data_2NAN # _entry.id 2NAN # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_code _database_2.database_id _database_2.pdbx_database_accession _database_2.pdbx_DOI RCSB104630 RCSB ? ? 2NAN PDB pdb_00002nan 10.2210/pdb2nan/pdb 25802 BMRB ? ? D_1000104630 WWPDB ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 25802 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2NAN _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2016-01-06 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pospisilova, E.' 1 'Kukacka, Z.' 2 'Kavan, D.' 3 'Novak, P.' 4 'Chmelik, J.' 5 # _citation.id primary _citation.title 'NMR structure of human DCL-1 (CD302) extracellular domain' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pospisilova, E.' 1 ? primary 'Kukacka, Z.' 2 ? primary 'Kavan, D.' 3 ? primary 'Novak, P.' 4 ? primary 'Chmelik, J.' 5 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'CD302 antigen' _entity.formula_weight 16227.978 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Extracellular domain residues 23-161' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name ;C-type lectin BIMLEC, C-type lectin domain family 13 member A, DEC205-associated C-type lectin 1, Type I transmembrane C-type lectin receptor DCL-1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDAS FKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR ; _entity_poly.pdbx_seq_one_letter_code_can ;MDCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDAS FKWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 CYS n 1 4 PRO n 1 5 SER n 1 6 SER n 1 7 THR n 1 8 TRP n 1 9 ILE n 1 10 GLN n 1 11 PHE n 1 12 GLN n 1 13 ASP n 1 14 SER n 1 15 CYS n 1 16 TYR n 1 17 ILE n 1 18 PHE n 1 19 LEU n 1 20 GLN n 1 21 GLU n 1 22 ALA n 1 23 ILE n 1 24 LYS n 1 25 VAL n 1 26 GLU n 1 27 SER n 1 28 ILE n 1 29 GLU n 1 30 ASP n 1 31 VAL n 1 32 ARG n 1 33 ASN n 1 34 GLN n 1 35 CYS n 1 36 THR n 1 37 ASP n 1 38 HIS n 1 39 GLY n 1 40 ALA n 1 41 ASP n 1 42 MET n 1 43 ILE n 1 44 SER n 1 45 ILE n 1 46 HIS n 1 47 ASN n 1 48 GLU n 1 49 GLU n 1 50 GLU n 1 51 ASN n 1 52 ALA n 1 53 PHE n 1 54 ILE n 1 55 LEU n 1 56 ASP n 1 57 THR n 1 58 LEU n 1 59 LYS n 1 60 LYS n 1 61 GLN n 1 62 TRP n 1 63 LYS n 1 64 GLY n 1 65 PRO n 1 66 ASP n 1 67 ASP n 1 68 ILE n 1 69 LEU n 1 70 LEU n 1 71 GLY n 1 72 MET n 1 73 PHE n 1 74 TYR n 1 75 ASP n 1 76 THR n 1 77 ASP n 1 78 ASP n 1 79 ALA n 1 80 SER n 1 81 PHE n 1 82 LYS n 1 83 TRP n 1 84 PHE n 1 85 ASP n 1 86 ASN n 1 87 SER n 1 88 ASN n 1 89 MET n 1 90 THR n 1 91 PHE n 1 92 ASP n 1 93 LYS n 1 94 TRP n 1 95 THR n 1 96 ASP n 1 97 GLN n 1 98 ASP n 1 99 ASP n 1 100 ASP n 1 101 GLU n 1 102 ASP n 1 103 LEU n 1 104 VAL n 1 105 ASP n 1 106 THR n 1 107 CYS n 1 108 ALA n 1 109 PHE n 1 110 LEU n 1 111 HIS n 1 112 ILE n 1 113 LYS n 1 114 THR n 1 115 GLY n 1 116 GLU n 1 117 TRP n 1 118 LYS n 1 119 LYS n 1 120 GLY n 1 121 ASN n 1 122 CYS n 1 123 GLU n 1 124 VAL n 1 125 SER n 1 126 SER n 1 127 VAL n 1 128 GLU n 1 129 GLY n 1 130 THR n 1 131 LEU n 1 132 CYS n 1 133 LYS n 1 134 THR n 1 135 ALA n 1 136 ILE n 1 137 PRO n 1 138 TYR n 1 139 LYS n 1 140 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'CD302, CLEC13A, DCL1, KIAA0022' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-Gold(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'pET-30a(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CD302_HUMAN _struct_ref.pdbx_db_accession Q8IX05 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DCPSSTWIQFQDSCYIFLQEAIKVESIEDVRNQCTDHGADMISIHNEEENAFILDTLKKQWKGPDDILLGMFYDTDDASF KWFDNSNMTFDKWTDQDDDEDLVDTCAFLHIKTGEWKKGNCEVSSVEGTLCKTAIPYKR ; _struct_ref.pdbx_align_begin 23 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2NAN _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IX05 _struct_ref_seq.db_align_beg 23 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 23 _struct_ref_seq.pdbx_auth_seq_align_end 161 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2NAN _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8IX05 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'initiating methionine' _struct_ref_seq_dif.pdbx_auth_seq_num 22 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D HNCO' 1 3 1 '3D HN(CA)CO' 1 4 1 '3D HNCA' 1 5 1 '3D HN(CO)CA' 1 6 1 '3D HNCACB' 1 7 1 '3D CBCA(CO)NH' 1 8 1 '2D 1H-13C HSQC aliphatic' 1 9 1 '2D 1H-13C HSQC aromatic' 1 10 1 '3D 1H-15N NOESY' 1 11 1 '3D 1H-13C NOESY aliphatic' 1 12 1 '3D 1H-13C NOESY aromatic' 1 13 1 '3D 1H-15N TOCSY' 1 14 1 '3D H(CC)(CO)NH' 1 15 1 '3D (H)CC(CO)NH' 1 16 1 '2D (HB)CB(CGCD)HD' 1 17 1 '3D HCCH-TOCSY' 1 18 1 '3D HCCH-TOCSY aromatic' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.5 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 303.15 _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.contents '0.5 mM [U-100% 13C; U-100% 15N] CD302, 25 mM PIPES, 50 mM sodium chloride, 1 mM sodium azide, 90 % H2O, 10 % D2O, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model 'AVANCE III' _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.type 'Bruker Avance III' # _pdbx_nmr_refine.entry_id 2NAN _pdbx_nmr_refine.method 'simulated annealing, molecular dynamics, torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 500 _pdbx_nmr_ensemble.conformers_submitted_total_number 10 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2NAN _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2NAN _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Bruker Biospin' collection TopSpin ? 1 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing NMRPipe ? 2 Goddard 'chemical shift assignment' Sparky ? 3 Goddard 'structure solution' Sparky ? 4 Goddard refinement Sparky ? 5 'Brunger, Adams, Clore, Gros, Nilges and Read' 'chemical shift assignment' Sparky ? 6 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' Sparky ? 7 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement Sparky ? 8 Goddard 'chemical shift assignment' Sparky ? 9 Goddard 'structure solution' Sparky ? 10 Goddard refinement Sparky ? 11 'Brunger, Adams, Clore, Gros, Nilges and Read' 'chemical shift assignment' Sparky ? 12 'Brunger, Adams, Clore, Gros, Nilges and Read' 'structure solution' Sparky ? 13 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement Sparky ? 14 ;Linge, O'Donoghue and Nilges ; 'chemical shift assignment' ARIA ? 15 ;Linge, O'Donoghue and Nilges ; 'structure solution' ARIA ? 16 ;Linge, O'Donoghue and Nilges ; 'data analysis' ARIA ? 17 'Cornilescu, Delaglio and Bax' 'data analysis' TALOS ? 18 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS ? 19 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2NAN _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2NAN _struct.title 'NMR structure of human DCL-1 (CD302) extracellular domain' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2NAN _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'C-type lectin like receptor, IMMUNE SYSTEM' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 SER A 27 ? ASP A 37 ? SER A 48 ASP A 58 1 ? 11 HELX_P HELX_P2 2 ASN A 47 ? TRP A 62 ? ASN A 68 TRP A 83 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 24 A CYS 36 1_555 ? ? ? ? ? ? ? 2.027 ? ? disulf2 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 132 SG ? ? A CYS 56 A CYS 153 1_555 ? ? ? ? ? ? ? 1.998 ? ? disulf3 disulf ? ? A CYS 107 SG ? ? ? 1_555 A CYS 122 SG ? ? A CYS 128 A CYS 143 1_555 ? ? ? ? ? ? ? 2.019 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 2 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 9 ? PHE A 11 ? ILE A 30 PHE A 32 A 2 SER A 14 ? LEU A 19 ? SER A 35 LEU A 40 A 3 THR A 130 ? ALA A 135 ? THR A 151 ALA A 156 A 4 ASP A 41 ? MET A 42 ? ASP A 62 MET A 63 B 1 ASP A 67 ? LEU A 69 ? ASP A 88 LEU A 90 B 2 PHE A 109 ? HIS A 111 ? PHE A 130 HIS A 132 C 1 MET A 72 ? ASP A 75 ? MET A 93 ASP A 96 C 2 SER A 80 ? TRP A 83 ? SER A 101 TRP A 104 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 9 ? N ILE A 30 O TYR A 16 ? O TYR A 37 A 2 3 N CYS A 15 ? N CYS A 36 O THR A 134 ? O THR A 155 A 3 4 O LYS A 133 ? O LYS A 154 N ASP A 41 ? N ASP A 62 B 1 2 N ILE A 68 ? N ILE A 89 O LEU A 110 ? O LEU A 131 C 1 2 N PHE A 73 ? N PHE A 94 O LYS A 82 ? O LYS A 103 # _atom_sites.entry_id 2NAN _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 22 22 MET MET A . n A 1 2 ASP 2 23 23 ASP ASP A . n A 1 3 CYS 3 24 24 CYS CYS A . n A 1 4 PRO 4 25 25 PRO PRO A . n A 1 5 SER 5 26 26 SER SER A . n A 1 6 SER 6 27 27 SER SER A . n A 1 7 THR 7 28 28 THR THR A . n A 1 8 TRP 8 29 29 TRP TRP A . n A 1 9 ILE 9 30 30 ILE ILE A . n A 1 10 GLN 10 31 31 GLN GLN A . n A 1 11 PHE 11 32 32 PHE PHE A . n A 1 12 GLN 12 33 33 GLN GLN A . n A 1 13 ASP 13 34 34 ASP ASP A . n A 1 14 SER 14 35 35 SER SER A . n A 1 15 CYS 15 36 36 CYS CYS A . n A 1 16 TYR 16 37 37 TYR TYR A . n A 1 17 ILE 17 38 38 ILE ILE A . n A 1 18 PHE 18 39 39 PHE PHE A . n A 1 19 LEU 19 40 40 LEU LEU A . n A 1 20 GLN 20 41 41 GLN GLN A . n A 1 21 GLU 21 42 42 GLU GLU A . n A 1 22 ALA 22 43 43 ALA ALA A . n A 1 23 ILE 23 44 44 ILE ILE A . n A 1 24 LYS 24 45 45 LYS LYS A . n A 1 25 VAL 25 46 46 VAL VAL A . n A 1 26 GLU 26 47 47 GLU GLU A . n A 1 27 SER 27 48 48 SER SER A . n A 1 28 ILE 28 49 49 ILE ILE A . n A 1 29 GLU 29 50 50 GLU GLU A . n A 1 30 ASP 30 51 51 ASP ASP A . n A 1 31 VAL 31 52 52 VAL VAL A . n A 1 32 ARG 32 53 53 ARG ARG A . n A 1 33 ASN 33 54 54 ASN ASN A . n A 1 34 GLN 34 55 55 GLN GLN A . n A 1 35 CYS 35 56 56 CYS CYS A . n A 1 36 THR 36 57 57 THR THR A . n A 1 37 ASP 37 58 58 ASP ASP A . n A 1 38 HIS 38 59 59 HIS HIS A . n A 1 39 GLY 39 60 60 GLY GLY A . n A 1 40 ALA 40 61 61 ALA ALA A . n A 1 41 ASP 41 62 62 ASP ASP A . n A 1 42 MET 42 63 63 MET MET A . n A 1 43 ILE 43 64 64 ILE ILE A . n A 1 44 SER 44 65 65 SER SER A . n A 1 45 ILE 45 66 66 ILE ILE A . n A 1 46 HIS 46 67 67 HIS HIS A . n A 1 47 ASN 47 68 68 ASN ASN A . n A 1 48 GLU 48 69 69 GLU GLU A . n A 1 49 GLU 49 70 70 GLU GLU A . n A 1 50 GLU 50 71 71 GLU GLU A . n A 1 51 ASN 51 72 72 ASN ASN A . n A 1 52 ALA 52 73 73 ALA ALA A . n A 1 53 PHE 53 74 74 PHE PHE A . n A 1 54 ILE 54 75 75 ILE ILE A . n A 1 55 LEU 55 76 76 LEU LEU A . n A 1 56 ASP 56 77 77 ASP ASP A . n A 1 57 THR 57 78 78 THR THR A . n A 1 58 LEU 58 79 79 LEU LEU A . n A 1 59 LYS 59 80 80 LYS LYS A . n A 1 60 LYS 60 81 81 LYS LYS A . n A 1 61 GLN 61 82 82 GLN GLN A . n A 1 62 TRP 62 83 83 TRP TRP A . n A 1 63 LYS 63 84 84 LYS LYS A . n A 1 64 GLY 64 85 85 GLY GLY A . n A 1 65 PRO 65 86 86 PRO PRO A . n A 1 66 ASP 66 87 87 ASP ASP A . n A 1 67 ASP 67 88 88 ASP ASP A . n A 1 68 ILE 68 89 89 ILE ILE A . n A 1 69 LEU 69 90 90 LEU LEU A . n A 1 70 LEU 70 91 91 LEU LEU A . n A 1 71 GLY 71 92 92 GLY GLY A . n A 1 72 MET 72 93 93 MET MET A . n A 1 73 PHE 73 94 94 PHE PHE A . n A 1 74 TYR 74 95 95 TYR TYR A . n A 1 75 ASP 75 96 96 ASP ASP A . n A 1 76 THR 76 97 97 THR THR A . n A 1 77 ASP 77 98 98 ASP ASP A . n A 1 78 ASP 78 99 99 ASP ASP A . n A 1 79 ALA 79 100 100 ALA ALA A . n A 1 80 SER 80 101 101 SER SER A . n A 1 81 PHE 81 102 102 PHE PHE A . n A 1 82 LYS 82 103 103 LYS LYS A . n A 1 83 TRP 83 104 104 TRP TRP A . n A 1 84 PHE 84 105 105 PHE PHE A . n A 1 85 ASP 85 106 106 ASP ASP A . n A 1 86 ASN 86 107 107 ASN ASN A . n A 1 87 SER 87 108 108 SER SER A . n A 1 88 ASN 88 109 109 ASN ASN A . n A 1 89 MET 89 110 110 MET MET A . n A 1 90 THR 90 111 111 THR THR A . n A 1 91 PHE 91 112 112 PHE PHE A . n A 1 92 ASP 92 113 113 ASP ASP A . n A 1 93 LYS 93 114 114 LYS LYS A . n A 1 94 TRP 94 115 115 TRP TRP A . n A 1 95 THR 95 116 116 THR THR A . n A 1 96 ASP 96 117 117 ASP ASP A . n A 1 97 GLN 97 118 118 GLN GLN A . n A 1 98 ASP 98 119 119 ASP ASP A . n A 1 99 ASP 99 120 120 ASP ASP A . n A 1 100 ASP 100 121 121 ASP ASP A . n A 1 101 GLU 101 122 122 GLU GLU A . n A 1 102 ASP 102 123 123 ASP ASP A . n A 1 103 LEU 103 124 124 LEU LEU A . n A 1 104 VAL 104 125 125 VAL VAL A . n A 1 105 ASP 105 126 126 ASP ASP A . n A 1 106 THR 106 127 127 THR THR A . n A 1 107 CYS 107 128 128 CYS CYS A . n A 1 108 ALA 108 129 129 ALA ALA A . n A 1 109 PHE 109 130 130 PHE PHE A . n A 1 110 LEU 110 131 131 LEU LEU A . n A 1 111 HIS 111 132 132 HIS HIS A . n A 1 112 ILE 112 133 133 ILE ILE A . n A 1 113 LYS 113 134 134 LYS LYS A . n A 1 114 THR 114 135 135 THR THR A . n A 1 115 GLY 115 136 136 GLY GLY A . n A 1 116 GLU 116 137 137 GLU GLU A . n A 1 117 TRP 117 138 138 TRP TRP A . n A 1 118 LYS 118 139 139 LYS LYS A . n A 1 119 LYS 119 140 140 LYS LYS A . n A 1 120 GLY 120 141 141 GLY GLY A . n A 1 121 ASN 121 142 142 ASN ASN A . n A 1 122 CYS 122 143 143 CYS CYS A . n A 1 123 GLU 123 144 144 GLU GLU A . n A 1 124 VAL 124 145 145 VAL VAL A . n A 1 125 SER 125 146 146 SER SER A . n A 1 126 SER 126 147 147 SER SER A . n A 1 127 VAL 127 148 148 VAL VAL A . n A 1 128 GLU 128 149 149 GLU GLU A . n A 1 129 GLY 129 150 150 GLY GLY A . n A 1 130 THR 130 151 151 THR THR A . n A 1 131 LEU 131 152 152 LEU LEU A . n A 1 132 CYS 132 153 153 CYS CYS A . n A 1 133 LYS 133 154 154 LYS LYS A . n A 1 134 THR 134 155 155 THR THR A . n A 1 135 ALA 135 156 156 ALA ALA A . n A 1 136 ILE 136 157 157 ILE ILE A . n A 1 137 PRO 137 158 158 PRO PRO A . n A 1 138 TYR 138 159 159 TYR TYR A . n A 1 139 LYS 139 160 160 LYS LYS A . n A 1 140 ARG 140 161 161 ARG ARG A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2017-01-11 2 'Structure model' 1 1 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id CD302-1 0.5 ? mM '[U-100% 13C; U-100% 15N]' 1 PIPES-2 25 ? mM ? 1 'sodium chloride-3' 50 ? mM ? 1 'sodium azide-4' 1 ? mM ? 1 H2O-5 90 ? % ? 1 D2O-6 10 ? % ? 1 # _pdbx_nmr_constraints.disulfide_bond_constraints_total_count ? _pdbx_nmr_constraints.entry_id 2NAN _pdbx_nmr_constraints.hydrogen_bond_constraints_total_count ? _pdbx_nmr_constraints.NA_alpha-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_beta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_chi-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_delta-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_epsilon-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_gamma-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_other-angle_constraints_total_count ? _pdbx_nmr_constraints.NA_sugar_pucker_constraints_total_count ? _pdbx_nmr_constraints.NOE_constraints_total 4588 _pdbx_nmr_constraints.NOE_interentity_total_count ? _pdbx_nmr_constraints.NOE_interproton_distance_evaluation ? _pdbx_nmr_constraints.NOE_intraresidue_total_count 1504 _pdbx_nmr_constraints.NOE_long_range_total_count 1555 _pdbx_nmr_constraints.NOE_medium_range_total_count 624 _pdbx_nmr_constraints.NOE_motional_averaging_correction ? _pdbx_nmr_constraints.NOE_pseudoatom_corrections ? _pdbx_nmr_constraints.NOE_sequential_total_count 905 _pdbx_nmr_constraints.protein_chi_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_other_angle_constraints_total_count 0 _pdbx_nmr_constraints.protein_phi_angle_constraints_total_count 114 _pdbx_nmr_constraints.protein_psi_angle_constraints_total_count 114 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 7 HZ1 A LYS 45 ? ? OE2 A GLU 47 ? ? 1.58 2 9 OD2 A ASP 88 ? ? HZ3 A LYS 139 ? ? 1.59 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 3 CG A GLU 71 ? ? CD A GLU 71 ? ? 1.416 1.515 -0.099 0.015 N 2 7 CG A GLU 71 ? ? CD A GLU 71 ? ? 1.414 1.515 -0.101 0.015 N 3 8 CG A GLU 71 ? ? CD A GLU 71 ? ? 1.417 1.515 -0.098 0.015 N 4 9 CG A GLU 71 ? ? CD A GLU 71 ? ? 1.421 1.515 -0.094 0.015 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 33 ? ? 62.83 -67.89 2 1 ASP A 34 ? ? -156.37 20.91 3 1 GLN A 41 ? ? -67.57 94.61 4 1 ILE A 64 ? ? -40.33 151.26 5 1 TRP A 83 ? ? -108.25 -161.75 6 1 LYS A 84 ? ? -70.41 -77.05 7 1 LYS A 114 ? ? -119.15 68.36 8 1 ASP A 121 ? ? -95.94 -150.77 9 1 CYS A 128 ? ? -129.09 -169.85 10 1 SER A 147 ? ? -75.67 22.59 11 2 GLN A 33 ? ? 60.48 -85.96 12 2 GLN A 41 ? ? -68.23 94.84 13 2 ILE A 64 ? ? -36.96 146.37 14 2 TRP A 83 ? ? -109.66 -159.91 15 2 LYS A 84 ? ? -68.56 -72.26 16 2 ASN A 107 ? ? 83.65 -11.07 17 2 ASP A 120 ? ? 70.66 178.21 18 2 ASP A 121 ? ? -150.12 -38.36 19 2 GLU A 122 ? ? -91.41 -74.53 20 2 CYS A 128 ? ? -129.30 -167.03 21 2 SER A 147 ? ? -76.20 22.43 22 3 GLN A 33 ? ? 59.99 -81.74 23 3 ASP A 34 ? ? -145.55 24.32 24 3 GLN A 41 ? ? -69.47 94.80 25 3 ILE A 64 ? ? -36.85 144.31 26 3 TRP A 83 ? ? -105.88 -161.67 27 3 LYS A 84 ? ? -74.64 -72.03 28 3 ASP A 120 ? ? -175.41 90.54 29 3 ASP A 121 ? ? -121.98 -68.32 30 3 GLU A 122 ? ? -98.94 -99.44 31 3 CYS A 128 ? ? -124.48 -168.25 32 3 GLU A 144 ? ? -92.36 35.54 33 3 SER A 147 ? ? -75.73 21.96 34 4 GLN A 33 ? ? 62.61 -76.98 35 4 ASP A 34 ? ? -154.37 26.26 36 4 GLN A 41 ? ? -69.49 94.83 37 4 ILE A 64 ? ? -40.93 150.54 38 4 TRP A 83 ? ? -106.17 -166.90 39 4 LYS A 84 ? ? -66.20 -72.53 40 4 ALA A 100 ? ? 67.01 61.79 41 4 ASP A 120 ? ? 86.17 175.58 42 4 ASP A 121 ? ? -126.33 -83.44 43 4 SER A 147 ? ? -74.89 22.78 44 5 GLN A 33 ? ? 60.51 -86.80 45 5 ASP A 34 ? ? -145.99 26.51 46 5 GLN A 41 ? ? -67.07 94.94 47 5 ILE A 64 ? ? -40.99 151.16 48 5 TRP A 83 ? ? -105.96 -158.58 49 5 LYS A 84 ? ? -72.56 -74.53 50 5 ALA A 100 ? ? 60.45 67.85 51 5 ASP A 120 ? ? 67.79 95.07 52 5 GLU A 122 ? ? -74.39 -71.51 53 5 SER A 147 ? ? -75.15 22.85 54 6 GLN A 33 ? ? 66.30 -74.67 55 6 ASP A 34 ? ? -154.76 23.85 56 6 GLN A 41 ? ? -69.96 94.70 57 6 TRP A 83 ? ? -109.07 -161.63 58 6 ALA A 100 ? ? 66.02 68.18 59 6 ASP A 120 ? ? 72.93 116.44 60 6 GLU A 122 ? ? -77.94 -85.54 61 6 CYS A 128 ? ? -127.87 -167.52 62 6 SER A 147 ? ? -78.06 21.89 63 7 GLN A 33 ? ? 63.02 -80.29 64 7 ASP A 34 ? ? -149.37 33.65 65 7 GLN A 41 ? ? -67.36 94.52 66 7 TRP A 83 ? ? -104.53 -162.04 67 7 ASP A 120 ? ? 69.54 76.66 68 7 GLU A 122 ? ? -68.89 -71.74 69 7 CYS A 128 ? ? -128.04 -169.49 70 7 SER A 147 ? ? -77.67 22.08 71 8 GLN A 41 ? ? -68.38 94.87 72 8 ILE A 64 ? ? -39.08 151.75 73 8 TRP A 83 ? ? -105.79 -163.76 74 8 LYS A 84 ? ? -68.44 -70.45 75 8 ASN A 107 ? ? 75.51 -12.38 76 8 ASP A 120 ? ? 72.09 144.77 77 8 GLU A 122 ? ? -104.05 -83.09 78 8 CYS A 128 ? ? -127.22 -166.79 79 8 SER A 147 ? ? -76.29 22.57 80 9 GLN A 33 ? ? 63.52 -81.78 81 9 ASP A 34 ? ? -146.39 25.59 82 9 GLN A 41 ? ? -67.77 94.69 83 9 ILE A 64 ? ? -35.13 135.49 84 9 TRP A 83 ? ? -107.17 -161.30 85 9 LYS A 84 ? ? -70.34 -71.71 86 9 ASP A 120 ? ? 67.83 -173.93 87 9 ASP A 121 ? ? -140.94 -74.61 88 9 LEU A 124 ? ? -102.79 40.48 89 9 CYS A 128 ? ? -126.71 -166.85 90 9 SER A 147 ? ? -76.39 21.88 91 9 LYS A 160 ? ? -142.20 38.62 92 10 ASP A 23 ? ? -134.78 -53.35 93 10 GLN A 33 ? ? 63.06 -75.08 94 10 ASP A 34 ? ? -154.42 16.75 95 10 GLN A 41 ? ? -67.84 94.14 96 10 TRP A 83 ? ? -104.85 -159.63 97 10 ALA A 100 ? ? 61.63 61.67 98 10 ASP A 120 ? ? -179.87 136.44 99 10 ASP A 121 ? ? -112.44 -85.64 100 10 SER A 147 ? ? -78.11 22.55 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 2 ARG A 53 ? ? 0.095 'SIDE CHAIN' 2 4 ARG A 53 ? ? 0.076 'SIDE CHAIN' #