data_2N8N
# 
_entry.id   2N8N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
RCSB104560   RCSB  ?            ?                   
2N8N         PDB   pdb_00002n8n 10.2210/pdb2n8n/pdb 
25856        BMRB  ?            10.13018/BMR25856   
D_1000104560 WWPDB ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-10-26 
2 'Structure model' 1 1 2016-11-16 
3 'Structure model' 1 2 2023-06-14 
4 'Structure model' 1 3 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Data collection'     
3 3 'Structure model' 'Database references' 
4 3 'Structure model' Other                 
5 4 'Structure model' 'Data collection'     
6 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' database_2            
2 3 'Structure model' pdbx_database_status  
3 3 'Structure model' pdbx_nmr_spectrometer 
4 4 'Structure model' chem_comp_atom        
5 4 'Structure model' chem_comp_bond        
6 4 'Structure model' database_2            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_database_2.pdbx_DOI'                       
2 3 'Structure model' '_database_2.pdbx_database_accession'        
3 3 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
4 3 'Structure model' '_pdbx_nmr_spectrometer.model'               
5 4 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2N8N 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2015-10-21 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.db_id          25856 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kim, D.' 1 
'Lee, K.' 2 
'Lee, B.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structure and dynamics study of translation initiation factor 1 from Staphylococcus aureus suggests its RNA binding mode' 
_citation.journal_abbrev            Biochim.Biophys.Acta 
_citation.journal_volume            1865 
_citation.page_first                65 
_citation.page_last                 75 
_citation.year                      2017 
_citation.journal_id_ASTM           BBACAQ 
_citation.country                   NE 
_citation.journal_id_ISSN           0006-3002 
_citation.journal_id_CSD            0113 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   27784646 
_citation.pdbx_database_id_DOI      10.1016/j.bbapap.2016.10.009 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kim, D.H.'  1 ? 
primary 'Kang, S.J.' 2 ? 
primary 'Lee, K.Y.'  3 ? 
primary 'Jang, S.B.' 4 ? 
primary 'Kang, S.M.' 5 ? 
primary 'Lee, B.J.'  6 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Translation initiation factor IF-1' 
_entity.formula_weight             8291.646 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK 
_entity_poly.pdbx_seq_one_letter_code_can   MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  LYS n 
1 4  GLN n 
1 5  ASP n 
1 6  VAL n 
1 7  ILE n 
1 8  GLU n 
1 9  LEU n 
1 10 GLU n 
1 11 GLY n 
1 12 THR n 
1 13 VAL n 
1 14 LEU n 
1 15 ASP n 
1 16 THR n 
1 17 LEU n 
1 18 PRO n 
1 19 ASN n 
1 20 ALA n 
1 21 MET n 
1 22 PHE n 
1 23 LYS n 
1 24 VAL n 
1 25 GLU n 
1 26 LEU n 
1 27 GLU n 
1 28 ASN n 
1 29 GLY n 
1 30 HIS n 
1 31 GLU n 
1 32 ILE n 
1 33 LEU n 
1 34 ALA n 
1 35 HIS n 
1 36 VAL n 
1 37 SER n 
1 38 GLY n 
1 39 LYS n 
1 40 ILE n 
1 41 ARG n 
1 42 MET n 
1 43 ASN n 
1 44 TYR n 
1 45 ILE n 
1 46 ARG n 
1 47 ILE n 
1 48 LEU n 
1 49 PRO n 
1 50 GLY n 
1 51 ASP n 
1 52 LYS n 
1 53 VAL n 
1 54 THR n 
1 55 VAL n 
1 56 GLU n 
1 57 MET n 
1 58 SER n 
1 59 PRO n 
1 60 TYR n 
1 61 ASP n 
1 62 LEU n 
1 63 THR n 
1 64 ARG n 
1 65 GLY n 
1 66 ARG n 
1 67 ILE n 
1 68 THR n 
1 69 TYR n 
1 70 ARG n 
1 71 TYR n 
1 72 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'infA, SAV2228' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    Mu50 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Staphylococcus aureus subsp. aureus Mu50' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     158878 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET21a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  MET 1  1  1  MET MET A . n 
A 1 2  ALA 2  2  2  ALA ALA A . n 
A 1 3  LYS 3  3  3  LYS LYS A . n 
A 1 4  GLN 4  4  4  GLN GLN A . n 
A 1 5  ASP 5  5  5  ASP ASP A . n 
A 1 6  VAL 6  6  6  VAL VAL A . n 
A 1 7  ILE 7  7  7  ILE ILE A . n 
A 1 8  GLU 8  8  8  GLU GLU A . n 
A 1 9  LEU 9  9  9  LEU LEU A . n 
A 1 10 GLU 10 10 10 GLU GLU A . n 
A 1 11 GLY 11 11 11 GLY GLY A . n 
A 1 12 THR 12 12 12 THR THR A . n 
A 1 13 VAL 13 13 13 VAL VAL A . n 
A 1 14 LEU 14 14 14 LEU LEU A . n 
A 1 15 ASP 15 15 15 ASP ASP A . n 
A 1 16 THR 16 16 16 THR THR A . n 
A 1 17 LEU 17 17 17 LEU LEU A . n 
A 1 18 PRO 18 18 18 PRO PRO A . n 
A 1 19 ASN 19 19 19 ASN ASN A . n 
A 1 20 ALA 20 20 20 ALA ALA A . n 
A 1 21 MET 21 21 21 MET MET A . n 
A 1 22 PHE 22 22 22 PHE PHE A . n 
A 1 23 LYS 23 23 23 LYS LYS A . n 
A 1 24 VAL 24 24 24 VAL VAL A . n 
A 1 25 GLU 25 25 25 GLU GLU A . n 
A 1 26 LEU 26 26 26 LEU LEU A . n 
A 1 27 GLU 27 27 27 GLU GLU A . n 
A 1 28 ASN 28 28 28 ASN ASN A . n 
A 1 29 GLY 29 29 29 GLY GLY A . n 
A 1 30 HIS 30 30 30 HIS HIS A . n 
A 1 31 GLU 31 31 31 GLU GLU A . n 
A 1 32 ILE 32 32 32 ILE ILE A . n 
A 1 33 LEU 33 33 33 LEU LEU A . n 
A 1 34 ALA 34 34 34 ALA ALA A . n 
A 1 35 HIS 35 35 35 HIS HIS A . n 
A 1 36 VAL 36 36 36 VAL VAL A . n 
A 1 37 SER 37 37 37 SER SER A . n 
A 1 38 GLY 38 38 38 GLY GLY A . n 
A 1 39 LYS 39 39 39 LYS LYS A . n 
A 1 40 ILE 40 40 40 ILE ILE A . n 
A 1 41 ARG 41 41 41 ARG ARG A . n 
A 1 42 MET 42 42 42 MET MET A . n 
A 1 43 ASN 43 43 43 ASN ASN A . n 
A 1 44 TYR 44 44 44 TYR TYR A . n 
A 1 45 ILE 45 45 45 ILE ILE A . n 
A 1 46 ARG 46 46 46 ARG ARG A . n 
A 1 47 ILE 47 47 47 ILE ILE A . n 
A 1 48 LEU 48 48 48 LEU LEU A . n 
A 1 49 PRO 49 49 49 PRO PRO A . n 
A 1 50 GLY 50 50 50 GLY GLY A . n 
A 1 51 ASP 51 51 51 ASP ASP A . n 
A 1 52 LYS 52 52 52 LYS LYS A . n 
A 1 53 VAL 53 53 53 VAL VAL A . n 
A 1 54 THR 54 54 54 THR THR A . n 
A 1 55 VAL 55 55 55 VAL VAL A . n 
A 1 56 GLU 56 56 56 GLU GLU A . n 
A 1 57 MET 57 57 57 MET MET A . n 
A 1 58 SER 58 58 58 SER SER A . n 
A 1 59 PRO 59 59 59 PRO PRO A . n 
A 1 60 TYR 60 60 60 TYR TYR A . n 
A 1 61 ASP 61 61 61 ASP ASP A . n 
A 1 62 LEU 62 62 62 LEU LEU A . n 
A 1 63 THR 63 63 63 THR THR A . n 
A 1 64 ARG 64 64 64 ARG ARG A . n 
A 1 65 GLY 65 65 65 GLY GLY A . n 
A 1 66 ARG 66 66 66 ARG ARG A . n 
A 1 67 ILE 67 67 67 ILE ILE A . n 
A 1 68 THR 68 68 68 THR THR A . n 
A 1 69 TYR 69 69 69 TYR TYR A . n 
A 1 70 ARG 70 70 70 ARG ARG A . n 
A 1 71 TYR 71 71 71 TYR TYR A . n 
A 1 72 LYS 72 72 72 LYS LYS A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2N8N 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2N8N 
_struct.title                     'Solution structure of translation initiation factor' 
_struct.pdbx_model_details        'lowest energy, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2N8N 
_struct_keywords.pdbx_keywords   TRANSLATION 
_struct_keywords.text            'translation initiation, RNA-binding, translation' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IF1_STAAM 
_struct_ref.pdbx_db_accession          P65118 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2N8N 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 72 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P65118 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  72 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       72 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       SER 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        37 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ASN 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        43 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        SER 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         37 
_struct_conf.end_auth_comp_id        ASN 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         43 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 7  ? THR A 16 ? ILE A 7  THR A 16 
A 2 MET A 21 ? LEU A 26 ? MET A 21 LEU A 26 
A 3 GLU A 31 ? VAL A 36 ? GLU A 31 VAL A 36 
A 4 ARG A 64 ? ARG A 70 ? ARG A 64 ARG A 70 
A 5 LYS A 52 ? MET A 57 ? LYS A 52 MET A 57 
A 6 ILE A 7  ? THR A 16 ? ILE A 7  THR A 16 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 12 ? N THR A 12 O GLU A 25 ? O GLU A 25 
A 2 3 N PHE A 22 ? N PHE A 22 O ALA A 34 ? O ALA A 34 
A 3 4 N HIS A 35 ? N HIS A 35 O ILE A 67 ? O ILE A 67 
A 4 5 O TYR A 69 ? O TYR A 69 N THR A 54 ? N THR A 54 
A 5 6 O MET A 57 ? O MET A 57 N ILE A 7  ? N ILE A 7  
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1  H2  A MET 1  ? ? OE1  A GLU 8  ? ? 1.56 
2  1  HZ3 A LYS 3  ? ? OE2  A GLU 8  ? ? 1.58 
3  1  OE1 A GLU 10 ? ? HZ3  A LYS 52 ? ? 1.59 
4  1  OD1 A ASP 15 ? ? HZ1  A LYS 23 ? ? 1.60 
5  2  H3  A MET 1  ? ? OD2  A ASP 5  ? ? 1.58 
6  2  OE2 A GLU 56 ? ? HH11 A ARG 66 ? ? 1.59 
7  3  H1  A MET 1  ? ? OD2  A ASP 5  ? ? 1.53 
8  4  HZ3 A LYS 52 ? ? OXT  A LYS 72 ? ? 1.60 
9  5  HZ3 A LYS 3  ? ? OE1  A GLU 56 ? ? 1.58 
10 5  OE1 A GLU 10 ? ? HZ3  A LYS 52 ? ? 1.59 
11 6  HZ2 A LYS 3  ? ? OE1  A GLU 56 ? ? 1.59 
12 7  HZ1 A LYS 3  ? ? OD1  A ASP 5  ? ? 1.57 
13 8  OD1 A ASP 51 ? ? HZ3  A LYS 72 ? ? 1.55 
14 9  H2  A MET 1  ? ? OE2  A GLU 56 ? ? 1.57 
15 9  OE1 A GLU 10 ? ? HZ3  A LYS 52 ? ? 1.58 
16 9  O   A ALA 2  ? ? HZ3  A LYS 3  ? ? 1.60 
17 10 HZ2 A LYS 3  ? ? OD1  A ASP 5  ? ? 1.57 
18 10 OE2 A GLU 56 ? ? HE   A ARG 66 ? ? 1.60 
19 11 H3  A MET 1  ? ? OE1  A GLU 8  ? ? 1.56 
20 11 HZ3 A LYS 52 ? ? OXT  A LYS 72 ? ? 1.58 
21 11 OD2 A ASP 51 ? ? HH21 A ARG 70 ? ? 1.58 
22 11 OE1 A GLU 10 ? ? HZ1  A LYS 52 ? ? 1.59 
23 12 OD1 A ASP 61 ? ? H    A ARG 64 ? ? 1.57 
24 13 OD2 A ASP 51 ? ? HZ2  A LYS 72 ? ? 1.58 
25 13 H2  A MET 1  ? ? OE2  A GLU 8  ? ? 1.59 
26 14 HZ2 A LYS 3  ? ? OE1  A GLU 8  ? ? 1.54 
27 14 H2  A MET 1  ? ? OE2  A GLU 8  ? ? 1.59 
28 15 H1  A MET 1  ? ? OE2  A GLU 8  ? ? 1.51 
29 15 OD2 A ASP 51 ? ? HZ3  A LYS 72 ? ? 1.54 
30 15 H3  A MET 1  ? ? OE1  A GLN 4  ? ? 1.57 
31 15 HG  A SER 58 ? ? OD2  A ASP 61 ? ? 1.58 
32 15 HZ3 A LYS 23 ? ? OE1  A GLU 25 ? ? 1.59 
33 16 H3  A MET 1  ? ? OD2  A ASP 5  ? ? 1.51 
34 16 OD1 A ASP 51 ? ? HZ2  A LYS 72 ? ? 1.54 
35 16 OD1 A ASP 15 ? ? HZ2  A LYS 23 ? ? 1.58 
36 16 OE2 A GLU 10 ? ? HZ1  A LYS 52 ? ? 1.60 
37 17 H3  A MET 1  ? ? OE2  A GLU 8  ? ? 1.55 
38 18 H2  A MET 1  ? ? OD2  A ASP 5  ? ? 1.51 
39 18 HZ3 A LYS 3  ? ? OD1  A ASP 5  ? ? 1.56 
40 18 OE2 A GLU 10 ? ? HZ3  A LYS 52 ? ? 1.57 
41 19 OE2 A GLU 56 ? ? HE   A ARG 66 ? ? 1.56 
42 19 H2  A MET 1  ? ? OD2  A ASP 5  ? ? 1.57 
43 19 OD1 A ASP 61 ? ? H    A ARG 64 ? ? 1.59 
44 20 HZ3 A LYS 3  ? ? OE2  A GLU 8  ? ? 1.56 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  ASN A 19 ? ? 73.50   41.27   
2  1  TYR A 44 ? ? -63.20  26.35   
3  1  ASP A 61 ? ? -124.26 -84.08  
4  2  ALA A 2  ? ? 167.53  -78.80  
5  2  ASP A 5  ? ? -163.56 -56.24  
6  2  TYR A 44 ? ? -65.91  91.41   
7  2  ASP A 61 ? ? -123.09 -71.01  
8  2  LEU A 62 ? ? 59.86   14.18   
9  3  ASP A 5  ? ? -56.70  109.15  
10 3  ASP A 61 ? ? -116.00 -79.49  
11 3  LEU A 62 ? ? 58.61   16.57   
12 4  LYS A 3  ? ? 176.11  -174.53 
13 4  ILE A 45 ? ? -82.95  34.20   
14 4  ASP A 61 ? ? -123.82 -65.74  
15 5  ASP A 5  ? ? 70.46   -70.60  
16 5  ILE A 45 ? ? -77.19  38.29   
17 5  ASP A 61 ? ? -116.04 -80.20  
18 5  LEU A 62 ? ? 58.06   18.22   
19 6  ASP A 5  ? ? -73.34  -76.91  
20 6  ILE A 45 ? ? -83.25  38.28   
21 6  ASP A 61 ? ? -103.36 -85.39  
22 6  LEU A 62 ? ? 59.19   10.50   
23 7  ASP A 61 ? ? -121.94 -65.49  
24 8  LYS A 3  ? ? -176.88 -48.19  
25 8  PRO A 18 ? ? -49.65  152.38  
26 8  ASP A 61 ? ? -105.42 -78.63  
27 8  LEU A 62 ? ? 59.25   18.27   
28 9  LYS A 3  ? ? -144.08 -60.65  
29 9  ILE A 45 ? ? -82.96  40.05   
30 9  ASP A 61 ? ? -123.06 -59.02  
31 10 ASP A 61 ? ? -107.62 -65.68  
32 11 LYS A 3  ? ? -140.17 33.78   
33 11 GLN A 4  ? ? -138.70 -85.25  
34 11 ASN A 19 ? ? 73.52   33.18   
35 11 ARG A 46 ? ? -68.16  99.91   
36 11 ASP A 61 ? ? -99.46  -90.76  
37 11 LEU A 62 ? ? 68.29   -25.94  
38 12 ALA A 20 ? ? 71.83   31.84   
39 12 ILE A 45 ? ? -83.93  39.46   
40 12 ASP A 61 ? ? -108.60 -81.07  
41 13 ASP A 61 ? ? -126.00 -75.90  
42 14 ASP A 5  ? ? -136.06 -66.17  
43 14 ILE A 45 ? ? -81.78  37.31   
44 14 PRO A 49 ? ? -39.83  127.88  
45 14 ASP A 61 ? ? -114.82 -78.17  
46 15 ASN A 19 ? ? 72.87   35.63   
47 15 ASP A 61 ? ? -104.39 -70.68  
48 16 LYS A 3  ? ? -157.19 -151.72 
49 16 ASP A 5  ? ? 85.39   19.43   
50 16 ASP A 61 ? ? -116.50 -79.07  
51 17 GLN A 4  ? ? -141.20 18.95   
52 17 ALA A 20 ? ? 72.90   30.63   
53 18 LYS A 3  ? ? -162.55 9.10    
54 18 GLN A 4  ? ? 50.13   81.50   
55 19 ALA A 2  ? ? -132.84 -65.93  
56 19 LYS A 3  ? ? -162.81 -60.91  
57 19 ALA A 20 ? ? 77.86   33.51   
58 19 ASP A 61 ? ? -124.95 -74.69  
59 20 ALA A 2  ? ? 69.39   -76.49  
60 20 ASN A 19 ? ? 74.15   40.90   
61 20 ASP A 61 ? ? -102.82 -97.24  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1  ARG A 66 ? ? 0.108 'SIDE CHAIN' 
2 9  ARG A 70 ? ? 0.081 'SIDE CHAIN' 
3 15 ARG A 70 ? ? 0.078 'SIDE CHAIN' 
4 19 ARG A 41 ? ? 0.077 'SIDE CHAIN' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2N8N 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.43 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_ensemble_rms.atom_type                              ? 
_pdbx_nmr_ensemble_rms.bond_angle_rms_dev                     ? 
_pdbx_nmr_ensemble_rms.bond_angle_rms_dev_error               ? 
_pdbx_nmr_ensemble_rms.chain_range_begin                      ? 
_pdbx_nmr_ensemble_rms.chain_range_end                        ? 
_pdbx_nmr_ensemble_rms.coord_average_rmsd_method              ? 
_pdbx_nmr_ensemble_rms.covalent_bond_rms_dev                  ? 
_pdbx_nmr_ensemble_rms.covalent_bond_rms_dev_error            ? 
_pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev                ? 
_pdbx_nmr_ensemble_rms.dihedral_angles_rms_dev_error          ? 
_pdbx_nmr_ensemble_rms.distance_rms_dev                       0.02 
_pdbx_nmr_ensemble_rms.distance_rms_dev_error                 ? 
_pdbx_nmr_ensemble_rms.entry_id                               2N8N 
_pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev         ? 
_pdbx_nmr_ensemble_rms.improper_torsion_angle_rms_dev_error   ? 
_pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev              ? 
_pdbx_nmr_ensemble_rms.peptide_planarity_rms_dev_error        ? 
_pdbx_nmr_ensemble_rms.residue_range_begin                    ? 
_pdbx_nmr_ensemble_rms.residue_range_end                      ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2N8N 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
_pdbx_nmr_sample_details.contents         '0.1mM PMSF-1, 1mM EDTA-2, 50mM sodium chloride-3, 20mM MES-4, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
PMSF-1              0.1 ? mM ? 1 
EDTA-2              1   ? mM ? 1 
'sodium chloride-3' 50  ? mM ? 1 
MES-4               20  ? mM ? 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      50 
_pdbx_nmr_exptl_sample_conditions.pH                  6 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         308 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '3D HNCO'         
1 2  1 '3D HCACO'        
1 3  1 '3D HNCA'         
1 4  1 '3D HN(CO)CA'     
1 5  1 '3D HNCACB'       
1 6  1 '3D HN(COCA)CB'   
1 7  1 '3D 1H-15N NOESY' 
1 8  1 '3D 1H-13C NOESY' 
1 9  1 '3D HCCH-TOCSY'   
1 10 1 '3D 1H-15N TOCSY' 
# 
_pdbx_nmr_constraints.disulfide_bond_constraints_total_count        ? 
_pdbx_nmr_constraints.entry_id                                      2N8N 
_pdbx_nmr_constraints.hydrogen_bond_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_beta-angle_constraints_total_count         ? 
_pdbx_nmr_constraints.NA_chi-angle_constraints_total_count          ? 
_pdbx_nmr_constraints.NA_delta-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count      ? 
_pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_other-angle_constraints_total_count        ? 
_pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count       ? 
_pdbx_nmr_constraints.NOE_constraints_total                         730 
_pdbx_nmr_constraints.NOE_interentity_total_count                   ? 
_pdbx_nmr_constraints.NOE_interproton_distance_evaluation           ? 
_pdbx_nmr_constraints.NOE_intraresidue_total_count                  117 
_pdbx_nmr_constraints.NOE_long_range_total_count                    284 
_pdbx_nmr_constraints.NOE_medium_range_total_count                  78 
_pdbx_nmr_constraints.NOE_motional_averaging_correction             ? 
_pdbx_nmr_constraints.NOE_pseudoatom_corrections                    ? 
_pdbx_nmr_constraints.NOE_sequential_total_count                    251 
_pdbx_nmr_constraints.protein_chi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_other_angle_constraints_total_count   ? 
_pdbx_nmr_constraints.protein_phi_angle_constraints_total_count     ? 
_pdbx_nmr_constraints.protein_psi_angle_constraints_total_count     ? 
# 
_pdbx_nmr_refine.entry_id           2N8N 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe 1 ? 
'Johnson, One Moon Scientific'                      'chemical shift assignment' NMRView 2 ? 
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA   3 ? 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNS     4 ? 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
GLN N    N N N 74  
GLN CA   C N S 75  
GLN C    C N N 76  
GLN O    O N N 77  
GLN CB   C N N 78  
GLN CG   C N N 79  
GLN CD   C N N 80  
GLN OE1  O N N 81  
GLN NE2  N N N 82  
GLN OXT  O N N 83  
GLN H    H N N 84  
GLN H2   H N N 85  
GLN HA   H N N 86  
GLN HB2  H N N 87  
GLN HB3  H N N 88  
GLN HG2  H N N 89  
GLN HG3  H N N 90  
GLN HE21 H N N 91  
GLN HE22 H N N 92  
GLN HXT  H N N 93  
GLU N    N N N 94  
GLU CA   C N S 95  
GLU C    C N N 96  
GLU O    O N N 97  
GLU CB   C N N 98  
GLU CG   C N N 99  
GLU CD   C N N 100 
GLU OE1  O N N 101 
GLU OE2  O N N 102 
GLU OXT  O N N 103 
GLU H    H N N 104 
GLU H2   H N N 105 
GLU HA   H N N 106 
GLU HB2  H N N 107 
GLU HB3  H N N 108 
GLU HG2  H N N 109 
GLU HG3  H N N 110 
GLU HE2  H N N 111 
GLU HXT  H N N 112 
GLY N    N N N 113 
GLY CA   C N N 114 
GLY C    C N N 115 
GLY O    O N N 116 
GLY OXT  O N N 117 
GLY H    H N N 118 
GLY H2   H N N 119 
GLY HA2  H N N 120 
GLY HA3  H N N 121 
GLY HXT  H N N 122 
HIS N    N N N 123 
HIS CA   C N S 124 
HIS C    C N N 125 
HIS O    O N N 126 
HIS CB   C N N 127 
HIS CG   C Y N 128 
HIS ND1  N Y N 129 
HIS CD2  C Y N 130 
HIS CE1  C Y N 131 
HIS NE2  N Y N 132 
HIS OXT  O N N 133 
HIS H    H N N 134 
HIS H2   H N N 135 
HIS HA   H N N 136 
HIS HB2  H N N 137 
HIS HB3  H N N 138 
HIS HD1  H N N 139 
HIS HD2  H N N 140 
HIS HE1  H N N 141 
HIS HE2  H N N 142 
HIS HXT  H N N 143 
ILE N    N N N 144 
ILE CA   C N S 145 
ILE C    C N N 146 
ILE O    O N N 147 
ILE CB   C N S 148 
ILE CG1  C N N 149 
ILE CG2  C N N 150 
ILE CD1  C N N 151 
ILE OXT  O N N 152 
ILE H    H N N 153 
ILE H2   H N N 154 
ILE HA   H N N 155 
ILE HB   H N N 156 
ILE HG12 H N N 157 
ILE HG13 H N N 158 
ILE HG21 H N N 159 
ILE HG22 H N N 160 
ILE HG23 H N N 161 
ILE HD11 H N N 162 
ILE HD12 H N N 163 
ILE HD13 H N N 164 
ILE HXT  H N N 165 
LEU N    N N N 166 
LEU CA   C N S 167 
LEU C    C N N 168 
LEU O    O N N 169 
LEU CB   C N N 170 
LEU CG   C N N 171 
LEU CD1  C N N 172 
LEU CD2  C N N 173 
LEU OXT  O N N 174 
LEU H    H N N 175 
LEU H2   H N N 176 
LEU HA   H N N 177 
LEU HB2  H N N 178 
LEU HB3  H N N 179 
LEU HG   H N N 180 
LEU HD11 H N N 181 
LEU HD12 H N N 182 
LEU HD13 H N N 183 
LEU HD21 H N N 184 
LEU HD22 H N N 185 
LEU HD23 H N N 186 
LEU HXT  H N N 187 
LYS N    N N N 188 
LYS CA   C N S 189 
LYS C    C N N 190 
LYS O    O N N 191 
LYS CB   C N N 192 
LYS CG   C N N 193 
LYS CD   C N N 194 
LYS CE   C N N 195 
LYS NZ   N N N 196 
LYS OXT  O N N 197 
LYS H    H N N 198 
LYS H2   H N N 199 
LYS HA   H N N 200 
LYS HB2  H N N 201 
LYS HB3  H N N 202 
LYS HG2  H N N 203 
LYS HG3  H N N 204 
LYS HD2  H N N 205 
LYS HD3  H N N 206 
LYS HE2  H N N 207 
LYS HE3  H N N 208 
LYS HZ1  H N N 209 
LYS HZ2  H N N 210 
LYS HZ3  H N N 211 
LYS HXT  H N N 212 
MET N    N N N 213 
MET CA   C N S 214 
MET C    C N N 215 
MET O    O N N 216 
MET CB   C N N 217 
MET CG   C N N 218 
MET SD   S N N 219 
MET CE   C N N 220 
MET OXT  O N N 221 
MET H    H N N 222 
MET H2   H N N 223 
MET HA   H N N 224 
MET HB2  H N N 225 
MET HB3  H N N 226 
MET HG2  H N N 227 
MET HG3  H N N 228 
MET HE1  H N N 229 
MET HE2  H N N 230 
MET HE3  H N N 231 
MET HXT  H N N 232 
PHE N    N N N 233 
PHE CA   C N S 234 
PHE C    C N N 235 
PHE O    O N N 236 
PHE CB   C N N 237 
PHE CG   C Y N 238 
PHE CD1  C Y N 239 
PHE CD2  C Y N 240 
PHE CE1  C Y N 241 
PHE CE2  C Y N 242 
PHE CZ   C Y N 243 
PHE OXT  O N N 244 
PHE H    H N N 245 
PHE H2   H N N 246 
PHE HA   H N N 247 
PHE HB2  H N N 248 
PHE HB3  H N N 249 
PHE HD1  H N N 250 
PHE HD2  H N N 251 
PHE HE1  H N N 252 
PHE HE2  H N N 253 
PHE HZ   H N N 254 
PHE HXT  H N N 255 
PRO N    N N N 256 
PRO CA   C N S 257 
PRO C    C N N 258 
PRO O    O N N 259 
PRO CB   C N N 260 
PRO CG   C N N 261 
PRO CD   C N N 262 
PRO OXT  O N N 263 
PRO H    H N N 264 
PRO HA   H N N 265 
PRO HB2  H N N 266 
PRO HB3  H N N 267 
PRO HG2  H N N 268 
PRO HG3  H N N 269 
PRO HD2  H N N 270 
PRO HD3  H N N 271 
PRO HXT  H N N 272 
SER N    N N N 273 
SER CA   C N S 274 
SER C    C N N 275 
SER O    O N N 276 
SER CB   C N N 277 
SER OG   O N N 278 
SER OXT  O N N 279 
SER H    H N N 280 
SER H2   H N N 281 
SER HA   H N N 282 
SER HB2  H N N 283 
SER HB3  H N N 284 
SER HG   H N N 285 
SER HXT  H N N 286 
THR N    N N N 287 
THR CA   C N S 288 
THR C    C N N 289 
THR O    O N N 290 
THR CB   C N R 291 
THR OG1  O N N 292 
THR CG2  C N N 293 
THR OXT  O N N 294 
THR H    H N N 295 
THR H2   H N N 296 
THR HA   H N N 297 
THR HB   H N N 298 
THR HG1  H N N 299 
THR HG21 H N N 300 
THR HG22 H N N 301 
THR HG23 H N N 302 
THR HXT  H N N 303 
TYR N    N N N 304 
TYR CA   C N S 305 
TYR C    C N N 306 
TYR O    O N N 307 
TYR CB   C N N 308 
TYR CG   C Y N 309 
TYR CD1  C Y N 310 
TYR CD2  C Y N 311 
TYR CE1  C Y N 312 
TYR CE2  C Y N 313 
TYR CZ   C Y N 314 
TYR OH   O N N 315 
TYR OXT  O N N 316 
TYR H    H N N 317 
TYR H2   H N N 318 
TYR HA   H N N 319 
TYR HB2  H N N 320 
TYR HB3  H N N 321 
TYR HD1  H N N 322 
TYR HD2  H N N 323 
TYR HE1  H N N 324 
TYR HE2  H N N 325 
TYR HH   H N N 326 
TYR HXT  H N N 327 
VAL N    N N N 328 
VAL CA   C N S 329 
VAL C    C N N 330 
VAL O    O N N 331 
VAL CB   C N N 332 
VAL CG1  C N N 333 
VAL CG2  C N N 334 
VAL OXT  O N N 335 
VAL H    H N N 336 
VAL H2   H N N 337 
VAL HA   H N N 338 
VAL HB   H N N 339 
VAL HG11 H N N 340 
VAL HG12 H N N 341 
VAL HG13 H N N 342 
VAL HG21 H N N 343 
VAL HG22 H N N 344 
VAL HG23 H N N 345 
VAL HXT  H N N 346 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
GLN N   CA   sing N N 70  
GLN N   H    sing N N 71  
GLN N   H2   sing N N 72  
GLN CA  C    sing N N 73  
GLN CA  CB   sing N N 74  
GLN CA  HA   sing N N 75  
GLN C   O    doub N N 76  
GLN C   OXT  sing N N 77  
GLN CB  CG   sing N N 78  
GLN CB  HB2  sing N N 79  
GLN CB  HB3  sing N N 80  
GLN CG  CD   sing N N 81  
GLN CG  HG2  sing N N 82  
GLN CG  HG3  sing N N 83  
GLN CD  OE1  doub N N 84  
GLN CD  NE2  sing N N 85  
GLN NE2 HE21 sing N N 86  
GLN NE2 HE22 sing N N 87  
GLN OXT HXT  sing N N 88  
GLU N   CA   sing N N 89  
GLU N   H    sing N N 90  
GLU N   H2   sing N N 91  
GLU CA  C    sing N N 92  
GLU CA  CB   sing N N 93  
GLU CA  HA   sing N N 94  
GLU C   O    doub N N 95  
GLU C   OXT  sing N N 96  
GLU CB  CG   sing N N 97  
GLU CB  HB2  sing N N 98  
GLU CB  HB3  sing N N 99  
GLU CG  CD   sing N N 100 
GLU CG  HG2  sing N N 101 
GLU CG  HG3  sing N N 102 
GLU CD  OE1  doub N N 103 
GLU CD  OE2  sing N N 104 
GLU OE2 HE2  sing N N 105 
GLU OXT HXT  sing N N 106 
GLY N   CA   sing N N 107 
GLY N   H    sing N N 108 
GLY N   H2   sing N N 109 
GLY CA  C    sing N N 110 
GLY CA  HA2  sing N N 111 
GLY CA  HA3  sing N N 112 
GLY C   O    doub N N 113 
GLY C   OXT  sing N N 114 
GLY OXT HXT  sing N N 115 
HIS N   CA   sing N N 116 
HIS N   H    sing N N 117 
HIS N   H2   sing N N 118 
HIS CA  C    sing N N 119 
HIS CA  CB   sing N N 120 
HIS CA  HA   sing N N 121 
HIS C   O    doub N N 122 
HIS C   OXT  sing N N 123 
HIS CB  CG   sing N N 124 
HIS CB  HB2  sing N N 125 
HIS CB  HB3  sing N N 126 
HIS CG  ND1  sing Y N 127 
HIS CG  CD2  doub Y N 128 
HIS ND1 CE1  doub Y N 129 
HIS ND1 HD1  sing N N 130 
HIS CD2 NE2  sing Y N 131 
HIS CD2 HD2  sing N N 132 
HIS CE1 NE2  sing Y N 133 
HIS CE1 HE1  sing N N 134 
HIS NE2 HE2  sing N N 135 
HIS OXT HXT  sing N N 136 
ILE N   CA   sing N N 137 
ILE N   H    sing N N 138 
ILE N   H2   sing N N 139 
ILE CA  C    sing N N 140 
ILE CA  CB   sing N N 141 
ILE CA  HA   sing N N 142 
ILE C   O    doub N N 143 
ILE C   OXT  sing N N 144 
ILE CB  CG1  sing N N 145 
ILE CB  CG2  sing N N 146 
ILE CB  HB   sing N N 147 
ILE CG1 CD1  sing N N 148 
ILE CG1 HG12 sing N N 149 
ILE CG1 HG13 sing N N 150 
ILE CG2 HG21 sing N N 151 
ILE CG2 HG22 sing N N 152 
ILE CG2 HG23 sing N N 153 
ILE CD1 HD11 sing N N 154 
ILE CD1 HD12 sing N N 155 
ILE CD1 HD13 sing N N 156 
ILE OXT HXT  sing N N 157 
LEU N   CA   sing N N 158 
LEU N   H    sing N N 159 
LEU N   H2   sing N N 160 
LEU CA  C    sing N N 161 
LEU CA  CB   sing N N 162 
LEU CA  HA   sing N N 163 
LEU C   O    doub N N 164 
LEU C   OXT  sing N N 165 
LEU CB  CG   sing N N 166 
LEU CB  HB2  sing N N 167 
LEU CB  HB3  sing N N 168 
LEU CG  CD1  sing N N 169 
LEU CG  CD2  sing N N 170 
LEU CG  HG   sing N N 171 
LEU CD1 HD11 sing N N 172 
LEU CD1 HD12 sing N N 173 
LEU CD1 HD13 sing N N 174 
LEU CD2 HD21 sing N N 175 
LEU CD2 HD22 sing N N 176 
LEU CD2 HD23 sing N N 177 
LEU OXT HXT  sing N N 178 
LYS N   CA   sing N N 179 
LYS N   H    sing N N 180 
LYS N   H2   sing N N 181 
LYS CA  C    sing N N 182 
LYS CA  CB   sing N N 183 
LYS CA  HA   sing N N 184 
LYS C   O    doub N N 185 
LYS C   OXT  sing N N 186 
LYS CB  CG   sing N N 187 
LYS CB  HB2  sing N N 188 
LYS CB  HB3  sing N N 189 
LYS CG  CD   sing N N 190 
LYS CG  HG2  sing N N 191 
LYS CG  HG3  sing N N 192 
LYS CD  CE   sing N N 193 
LYS CD  HD2  sing N N 194 
LYS CD  HD3  sing N N 195 
LYS CE  NZ   sing N N 196 
LYS CE  HE2  sing N N 197 
LYS CE  HE3  sing N N 198 
LYS NZ  HZ1  sing N N 199 
LYS NZ  HZ2  sing N N 200 
LYS NZ  HZ3  sing N N 201 
LYS OXT HXT  sing N N 202 
MET N   CA   sing N N 203 
MET N   H    sing N N 204 
MET N   H2   sing N N 205 
MET CA  C    sing N N 206 
MET CA  CB   sing N N 207 
MET CA  HA   sing N N 208 
MET C   O    doub N N 209 
MET C   OXT  sing N N 210 
MET CB  CG   sing N N 211 
MET CB  HB2  sing N N 212 
MET CB  HB3  sing N N 213 
MET CG  SD   sing N N 214 
MET CG  HG2  sing N N 215 
MET CG  HG3  sing N N 216 
MET SD  CE   sing N N 217 
MET CE  HE1  sing N N 218 
MET CE  HE2  sing N N 219 
MET CE  HE3  sing N N 220 
MET OXT HXT  sing N N 221 
PHE N   CA   sing N N 222 
PHE N   H    sing N N 223 
PHE N   H2   sing N N 224 
PHE CA  C    sing N N 225 
PHE CA  CB   sing N N 226 
PHE CA  HA   sing N N 227 
PHE C   O    doub N N 228 
PHE C   OXT  sing N N 229 
PHE CB  CG   sing N N 230 
PHE CB  HB2  sing N N 231 
PHE CB  HB3  sing N N 232 
PHE CG  CD1  doub Y N 233 
PHE CG  CD2  sing Y N 234 
PHE CD1 CE1  sing Y N 235 
PHE CD1 HD1  sing N N 236 
PHE CD2 CE2  doub Y N 237 
PHE CD2 HD2  sing N N 238 
PHE CE1 CZ   doub Y N 239 
PHE CE1 HE1  sing N N 240 
PHE CE2 CZ   sing Y N 241 
PHE CE2 HE2  sing N N 242 
PHE CZ  HZ   sing N N 243 
PHE OXT HXT  sing N N 244 
PRO N   CA   sing N N 245 
PRO N   CD   sing N N 246 
PRO N   H    sing N N 247 
PRO CA  C    sing N N 248 
PRO CA  CB   sing N N 249 
PRO CA  HA   sing N N 250 
PRO C   O    doub N N 251 
PRO C   OXT  sing N N 252 
PRO CB  CG   sing N N 253 
PRO CB  HB2  sing N N 254 
PRO CB  HB3  sing N N 255 
PRO CG  CD   sing N N 256 
PRO CG  HG2  sing N N 257 
PRO CG  HG3  sing N N 258 
PRO CD  HD2  sing N N 259 
PRO CD  HD3  sing N N 260 
PRO OXT HXT  sing N N 261 
SER N   CA   sing N N 262 
SER N   H    sing N N 263 
SER N   H2   sing N N 264 
SER CA  C    sing N N 265 
SER CA  CB   sing N N 266 
SER CA  HA   sing N N 267 
SER C   O    doub N N 268 
SER C   OXT  sing N N 269 
SER CB  OG   sing N N 270 
SER CB  HB2  sing N N 271 
SER CB  HB3  sing N N 272 
SER OG  HG   sing N N 273 
SER OXT HXT  sing N N 274 
THR N   CA   sing N N 275 
THR N   H    sing N N 276 
THR N   H2   sing N N 277 
THR CA  C    sing N N 278 
THR CA  CB   sing N N 279 
THR CA  HA   sing N N 280 
THR C   O    doub N N 281 
THR C   OXT  sing N N 282 
THR CB  OG1  sing N N 283 
THR CB  CG2  sing N N 284 
THR CB  HB   sing N N 285 
THR OG1 HG1  sing N N 286 
THR CG2 HG21 sing N N 287 
THR CG2 HG22 sing N N 288 
THR CG2 HG23 sing N N 289 
THR OXT HXT  sing N N 290 
TYR N   CA   sing N N 291 
TYR N   H    sing N N 292 
TYR N   H2   sing N N 293 
TYR CA  C    sing N N 294 
TYR CA  CB   sing N N 295 
TYR CA  HA   sing N N 296 
TYR C   O    doub N N 297 
TYR C   OXT  sing N N 298 
TYR CB  CG   sing N N 299 
TYR CB  HB2  sing N N 300 
TYR CB  HB3  sing N N 301 
TYR CG  CD1  doub Y N 302 
TYR CG  CD2  sing Y N 303 
TYR CD1 CE1  sing Y N 304 
TYR CD1 HD1  sing N N 305 
TYR CD2 CE2  doub Y N 306 
TYR CD2 HD2  sing N N 307 
TYR CE1 CZ   doub Y N 308 
TYR CE1 HE1  sing N N 309 
TYR CE2 CZ   sing Y N 310 
TYR CE2 HE2  sing N N 311 
TYR CZ  OH   sing N N 312 
TYR OH  HH   sing N N 313 
TYR OXT HXT  sing N N 314 
VAL N   CA   sing N N 315 
VAL N   H    sing N N 316 
VAL N   H2   sing N N 317 
VAL CA  C    sing N N 318 
VAL CA  CB   sing N N 319 
VAL CA  HA   sing N N 320 
VAL C   O    doub N N 321 
VAL C   OXT  sing N N 322 
VAL CB  CG1  sing N N 323 
VAL CB  CG2  sing N N 324 
VAL CB  HB   sing N N 325 
VAL CG1 HG11 sing N N 326 
VAL CG1 HG12 sing N N 327 
VAL CG1 HG13 sing N N 328 
VAL CG2 HG21 sing N N 329 
VAL CG2 HG22 sing N N 330 
VAL CG2 HG23 sing N N 331 
VAL OXT HXT  sing N N 332 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker AVANCE 1 'Bruker Avance' 
900 Bruker AVANCE 2 'Bruker Avance' 
# 
_atom_sites.entry_id                    2N8N 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
Q 
S 
# 
loop_