data_2N2V # _entry.id 2N2V # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id RCSB104352 RCSB 2N2V PDB 25613 BMRB D_1000104352 WWPDB # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25613 BMRB unspecified . 2N2w PDB unspecified . 2N2X PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N2V _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-05-15 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Veverka, V.' 1 'Hexnerova, R.' 2 'Jiracek, J.' 3 # _citation.id primary _citation.title 'Rational steering of insulin binding specificity by intra-chain chemical crosslinking.' _citation.journal_abbrev 'Sci Rep' _citation.journal_volume 6 _citation.page_first 19431 _citation.page_last 19431 _citation.year 2016 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2045-2322 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 26792393 _citation.pdbx_database_id_DOI 10.1038/srep19431 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Vikova, J.' 1 primary 'Collinsova, M.' 2 primary 'Kletvikova, E.' 3 primary 'Budesinsky, M.' 4 primary 'Kaplan, V.' 5 primary 'Zakova, L.' 6 primary 'Veverka, V.' 7 primary 'Hexnerova, R.' 8 primary 'Avino, R.J.' 9 primary 'Strakova, J.' 10 primary 'Selicharova, I.' 11 primary 'Vanek, V.' 12 primary 'Wright, D.W.' 13 primary 'Watson, C.J.' 14 primary 'Turkenburg, J.P.' 15 primary 'Brzozowski, A.M.' 16 primary 'Jiracek, J.' 17 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Insulin A chain' 2383.698 1 ? ? ? ? 2 polymer syn 'Insulin B chain' 3378.858 1 ? 'Y26(NVA), K29(HIX)' ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no GIVEQCCTSICSLYQLENYCN GIVEQCCTSICSLYQLENYCN A ? 2 'polypeptide(L)' no yes 'FVNQHLCGSHLVEALYLVCGERGFF(NVA)TP(HIX)T' FVNQHLCGSHLVEALYLVCGERGFFVTPXT B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ILE n 1 3 VAL n 1 4 GLU n 1 5 GLN n 1 6 CYS n 1 7 CYS n 1 8 THR n 1 9 SER n 1 10 ILE n 1 11 CYS n 1 12 SER n 1 13 LEU n 1 14 TYR n 1 15 GLN n 1 16 LEU n 1 17 GLU n 1 18 ASN n 1 19 TYR n 1 20 CYS n 1 21 ASN n 2 1 PHE n 2 2 VAL n 2 3 ASN n 2 4 GLN n 2 5 HIS n 2 6 LEU n 2 7 CYS n 2 8 GLY n 2 9 SER n 2 10 HIS n 2 11 LEU n 2 12 VAL n 2 13 GLU n 2 14 ALA n 2 15 LEU n 2 16 TYR n 2 17 LEU n 2 18 VAL n 2 19 CYS n 2 20 GLY n 2 21 GLU n 2 22 ARG n 2 23 GLY n 2 24 PHE n 2 25 PHE n 2 26 NVA n 2 27 THR n 2 28 PRO n 2 29 HIX n 2 30 THR n # loop_ _pdbx_entity_src_syn.entity_id _pdbx_entity_src_syn.pdbx_src_id _pdbx_entity_src_syn.pdbx_alt_source_flag _pdbx_entity_src_syn.pdbx_beg_seq_num _pdbx_entity_src_syn.pdbx_end_seq_num _pdbx_entity_src_syn.organism_scientific _pdbx_entity_src_syn.organism_common_name _pdbx_entity_src_syn.ncbi_taxonomy_id _pdbx_entity_src_syn.details 1 1 sample ? ? 'Homo sapiens' human 9606 ? 2 1 sample ? ? 'Homo sapiens' human 9606 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP INS_HUMAN P01308 1 GIVEQCCTSICSLYQLENYCN 90 ? 2 UNP INS_HUMAN P01308 2 FVNQHLCGSHLVEALYLVCGERGFFYTPKT 25 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2N2V A 1 ? 21 ? P01308 90 ? 110 ? 1 21 2 2 2N2V B 1 ? 30 ? P01308 25 ? 54 ? 1 30 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 2 2N2V NVA B 26 ? UNP P01308 TYR 50 'ENGINEERED MUTATION' 26 1 2 2N2V HIX B 29 ? UNP P01308 LYS 53 'ENGINEERED MUTATION' 29 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HIX 'L-peptide linking' n '3-(1H-1,2,3-triazol-5-yl)-L-alanine' ? 'C5 H8 N4 O2' 156.143 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 NVA 'L-peptide linking' n NORVALINE ? 'C5 H11 N O2' 117.146 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D 1H-1H NOESY' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 1.9 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '1.5 mM chain_A, 1.5 mM chain_B, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model Avance _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2N2V _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N2V _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N2V _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA ? 1 Krieger refinement YASARA ? 2 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N2V _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N2V _struct.title 'Solution structure of [B26-B29 triazole cross-linked]-insulin analogue at pH 1.9' _struct.pdbx_descriptor 'Insulin A chain, Insulin B chain' _struct.pdbx_model_details 'closest to the average, model28' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N2V _struct_keywords.pdbx_keywords HORMONE _struct_keywords.text HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 1 ? SER A 9 ? GLY A 1 SER A 9 1 ? 9 HELX_P HELX_P2 2 SER A 12 ? ASN A 18 ? SER A 12 ASN A 18 1 ? 7 HELX_P HELX_P3 3 GLY B 8 ? GLY B 20 ? GLY B 8 GLY B 20 1 ? 13 HELX_P HELX_P4 4 GLU B 21 ? GLY B 23 ? GLU B 21 GLY B 23 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 6 SG ? ? ? 1_555 A CYS 11 SG ? ? A CYS 6 A CYS 11 1_555 ? ? ? ? ? ? ? 2.016 ? disulf2 disulf ? ? A CYS 7 SG ? ? ? 1_555 B CYS 7 SG ? ? A CYS 7 B CYS 7 1_555 ? ? ? ? ? ? ? 2.036 ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 B CYS 19 SG ? ? A CYS 20 B CYS 19 1_555 ? ? ? ? ? ? ? 1.985 ? covale1 covale ? ? B PHE 25 C ? ? ? 1_555 B NVA 26 N ? ? B PHE 25 B NVA 26 1_555 ? ? ? ? ? ? ? 1.356 ? covale2 covale ? ? B NVA 26 C ? ? ? 1_555 B THR 27 N ? ? B NVA 26 B THR 27 1_555 ? ? ? ? ? ? ? 1.340 ? covale3 covale ? ? B PRO 28 C ? ? ? 1_555 B HIX 29 N ? ? B PRO 28 B HIX 29 1_555 ? ? ? ? ? ? ? 1.348 ? covale4 covale ? ? B HIX 29 C ? ? ? 1_555 B THR 30 N ? ? B HIX 29 B THR 30 1_555 ? ? ? ? ? ? ? 1.348 ? covale5 covale ? ? B NVA 26 CD ? ? ? 1_555 B HIX 29 NE2 ? ? B NVA 26 B HIX 29 1_555 ? ? ? ? ? ? ? 1.467 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # _atom_sites.entry_id 2N2V _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 CYS 6 6 6 CYS CYS A . n A 1 7 CYS 7 7 7 CYS CYS A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 SER 12 12 12 SER SER A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TYR 14 14 14 TYR TYR A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 ASN 21 21 21 ASN ASN A . n B 2 1 PHE 1 1 1 PHE PHE B . n B 2 2 VAL 2 2 2 VAL VAL B . n B 2 3 ASN 3 3 3 ASN ASN B . n B 2 4 GLN 4 4 4 GLN GLN B . n B 2 5 HIS 5 5 5 HIS HIS B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 CYS 7 7 7 CYS CYS B . n B 2 8 GLY 8 8 8 GLY GLY B . n B 2 9 SER 9 9 9 SER SER B . n B 2 10 HIS 10 10 10 HIS HIS B . n B 2 11 LEU 11 11 11 LEU LEU B . n B 2 12 VAL 12 12 12 VAL VAL B . n B 2 13 GLU 13 13 13 GLU GLU B . n B 2 14 ALA 14 14 14 ALA ALA B . n B 2 15 LEU 15 15 15 LEU LEU B . n B 2 16 TYR 16 16 16 TYR TYR B . n B 2 17 LEU 17 17 17 LEU LEU B . n B 2 18 VAL 18 18 18 VAL VAL B . n B 2 19 CYS 19 19 19 CYS CYS B . n B 2 20 GLY 20 20 20 GLY GLY B . n B 2 21 GLU 21 21 21 GLU GLU B . n B 2 22 ARG 22 22 22 ARG ARG B . n B 2 23 GLY 23 23 23 GLY GLY B . n B 2 24 PHE 24 24 24 PHE PHE B . n B 2 25 PHE 25 25 25 PHE PHE B . n B 2 26 NVA 26 26 26 NVA ARX B . n B 2 27 THR 27 27 27 THR THR B . n B 2 28 PRO 28 28 28 PRO PRO B . n B 2 29 HIX 29 29 29 HIX HIX B . n B 2 30 THR 30 30 30 THR THR B . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B NVA 26 B NVA 26 ? VAL NORVALINE 2 B HIX 29 B HIX 29 ? ALA '3-(1H-1,2,3-TRIAZOL-5-YL)-L-ALANINE' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1186.1 ? 1 MORE -16.9 ? 1 'SSA (A^2)' 4195.0 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2016-02-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id chain_A-1 1.5 ? mM ? 1 chain_B-2 1.5 ? mM ? 1 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 16 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 NVA _pdbx_validate_close_contact.auth_seq_id_1 26 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG1 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 THR _pdbx_validate_close_contact.auth_seq_id_2 27 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.59 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 10 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.186 1.252 -0.066 0.011 N 2 12 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.183 1.252 -0.069 0.011 N 3 13 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.183 1.252 -0.069 0.011 N 4 16 CD B GLU 21 ? ? OE1 B GLU 21 ? ? 1.184 1.252 -0.068 0.011 N 5 17 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.184 1.252 -0.068 0.011 N 6 18 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.181 1.252 -0.071 0.011 N 7 18 CD B GLU 13 ? ? OE1 B GLU 13 ? ? 1.180 1.252 -0.072 0.011 N 8 19 CD B GLU 21 ? ? OE1 B GLU 21 ? ? 1.166 1.252 -0.086 0.011 N 9 21 CD B GLU 13 ? ? OE2 B GLU 13 ? ? 1.322 1.252 0.070 0.011 N 10 21 CD B GLU 21 ? ? OE2 B GLU 21 ? ? 1.335 1.252 0.083 0.011 N 11 23 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.170 1.252 -0.082 0.011 N 12 23 CD B GLU 13 ? ? OE1 B GLU 13 ? ? 1.185 1.252 -0.067 0.011 N 13 24 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.169 1.252 -0.083 0.011 N 14 24 CD B GLU 13 ? ? OE1 B GLU 13 ? ? 1.177 1.252 -0.075 0.011 N 15 25 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.165 1.252 -0.087 0.011 N 16 25 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.336 1.252 0.084 0.011 N 17 25 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.186 1.252 -0.066 0.011 N 18 25 CD B GLU 13 ? ? OE1 B GLU 13 ? ? 1.185 1.252 -0.067 0.011 N 19 25 CD B GLU 21 ? ? OE1 B GLU 21 ? ? 1.182 1.252 -0.070 0.011 N 20 26 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.171 1.252 -0.081 0.011 N 21 26 CD B GLU 13 ? ? OE1 B GLU 13 ? ? 1.161 1.252 -0.091 0.011 N 22 26 CD B GLU 21 ? ? OE1 B GLU 21 ? ? 1.176 1.252 -0.076 0.011 N 23 27 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.186 1.252 -0.066 0.011 N 24 27 CD A GLU 17 ? ? OE1 A GLU 17 ? ? 1.171 1.252 -0.081 0.011 N 25 27 CD B GLU 13 ? ? OE1 B GLU 13 ? ? 1.166 1.252 -0.086 0.011 N 26 28 CD A GLU 4 ? ? OE2 A GLU 4 ? ? 1.322 1.252 0.070 0.011 N 27 28 CD B GLU 21 ? ? OE1 B GLU 21 ? ? 1.175 1.252 -0.077 0.011 N 28 30 CD A GLU 4 ? ? OE1 A GLU 4 ? ? 1.181 1.252 -0.071 0.011 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 17 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 123.77 120.30 3.47 0.50 N 2 21 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 124.13 120.30 3.83 0.50 N 3 21 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH2 B ARG 22 ? ? 117.18 120.30 -3.12 0.50 N 4 27 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH1 B ARG 22 ? ? 124.25 120.30 3.95 0.50 N 5 27 NE B ARG 22 ? ? CZ B ARG 22 ? ? NH2 B ARG 22 ? ? 116.77 120.30 -3.53 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG B 22 ? ? -94.02 33.97 2 2 HIX B 29 ? ? -58.80 103.65 3 4 CYS B 7 ? ? -111.86 -71.36 4 4 HIX B 29 ? ? -65.49 96.17 5 5 CYS B 7 ? ? -130.84 -58.12 6 5 SER B 9 ? ? -59.01 -8.63 7 5 GLU B 21 ? ? -143.60 -16.13 8 5 THR B 27 ? ? 71.55 164.57 9 5 HIX B 29 ? ? -57.32 96.18 10 6 HIX B 29 ? ? -69.13 88.22 11 7 CYS B 7 ? ? -121.53 -70.46 12 7 CYS B 19 ? ? -136.87 -31.68 13 7 THR B 27 ? ? 75.07 160.03 14 7 HIX B 29 ? ? -55.78 97.75 15 8 SER B 9 ? ? -57.17 -6.19 16 8 HIX B 29 ? ? -66.35 26.41 17 9 THR B 27 ? ? 72.89 167.82 18 10 CYS A 20 ? ? -121.13 -161.91 19 10 THR B 27 ? ? 71.69 165.78 20 10 HIX B 29 ? ? -60.28 97.75 21 12 CYS A 20 ? ? -129.22 -165.59 22 12 THR B 27 ? ? 107.51 151.12 23 13 THR B 27 ? ? 73.73 163.62 24 15 GLU B 21 ? ? -140.11 -23.61 25 16 THR B 27 ? ? 68.83 169.32 26 17 ARG B 22 ? ? -95.34 30.46 27 17 THR B 27 ? ? 74.14 149.30 28 18 CYS B 19 ? ? -132.43 -39.19 29 18 HIX B 29 ? ? -65.82 81.25 30 20 CYS A 20 ? ? -127.70 -160.94 31 20 THR B 27 ? ? 75.52 163.55 32 21 HIX B 29 ? ? -55.41 98.47 33 22 THR B 27 ? ? 77.76 159.72 34 23 GLU B 21 ? ? 74.56 -20.92 35 23 HIX B 29 ? ? -60.88 97.06 36 24 SER B 9 ? ? -59.88 -8.58 37 24 ARG B 22 ? ? -99.75 37.59 38 24 THR B 27 ? ? 71.25 167.73 39 25 HIX B 29 ? ? -59.85 101.60 40 26 CYS B 19 ? ? -93.98 -61.57 41 26 GLU B 21 ? ? 65.57 -23.90 42 26 ARG B 22 ? ? -88.27 30.33 43 26 PHE B 24 ? ? -54.69 173.79 44 27 ARG B 22 ? ? -97.11 38.23 45 28 HIX B 29 ? ? -69.02 94.51 46 29 THR B 27 ? ? 69.11 167.15 47 30 CYS B 7 ? ? -130.85 -43.76 48 30 GLU B 21 ? ? 62.98 -19.15 49 30 HIX B 29 ? ? -61.04 87.77 #