 6.9 _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 323 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D HNCA' 1 4 1 '3D HNCACB' 1 5 1 '3D CBCA(CO)NH' 1 6 1 '3D HCCH-TOCSY' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY aliphatic' 1 9 1 '3D 1H-13C NOESY aromatic' # _pdbx_nmr_refine.entry_id 2N2J _pdbx_nmr_refine.method 'TORSION ANGLE DYNAMICS, SIMULATED ANNEALING' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA_3.0 ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 'Bruker Biospin' 'collection, processing' TopSpin ? 3 'Johnson, One Moon Scientific' 'chemical shift assignment' NMRView ? 4 Goddard 'chemical shift assignment' Sparky ? 5 ;Linge, O'Donoghue and Nilges ; refinement ARIA_2.2 ? 6 ;Linge, O'Donoghue and Nilges ; 'prediction of dihedral angles' ARIA_2.2 ? 7 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 HIS N N N N 96 HIS CA C N S 97 HIS C C N N 98 HIS O O N N 99 HIS CB C N N 100 HIS CG C Y N 101 HIS ND1 N Y N 102 HIS CD2 C Y N 103 HIS CE1 C Y N 104 HIS NE2 N Y N 105 HIS OXT O N N 106 HIS H H N N 107 HIS H2 H N N 108 HIS HA H N N 109 HIS HB2 H N N 110 HIS HB3 H N N 111 HIS HD1 H N N 112 HIS HD2 H N N 113 HIS HE1 H N N 114 HIS HE2 H N N 115 HIS HXT H N N 116 ILE N N N N 117 ILE CA C N S 118 ILE C C N N 119 ILE O O N N 120 ILE CB C N S 121 ILE CG1 C N N 122 ILE CG2 C N N 123 ILE CD1 C N N 124 ILE OXT O N N 125 ILE H H N N 126 ILE H2 H N N 127 ILE HA H N N 128 ILE HB H N N 129 ILE HG12 H N N 130 ILE HG13 H N N 131 ILE HG21 H N N 132 ILE HG22 H N N 133 ILE HG23 H N N 134 ILE HD11 H N N 135 ILE HD12 H N N 136 ILE HD13 H N N 137 ILE HXT H N N 138 LEU N N N N 139 LEU CA C N S 140 LEU C C N N 141 LEU O O N N 142 LEU CB C N N 143 LEU CG C N N 144 LEU CD1 C N N 145 LEU CD2 C N N 146 LEU OXT O N N 147 LEU H H N N 148 LEU H2 H N N 149 LEU HA H N N 150 LEU HB2 H N N 151 LEU HB3 H N N 152 LEU HG H N N 153 LEU HD11 H N N 154 LEU HD12 H N N 155 LEU HD13 H N N 156 LEU HD21 H N N 157 LEU HD22 H N N 158 LEU HD23 H N N 159 LEU HXT H N N 160 MET N N N N 161 MET CA C N S 162 MET C C N N 163 MET O O N N 164 MET CB C N N 165 MET CG C N N 166 MET SD S N N 167 MET CE C N N 168 MET OXT O N N 169 MET H H N N 170 MET H2 H N N 171 MET HA H N N 172 MET HB2 H N N 173 MET HB3 H N N 174 MET HG2 H N N 175 MET HG3 H N N 176 MET HE1 H N N 177 MET HE2 H N N 178 MET HE3 H N N 179 MET HXT H N N 180 PHE N N N N 181 PHE CA C N S 182 PHE C C N N 183 PHE O O N N 184 PHE CB C N N 185 PHE CG C Y N 186 PHE CD1 C Y N 187 PHE CD2 C Y N 188 PHE CE1 C Y N 189 PHE CE2 C Y N 190 PHE CZ C Y N 191 PHE OXT O N N 192 PHE H H N N 193 PHE H2 H N N 194 PHE HA H N N 195 PHE HB2 H N N 196 PHE HB3 H N N 197 PHE HD1 H N N 198 PHE HD2 H N N 199 PHE HE1 H N N 200 PHE HE2 H N N 201 PHE HZ H N N 202 PHE HXT H N N 203 PRO N N N N 204 PRO CA C N S 205 PRO C C N N 206 PRO O O N N 207 PRO CB C N N 208 PRO CG C N N 209 PRO CD C N N 210 PRO OXT O N N 211 PRO H H N N 212 PRO HA H N N 213 PRO HB2 H N N 214 PRO HB3 H N N 215 PRO HG2 H N N 216 PRO HG3 H N N 217 PRO HD2 H N N 218 PRO HD3 H N N 219 PRO HXT H N N 220 SER N N N N 221 SER CA C N S 222 SER C C N N 223 SER O O N N 224 SER CB C N N 225 SER OG O N N 226 SER OXT O N N 227 SER H H N N 228 SER H2 H N N 229 SER HA H N N 230 SER HB2 H N N 231 SER HB3 H N N 232 SER HG H N N 233 SER HXT H N N 234 THR N N N N 235 THR CA C N S 236 THR C C N N 237 THR O O N N 238 THR CB C N R 239 THR OG1 O N N 240 THR CG2 C N N 241 THR OXT O N N 242 THR H H N N 243 THR H2 H N N 244 THR HA H N N 245 THR HB H N N 246 THR HG1 H N N 247 THR HG21 H N N 248 THR HG22 H N N 249 THR HG23 H N N 250 THR HXT H N N 251 TYR N N N N 252 TYR CA C N S 253 TYR C C N N 254 TYR O O N N 255 TYR CB C N N 256 TYR CG C Y N 257 TYR CD1 C Y N 258 TYR CD2 C Y N 259 TYR CE1 C Y N 260 TYR CE2 C Y N 261 TYR CZ C Y N 262 TYR OH O N N 263 TYR OXT O N N 264 TYR H H N N 265 TYR H2 H N N 266 TYR HA H N N 267 TYR HB2 H N N 268 TYR HB3 H N N 269 TYR HD1 H N N 270 TYR HD2 H N N 271 TYR HE1 H N N 272 TYR HE2 H N N 273 TYR HH H N N 274 TYR HXT H N N 275 VAL N N N N 276 VAL CA C N S 277 VAL C C N N 278 VAL O O N N 279 VAL CB C N N 280 VAL CG1 C N N 281 VAL CG2 C N N 282 VAL OXT O N N 283 VAL H H N N 284 VAL H2 H N N 285 VAL HA H N N 286 VAL HB H N N 287 VAL HG11 H N N 288 VAL HG12 H N N 289 VAL HG13 H N N 290 VAL HG21 H N N 291 VAL HG22 H N N 292 VAL HG23 H N N 293 VAL HXT H N N 294 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 ILE N CA sing N N 111 ILE N H sing N N 112 ILE N H2 sing N N 113 ILE CA C sing N N 114 ILE CA CB sing N N 115 ILE CA HA sing N N 116 ILE C O doub N N 117 ILE C OXT sing N N 118 ILE CB CG1 sing N N 119 ILE CB CG2 sing N N 120 ILE CB HB sing N N 121 ILE CG1 CD1 sing N N 122 ILE CG1 HG12 sing N N 123 ILE CG1 HG13 sing N N 124 ILE CG2 HG21 sing N N 125 ILE CG2 HG22 sing N N 126 ILE CG2 HG23 sing N N 127 ILE CD1 HD11 sing N N 128 ILE CD1 HD12 sing N N 129 ILE CD1 HD13 sing N N 130 ILE OXT HXT sing N N 131 LEU N CA sing N N 132 LEU N H sing N N 133 LEU N H2 sing N N 134 LEU CA C sing N N 135 LEU CA CB sing N N 136 LEU CA HA sing N N 137 LEU C O doub N N 138 LEU C OXT sing N N 139 LEU CB CG sing N N 140 LEU CB HB2 sing N N 141 LEU CB HB3 sing N N 142 LEU CG CD1 sing N N 143 LEU CG CD2 sing N N 144 LEU CG HG sing N N 145 LEU CD1 HD11 sing N N 146 LEU CD1 HD12 sing N N 147 LEU CD1 HD13 sing N N 148 LEU CD2 HD21 sing N N 149 LEU CD2 HD22 sing N N 150 LEU CD2 HD23 sing N N 151 LEU OXT HXT sing N N 152 MET N CA sing N N 153 MET N H sing N N 154 MET N H2 sing N N 155 MET CA C sing N N 156 MET CA CB sing N N 157 MET CA HA sing N N 158 MET C O doub N N 159 MET C OXT sing N N 160 MET CB CG sing N N 161 MET CB HB2 sing N N 162 MET CB HB3 sing N N 163 MET CG SD sing N N 164 MET CG HG2 sing N N 165 MET CG HG3 sing N N 166 MET SD CE sing N N 167 MET CE HE1 sing N N 168 MET CE HE2 sing N N 169 MET CE HE3 sing N N 170 MET OXT HXT sing N N 171 PHE N CA sing N N 172 PHE N H sing N N 173 PHE N H2 sing N N 174 PHE CA C sing N N 175 PHE CA CB sing N N 176 PHE CA HA sing N N 177 PHE C O doub N N 178 PHE C OXT sing N N 179 PHE CB CG sing N N 180 PHE CB HB2 sing N N 181 PHE CB HB3 sing N N 182 PHE CG CD1 doub Y N 183 PHE CG CD2 sing Y N 184 PHE CD1 CE1 sing Y N 185 PHE CD1 HD1 sing N N 186 PHE CD2 CE2 doub Y N 187 PHE CD2 HD2 sing N N 188 PHE CE1 CZ doub Y N 189 PHE CE1 HE1 sing N N 190 PHE CE2 CZ sing Y N 191 PHE CE2 HE2 sing N N 192 PHE CZ HZ sing N N 193 PHE OXT HXT sing N N 194 PRO N CA sing N N 195 PRO N CD sing N N 196 PRO N H sing N N 197 PRO CA C sing N N 198 PRO CA CB sing N N 199 PRO CA HA sing N N 200 PRO C O doub N N 201 PRO C OXT sing N N 202 PRO CB CG sing N N 203 PRO CB HB2 sing N N 204 PRO CB HB3 sing N N 205 PRO CG CD sing N N 206 PRO CG HG2 sing N N 207 PRO CG HG3 sing N N 208 PRO CD HD2 sing N N 209 PRO CD HD3 sing N N 210 PRO OXT HXT sing N N 211 SER N CA sing N N 212 SER N H sing N N 213 SER N H2 sing N N 214 SER CA C sing N N 215 SER CA CB sing N N 216 SER CA HA sing N N 217 SER C O doub N N 218 SER C OXT sing N N 219 SER CB OG sing N N 220 SER CB HB2 sing N N 221 SER CB HB3 sing N N 222 SER OG HG sing N N 223 SER OXT HXT sing N N 224 THR N CA sing N N 225 THR N H sing N N 226 THR N H2 sing N N 227 THR CA C sing N N 228 THR CA CB sing N N 229 THR CA HA sing N N 230 THR C O doub N N 231 THR C OXT sing N N 232 THR CB OG1 sing N N 233 THR CB CG2 sing N N 234 THR CB HB sing N N 235 THR OG1 HG1 sing N N 236 THR CG2 HG21 sing N N 237 THR CG2 HG22 sing N N 238 THR CG2 HG23 sing N N 239 THR OXT HXT sing N N 240 TYR N CA sing N N 241 TYR N H sing N N 242 TYR N H2 sing N N 243 TYR CA C sing N N 244 TYR CA CB sing N N 245 TYR CA HA sing N N 246 TYR C O doub N N 247 TYR C OXT sing N N 248 TYR CB CG sing N N 249 TYR CB HB2 sing N N 250 TYR CB HB3 sing N N 251 TYR CG CD1 doub Y N 252 TYR CG CD2 sing Y N 253 TYR CD1 CE1 sing Y N 254 TYR CD1 HD1 sing N N 255 TYR CD2 CE2 doub Y N 256 TYR CD2 HD2 sing N N 257 TYR CE1 CZ doub Y N 258 TYR CE1 HE1 sing N N 259 TYR CE2 CZ sing Y N 260 TYR CE2 HE2 sing N N 261 TYR CZ OH sing N N 262 TYR OH HH sing N N 263 TYR OXT HXT sing N N 264 VAL N CA sing N N 265 VAL N H sing N N 266 VAL N H2 sing N N 267 VAL CA C sing N N 268 VAL CA CB sing N N 269 VAL CA HA sing N N 270 VAL C O doub N N 271 VAL C OXT sing N N 272 VAL CB CG1 sing N N 273 VAL CB CG2 sing N N 274 VAL CB HB sing N N 275 VAL CG1 HG11 sing N N 276 VAL CG1 HG12 sing N N 277 VAL CG1 HG13 sing N N 278 VAL CG2 HG21 sing N N 279 VAL CG2 HG22 sing N N 280 VAL CG2 HG23 sing N N 281 VAL OXT HXT sing N N 282 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'BRUKER AVANCE' 600 Bruker AVANCE 2 'Bruker Avance' 750 Bruker AVANCE 3 'Bruker Avance' 800 Bruker AVANCE 4 'Bruker Avance' 950 Bruker AVANCE 5 'Bruker Avance' # _atom_sites.entry_id 2N2J _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_