data_2N7A # _entry.id 2N7A # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104511 RCSB ? ? 2N7A PDB pdb_00002n7a 10.2210/pdb2n7a/pdb 25798 BMRB ? ? D_1000104511 WWPDB ? ? # loop_ _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.content_type _pdbx_database_related.details 25798 BMRB unspecified . 2N7B PDB unspecified . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2N7A _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2015-09-07 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Proepster, J.M.' 1 'Yang, F.' 2 'Rabbani, S.' 3 'Ernst, B.' 4 'Allain, F.H.-T.' 5 'Schubert, M.' 6 # _citation.id primary _citation.title 'Structural basis for sulfation-dependent self-glycan recognition by the human immune-inhibitory receptor Siglec-8.' _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_volume 113 _citation.page_first E4170 _citation.page_last E4179 _citation.year 2016 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 0027-8424 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 27357658 _citation.pdbx_database_id_DOI 10.1073/pnas.1602214113 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Propster, J.M.' 1 ? primary 'Yang, F.' 2 ? primary 'Rabbani, S.' 3 ? primary 'Ernst, B.' 4 ? primary 'Allain, F.H.' 5 ? primary 'Schubert, M.' 6 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Sialic acid-binding Ig-like lectin 8' _entity.formula_weight 16665.463 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation C26S _entity.pdbx_fragment 'N-terminal lectin domain (UNP residues 17-155)' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Siglec-8, Sialoadhesin family member 2, SAF-2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MEGDRQYGDGYLLQVQELVTVQEGLSVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRF QLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHGSLVPR ; _entity_poly.pdbx_seq_one_letter_code_can ;MEGDRQYGDGYLLQVQELVTVQEGLSVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRF QLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHGSLVPR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 GLY n 1 4 ASP n 1 5 ARG n 1 6 GLN n 1 7 TYR n 1 8 GLY n 1 9 ASP n 1 10 GLY n 1 11 TYR n 1 12 LEU n 1 13 LEU n 1 14 GLN n 1 15 VAL n 1 16 GLN n 1 17 GLU n 1 18 LEU n 1 19 VAL n 1 20 THR n 1 21 VAL n 1 22 GLN n 1 23 GLU n 1 24 GLY n 1 25 LEU n 1 26 SER n 1 27 VAL n 1 28 HIS n 1 29 VAL n 1 30 PRO n 1 31 CYS n 1 32 SER n 1 33 PHE n 1 34 SER n 1 35 TYR n 1 36 PRO n 1 37 GLN n 1 38 ASP n 1 39 GLY n 1 40 TRP n 1 41 THR n 1 42 ASP n 1 43 SER n 1 44 ASP n 1 45 PRO n 1 46 VAL n 1 47 HIS n 1 48 GLY n 1 49 TYR n 1 50 TRP n 1 51 PHE n 1 52 ARG n 1 53 ALA n 1 54 GLY n 1 55 ASP n 1 56 ARG n 1 57 PRO n 1 58 TYR n 1 59 GLN n 1 60 ASP n 1 61 ALA n 1 62 PRO n 1 63 VAL n 1 64 ALA n 1 65 THR n 1 66 ASN n 1 67 ASN n 1 68 PRO n 1 69 ASP n 1 70 ARG n 1 71 GLU n 1 72 VAL n 1 73 GLN n 1 74 ALA n 1 75 GLU n 1 76 THR n 1 77 GLN n 1 78 GLY n 1 79 ARG n 1 80 PHE n 1 81 GLN n 1 82 LEU n 1 83 LEU n 1 84 GLY n 1 85 ASP n 1 86 ILE n 1 87 TRP n 1 88 SER n 1 89 ASN n 1 90 ASP n 1 91 CYS n 1 92 SER n 1 93 LEU n 1 94 SER n 1 95 ILE n 1 96 ARG n 1 97 ASP n 1 98 ALA n 1 99 ARG n 1 100 LYS n 1 101 ARG n 1 102 ASP n 1 103 LYS n 1 104 GLY n 1 105 SER n 1 106 TYR n 1 107 PHE n 1 108 PHE n 1 109 ARG n 1 110 LEU n 1 111 GLU n 1 112 ARG n 1 113 GLY n 1 114 SER n 1 115 MET n 1 116 LYS n 1 117 TRP n 1 118 SER n 1 119 TYR n 1 120 LYS n 1 121 SER n 1 122 GLN n 1 123 LEU n 1 124 ASN n 1 125 TYR n 1 126 LYS n 1 127 THR n 1 128 LYS n 1 129 GLN n 1 130 LEU n 1 131 SER n 1 132 VAL n 1 133 PHE n 1 134 VAL n 1 135 THR n 1 136 ALA n 1 137 LEU n 1 138 THR n 1 139 HIS n 1 140 GLY n 1 141 SER n 1 142 LEU n 1 143 VAL n 1 144 PRO n 1 145 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SAF2, SIGLEC8' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Rosetta-gami B (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET-43.1a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SIGL8_HUMAN _struct_ref.pdbx_db_accession Q9NYZ4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSDPVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRF QLLGDIWSNDCSLSIRDARKRDKGSYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTH ; _struct_ref.pdbx_align_begin 17 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2N7A _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 139 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NYZ4 _struct_ref_seq.db_align_beg 17 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 155 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 139 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2N7A SER A 26 ? UNP Q9NYZ4 CYS 42 'engineered mutation' 26 1 1 2N7A GLY A 140 ? UNP Q9NYZ4 ? ? 'expression tag' 140 2 1 2N7A SER A 141 ? UNP Q9NYZ4 ? ? 'expression tag' 141 3 1 2N7A LEU A 142 ? UNP Q9NYZ4 ? ? 'expression tag' 142 4 1 2N7A VAL A 143 ? UNP Q9NYZ4 ? ? 'expression tag' 143 5 1 2N7A PRO A 144 ? UNP Q9NYZ4 ? ? 'expression tag' 144 6 1 2N7A ARG A 145 ? UNP Q9NYZ4 ? ? 'expression tag' 145 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 2 '2D 1H-13C HSQC aliphatic' 1 3 2 '2D 1H-13C HSQC aromatic' 1 4 2 '3D HNCA' 1 5 2 '3D HNCACB' 1 6 2 '3D CBCA(CO)NH' 1 7 2 '3D HNCO' 1 8 2 '3D HN(CO)CA' 1 9 4 '3D HCCH-TOCSY' 1 10 2 '3D 1H-15N NOESY' 1 11 5 '2D 1H-1H NOESY' 1 12 2 '3D 1H-13C NOESY aliphatic' 1 13 2 '3D 1H-13C NOESY aromatic' 1 14 5 '2D 1H-1H TOCSY' 1 15 3 '2D 1H-13C constant-time HSQC to obtain stereospecific assignments of Val/Leu methyls' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.085 _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 293 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.3-1.2 mM [U-100% 15N] Siglec, 20 mM potassium phosphate, 40 mM sodium chloride, 95% H2O/5% D2O' 1 '95% H2O/5% D2O' '0.3-1.2 mM [U-100% 13C; U-100% 15N] Siglec, 20 mM potassium phosphate, 40 mM sodium chloride, 95% H2O/5% D2O' 2 '95% H2O/5% D2O' '0.3 mM [U-10% 13C; U-100% 15N] Siglec, 20 mM potassium phosphate, 40 mM sodium chloride, 95% H2O/5% D2O' 3 '95% H2O/5% D2O' '0.3-1.2 mM [U-100% 13C; U-100% 15N] Siglec, 20 mM potassium phosphate, 40 mM sodium chloride, 100% D2O' 4 '100% D2O' '0.3-1.2 mM [U-100% 15N] Siglec, 20 mM potassium phosphate, 40 mM sodium chloride, 100% D2O' 5 '100% D2O' # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 600 Bruker AVANCE 2 'Bruker Avance' 700 Bruker AVANCE 3 'Bruker Avance' 750 Bruker AVANCE 4 'Bruker Avance' 900 Bruker AVANCE 5 'Bruker Avance' # _pdbx_nmr_refine.entry_id 2N7A _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2N7A _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2N7A _pdbx_nmr_representative.selection_criteria 'closest to the average' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin 3.0 1 'Bruker Biospin' 'data analysis' TopSpin 3.0 2 'Bruker Biospin' processing TopSpin 3.0 3 Goddard 'chemical shift assignment' Sparky 3.114 4 Goddard 'data analysis' Sparky 3.114 5 'Herrmann, Guntert and Wuthrich' 'peak picking' ATNOS/CANDID 2.1 6 'Guntert, Mumenthaler and Wuthrich' 'structure calculation' CYANA 3.0 7 'Cornilescu, Delaglio and Bax' 'protein backbone torsion angle prediction from nmr chemical shifts' TALOS+ ? 8 'Laskowski and MacArthur' validation ProcheckNMR ? 9 'Case, D.A. et al.' refinement Amber 12 10 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2N7A _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2N7A _struct.title 'Solution structure of the human Siglec-8 lectin domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2N7A _struct_keywords.pdbx_keywords 'STRUCTURAL PROTEIN' _struct_keywords.text 'Sialic acid-binding immunoglobulin-like lectin 8, Siglec8, SAF-2, I-type lectin, carbohydrate-binding receptor, STRUCTURAL PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 MET A 1 ? ARG A 5 ? MET A 1 ARG A 5 5 ? 5 HELX_P HELX_P2 2 ASP A 85 ? ASN A 89 ? ASP A 85 ASN A 89 5 ? 5 HELX_P HELX_P3 3 ARG A 99 ? LYS A 103 ? ARG A 99 LYS A 103 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 31 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 91 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 31 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 91 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.040 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 5 ? C ? 4 ? D ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel C 1 2 ? parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel D 1 2 ? anti-parallel D 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 12 ? VAL A 15 ? LEU A 12 VAL A 15 A 2 CYS A 31 ? SER A 34 ? CYS A 31 SER A 34 B 1 LEU A 18 ? GLN A 22 ? LEU A 18 GLN A 22 B 2 LEU A 130 ? THR A 135 ? LEU A 130 THR A 135 B 3 GLY A 104 ? ARG A 112 ? GLY A 104 ARG A 112 B 4 VAL A 46 ? ARG A 52 ? VAL A 46 ARG A 52 B 5 ALA A 64 ? THR A 65 ? ALA A 64 THR A 65 C 1 LEU A 18 ? GLN A 22 ? LEU A 18 GLN A 22 C 2 LEU A 130 ? THR A 135 ? LEU A 130 THR A 135 C 3 GLY A 104 ? ARG A 112 ? GLY A 104 ARG A 112 C 4 MET A 115 ? SER A 118 ? MET A 115 SER A 118 D 1 VAL A 27 ? VAL A 29 ? VAL A 27 VAL A 29 D 2 LEU A 93 ? ILE A 95 ? LEU A 93 ILE A 95 D 3 PHE A 80 ? LEU A 82 ? PHE A 80 LEU A 82 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 12 ? N LEU A 12 O SER A 34 ? O SER A 34 B 1 2 N VAL A 19 ? N VAL A 19 O SER A 131 ? O SER A 131 B 2 3 O VAL A 132 ? O VAL A 132 N GLY A 104 ? N GLY A 104 B 3 4 O PHE A 107 ? O PHE A 107 N PHE A 51 ? N PHE A 51 B 4 5 N TRP A 50 ? N TRP A 50 O ALA A 64 ? O ALA A 64 C 1 2 N VAL A 19 ? N VAL A 19 O SER A 131 ? O SER A 131 C 2 3 O VAL A 132 ? O VAL A 132 N GLY A 104 ? N GLY A 104 C 3 4 N LEU A 110 ? N LEU A 110 O TRP A 117 ? O TRP A 117 D 1 2 N VAL A 29 ? N VAL A 29 O LEU A 93 ? O LEU A 93 D 2 3 O SER A 94 ? O SER A 94 N GLN A 81 ? N GLN A 81 # _atom_sites.entry_id 2N7A _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLY 3 3 3 GLY GLY A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 ARG 5 5 5 ARG ARG A . n A 1 6 GLN 6 6 6 GLN GLN A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLN 14 14 14 GLN GLN A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 VAL 27 27 27 VAL VAL A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 CYS 31 31 31 CYS CYS A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ASP 38 38 38 ASP ASP A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 THR 41 41 41 THR THR A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 HIS 47 47 47 HIS HIS A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 TYR 49 49 49 TYR TYR A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ALA 53 53 53 ALA ALA A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ASP 55 55 55 ASP ASP A . n A 1 56 ARG 56 56 56 ARG ARG A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ALA 64 64 64 ALA ALA A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ASN 66 66 66 ASN ASN A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 ARG 79 79 79 ARG ARG A . n A 1 80 PHE 80 80 80 PHE PHE A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 LEU 82 82 82 LEU LEU A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLY 84 84 84 GLY GLY A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 ILE 86 86 86 ILE ILE A . n A 1 87 TRP 87 87 87 TRP TRP A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 CYS 91 91 91 CYS CYS A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 SER 94 94 94 SER SER A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 ARG 96 96 96 ARG ARG A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 ARG 101 101 101 ARG ARG A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 TYR 106 106 106 TYR TYR A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 GLU 111 111 111 GLU GLU A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 MET 115 115 115 MET MET A . n A 1 116 LYS 116 116 116 LYS LYS A . n A 1 117 TRP 117 117 117 TRP TRP A . n A 1 118 SER 118 118 118 SER SER A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLN 122 122 122 GLN GLN A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 TYR 125 125 125 TYR TYR A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 THR 127 127 127 THR THR A . n A 1 128 LYS 128 128 128 LYS LYS A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 VAL 132 132 132 VAL VAL A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 ALA 136 136 136 ALA ALA A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 THR 138 138 138 THR THR A . n A 1 139 HIS 139 139 139 HIS HIS A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 SER 141 141 141 SER SER A . n A 1 142 LEU 142 142 142 LEU LEU A . n A 1 143 VAL 143 143 143 VAL VAL A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 ARG 145 145 145 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-06 2 'Structure model' 1 1 2016-07-27 3 'Structure model' 1 2 2016-08-03 4 'Structure model' 1 3 2016-10-12 5 'Structure model' 1 4 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Structure summary' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' database_2 2 5 'Structure model' pdbx_database_status 3 5 'Structure model' pdbx_nmr_software 4 5 'Structure model' pdbx_nmr_spectrometer 5 5 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 5 'Structure model' '_pdbx_nmr_software.name' 5 5 'Structure model' '_pdbx_nmr_spectrometer.model' 6 5 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Siglec-8-1 ? 0.3-1.2 mM '[U-100% 15N]' 1 'potassium phosphate-2' 20 ? mM ? 1 'sodium chloride-3' 40 ? mM ? 1 Siglec-8-4 ? 0.3-1.2 mM '[U-100% 13C; U-100% 15N]' 2 'potassium phosphate-5' 20 ? mM ? 2 'sodium chloride-6' 40 ? mM ? 2 Siglec-8-7 0.3 ? mM '[U-10% 13C; U-100% 15N]' 3 'potassium phosphate-8' 20 ? mM ? 3 'sodium chloride-9' 40 ? mM ? 3 Siglec-8-10 ? 0.3-1.2 mM '[U-100% 13C; U-100% 15N]' 4 'potassium phosphate-11' 20 ? mM ? 4 'sodium chloride-12' 40 ? mM ? 4 Siglec-8-13 ? 0.3-1.2 mM '[U-100% 15N]' 5 'potassium phosphate-14' 20 ? mM ? 5 'sodium chloride-15' 40 ? mM ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 138 ? ? -155.38 -1.38 2 1 HIS A 139 ? ? -151.01 0.94 3 1 VAL A 143 ? ? 44.74 85.47 4 2 GLN A 59 ? ? -134.60 -31.18 5 2 ASN A 124 ? ? -141.30 -30.44 6 2 HIS A 139 ? ? -150.46 30.26 7 2 VAL A 143 ? ? 59.56 134.22 8 3 THR A 138 ? ? -145.30 -19.13 9 3 VAL A 143 ? ? 60.05 132.80 10 4 GLN A 59 ? ? -134.39 -30.89 11 4 THR A 138 ? ? -147.49 -0.26 12 4 HIS A 139 ? ? -151.05 -11.65 13 4 VAL A 143 ? ? 63.79 128.72 14 5 THR A 138 ? ? -145.61 -18.81 15 5 VAL A 143 ? ? 58.73 128.78 16 6 THR A 138 ? ? -146.56 -20.93 17 6 VAL A 143 ? ? 58.14 127.79 18 7 THR A 138 ? ? -147.30 -19.62 19 7 VAL A 143 ? ? 42.63 83.97 20 8 THR A 138 ? ? -145.27 -18.30 21 8 VAL A 143 ? ? 47.30 99.00 22 9 ASN A 124 ? ? -151.16 -15.84 23 9 THR A 138 ? ? -145.03 -16.93 24 9 VAL A 143 ? ? 48.45 83.86 25 10 THR A 138 ? ? -150.09 11.42 26 10 VAL A 143 ? ? 49.15 79.06 27 11 ARG A 79 ? ? -131.45 -41.18 28 11 THR A 138 ? ? -147.74 -25.53 29 11 VAL A 143 ? ? 59.81 127.75 30 12 ASN A 124 ? ? -154.20 -25.95 31 12 THR A 138 ? ? -145.23 -20.57 32 12 VAL A 143 ? ? 49.81 99.95 33 13 ASN A 124 ? ? -151.45 -21.28 34 13 THR A 138 ? ? -146.61 -19.85 35 13 VAL A 143 ? ? 48.32 86.62 36 14 ASN A 124 ? ? -140.84 -29.50 37 14 THR A 138 ? ? -148.23 11.21 38 14 VAL A 143 ? ? 59.81 122.70 39 15 ASN A 124 ? ? -152.25 -22.32 40 15 HIS A 139 ? ? -150.15 29.06 41 15 VAL A 143 ? ? 51.29 78.35 42 16 ASN A 124 ? ? -152.98 -23.34 43 16 THR A 138 ? ? -147.32 11.44 44 16 VAL A 143 ? ? 49.29 86.04 45 17 THR A 138 ? ? -144.07 -16.23 46 17 VAL A 143 ? ? 58.97 128.75 47 18 ASN A 124 ? ? -154.61 -27.81 48 18 THR A 138 ? ? -150.80 5.24 49 18 VAL A 143 ? ? 59.67 131.19 50 19 THR A 138 ? ? -154.97 -1.20 51 19 HIS A 139 ? ? -150.34 2.03 52 19 VAL A 143 ? ? 58.61 127.09 53 20 ASP A 4 ? ? -151.69 23.48 54 20 THR A 138 ? ? -145.18 -18.06 55 20 VAL A 143 ? ? 46.57 87.71 #