data_2N3P # _entry.id 2N3P # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104382 RCSB ? ? 2N3P PDB pdb_00002n3p 10.2210/pdb2n3p/pdb 25653 BMRB ? ? D_1000104382 WWPDB ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25653 BMRB unspecified . 2n2g PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N3P _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2015-06-09 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Su, M.' 1 'Jung, J.H.' 2 # _citation.id primary _citation.title 'Stable and non-cytotoxic cystine knot peptides from a marine sponge asteropus' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Su, M.' 1 ? primary 'Li, H.' 2 ? primary 'Wang, H.' 3 ? primary 'Kim, E.' 4 ? primary 'Hong, J.' 5 ? primary 'Hamann, M.T.' 6 ? primary 'Kim, H.' 7 ? primary 'Kim, E.' 8 ? primary 'Jung, J.H.' 9 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description Asteropsin_G _entity.formula_weight 3524.967 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code '(PCA)WCAEEGESCEVYPCCDGLICYPTFPEPICGV' _entity_poly.pdbx_seq_one_letter_code_can QWCAEEGESCEVYPCCDGLICYPTFPEPICGV _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PCA n 1 2 TRP n 1 3 CYS n 1 4 ALA n 1 5 GLU n 1 6 GLU n 1 7 GLY n 1 8 GLU n 1 9 SER n 1 10 CYS n 1 11 GLU n 1 12 VAL n 1 13 TYR n 1 14 PRO n 1 15 CYS n 1 16 CYS n 1 17 ASP n 1 18 GLY n 1 19 LEU n 1 20 ILE n 1 21 CYS n 1 22 TYR n 1 23 PRO n 1 24 THR n 1 25 PHE n 1 26 PRO n 1 27 GLU n 1 28 PRO n 1 29 ILE n 1 30 CYS n 1 31 GLY n 1 32 VAL n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific Asteropus _entity_src_nat.pdbx_ncbi_taxonomy_id 350938 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 2N3P _struct_ref.pdbx_db_accession 2N3P _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N3P _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 2N3P _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 32 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 32 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 PCA 'L-peptide linking' n 'PYROGLUTAMIC ACID' ? 'C5 H7 N O3' 129.114 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-1H TOCSY' 1 2 1 '2D DQF-COSY' 1 3 1 '2D 1H-1H NOESY' 1 4 1 '2D 1H-13C HSQC' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '10 mM Asteropsin G-1, DMSO' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system DMSO # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Varian _pdbx_nmr_spectrometer.model INOVA _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Varian INOVA' # _pdbx_nmr_refine.entry_id 2N3P _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N3P _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N3P _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Brunger, Adams, Clore, Gros, Nilges and Read' processing CNS 1 ? Goddard 'chemical shift assignment' Sparky 2 ? 'Guntert, Mumenthaler and Wuthrich' processing CYANA 3 ? ? refinement CNS 4 ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N3P _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N3P _struct.title 'SOLUTION NMR STRUCTURE of ASTEROPSIN G from MARINE SPONGE ASTEROPUS' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N3P _struct_keywords.pdbx_keywords TOXIN _struct_keywords.text 'KNOTTIN, SPONGE, TOXIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 16 SG ? ? A CYS 3 A CYS 16 1_555 ? ? ? ? ? ? ? 2.032 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 21 SG ? ? A CYS 10 A CYS 21 1_555 ? ? ? ? ? ? ? 2.031 ? ? disulf3 disulf ? ? A CYS 15 SG ? ? ? 1_555 A CYS 30 SG ? ? A CYS 15 A CYS 30 1_555 ? ? ? ? ? ? ? 2.034 ? ? covale1 covale both ? A PCA 1 C ? ? ? 1_555 A TRP 2 N ? ? A PCA 1 A TRP 2 1_555 ? ? ? ? ? ? ? 1.338 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 1 0.01 2 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 2 0.08 3 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 3 -0.08 4 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 4 0.04 5 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 5 0.03 6 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 6 -0.02 7 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 7 0.00 8 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 8 0.08 9 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 9 0.08 10 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 10 0.05 11 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 11 0.05 12 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 12 0.06 13 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 13 0.19 14 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 14 0.00 15 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 15 0.05 16 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 16 0.13 17 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 17 0.16 18 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 18 -0.09 19 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 19 0.06 20 PHE 25 A . ? PHE 25 A PRO 26 A ? PRO 26 A 20 0.14 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 20 ? TYR A 22 ? ILE A 20 TYR A 22 A 2 ILE A 29 ? GLY A 31 ? ILE A 29 GLY A 31 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 22 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 22 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 29 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 29 # _atom_sites.entry_id 2N3P _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PCA 1 1 1 PCA PCA A . n A 1 2 TRP 2 2 2 TRP TRP A . n A 1 3 CYS 3 3 3 CYS CYS A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 TYR 22 22 22 TYR TYR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 VAL 32 32 32 VAL VAL A . n # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PCA _pdbx_struct_mod_residue.label_seq_id 1 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PCA _pdbx_struct_mod_residue.auth_seq_id 1 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id GLN _pdbx_struct_mod_residue.details 'PYROGLUTAMIC ACID' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-06-08 2 'Structure model' 2 0 2019-12-25 3 'Structure model' 2 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Polymer sequence' 4 3 'Structure model' 'Database references' 5 3 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' entity_poly 2 2 'Structure model' pdbx_nmr_software 3 2 'Structure model' pdbx_struct_mod_residue 4 2 'Structure model' struct_conn 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_entity_poly.pdbx_seq_one_letter_code_can' 2 2 'Structure model' '_pdbx_nmr_software.name' 3 2 'Structure model' '_pdbx_struct_mod_residue.parent_comp_id' 4 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 3 'Structure model' '_database_2.pdbx_DOI' 6 3 'Structure model' '_database_2.pdbx_database_accession' 7 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 2N3P _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details 'THE SEQUENCE OF THIS PROTEIN WAS NOT AVAILABLE AT THE UNIPROT KNOWLEDGEBASE DATABASE (UNIPROTKB) AT THE TIME OF DEPOSITION.' _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # _pdbx_nmr_exptl_sample.component 'Asteropsin G-1' _pdbx_nmr_exptl_sample.concentration 10 _pdbx_nmr_exptl_sample.concentration_range ? _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling ? _pdbx_nmr_exptl_sample.solution_id 1 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 5 ? ? -89.73 -156.65 2 1 PRO A 14 ? ? -70.14 -168.42 3 1 PRO A 23 ? ? -69.91 64.41 4 2 GLU A 5 ? ? -89.64 -156.80 5 2 PRO A 14 ? ? -70.19 -168.57 6 2 PRO A 23 ? ? -69.84 64.45 7 3 GLU A 5 ? ? -88.77 -156.28 8 3 PRO A 14 ? ? -69.39 -172.72 9 3 PRO A 23 ? ? -69.73 64.61 10 4 GLU A 5 ? ? -89.46 -156.43 11 4 PRO A 14 ? ? -69.35 -172.31 12 5 GLU A 5 ? ? -88.67 -154.46 13 5 CYS A 10 ? ? -96.77 33.33 14 5 PRO A 14 ? ? -69.55 -171.76 15 6 GLU A 5 ? ? -88.24 -155.96 16 6 PRO A 14 ? ? -69.53 -172.10 17 7 GLU A 5 ? ? -88.14 -154.32 18 7 PRO A 14 ? ? -70.50 -169.07 19 8 GLU A 5 ? ? -88.23 -156.78 20 8 PRO A 14 ? ? -69.07 -172.04 21 9 GLU A 5 ? ? -89.68 -156.34 22 9 PRO A 14 ? ? -69.23 -172.17 23 10 GLU A 5 ? ? -89.14 -156.30 24 10 PRO A 14 ? ? -70.21 -168.35 25 11 GLU A 5 ? ? -89.08 -156.12 26 12 GLU A 5 ? ? -89.00 -156.11 27 13 GLU A 5 ? ? -89.26 -155.96 28 14 GLU A 5 ? ? -88.06 -156.20 29 15 GLU A 5 ? ? -89.59 -156.58 30 16 GLU A 5 ? ? -89.11 -155.87 31 16 PRO A 23 ? ? -69.70 64.64 32 17 GLU A 5 ? ? -88.34 -155.70 33 18 GLU A 5 ? ? -88.07 -156.22 34 19 GLU A 5 ? ? -89.28 -156.09 35 20 GLU A 5 ? ? -88.62 -155.74 #