data_2NDI
# 
_entry.id   2NDI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.398 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_code 
_database_2.database_id 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
RCSB104728   RCSB  ?            ?                   
2NDI         PDB   pdb_00002ndi 10.2210/pdb2ndi/pdb 
26062        BMRB  ?            10.13018/BMR26062   
D_1000104728 WWPDB ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-06-07 
2 'Structure model' 1 1 2023-06-14 
3 'Structure model' 1 2 2024-10-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 2 'Structure model' Other                 
4 3 'Structure model' 'Data collection'     
5 3 'Structure model' 'Database references' 
6 3 'Structure model' 'Structure summary'   
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' database_2                
2  2 'Structure model' pdbx_database_status      
3  2 'Structure model' pdbx_nmr_software         
4  2 'Structure model' pdbx_nmr_spectrometer     
5  2 'Structure model' struct_ref_seq_dif        
6  3 'Structure model' chem_comp_atom            
7  3 'Structure model' chem_comp_bond            
8  3 'Structure model' database_2                
9  3 'Structure model' pdbx_entry_details        
10 3 'Structure model' pdbx_modification_feature 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_database_2.pdbx_DOI'                       
2 2 'Structure model' '_database_2.pdbx_database_accession'        
3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 
4 2 'Structure model' '_pdbx_nmr_software.name'                    
5 2 'Structure model' '_pdbx_nmr_spectrometer.model'               
6 2 'Structure model' '_struct_ref_seq_dif.details'                
7 3 'Structure model' '_database_2.pdbx_DOI'                       
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2NDI 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-01 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.db_id          26062 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_audit_author.name           'Hu, K.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.id                        primary 
_citation.title                     
'A sodium channel inhibitor ISTX-I with a novel structure provides a new hint at the evolutionary link between two toxin folds.' 
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_volume            6 
_citation.page_first                29691 
_citation.page_last                 29691 
_citation.year                      2016 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   27407029 
_citation.pdbx_database_id_DOI      10.1038/srep29691 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rong, M.'  1 ? 
primary 'Liu, J.'   2 ? 
primary 'Zhang, M.' 3 ? 
primary 'Wang, G.'  4 ? 
primary 'Zhao, G.'  5 ? 
primary 'Wang, G.'  6 ? 
primary 'Zhang, Y.' 7 ? 
primary 'Hu, K.'    8 ? 
primary 'Lai, R.'   9 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Putative secreted salivary protein' 
_entity.formula_weight             4793.280 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP RESIDUES 42-86' 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GLCSENGDCAADECCVDTVFEGDMVTRSCEKTTGNFTECPGLTPIA 
_entity_poly.pdbx_seq_one_letter_code_can   GLCSENGDCAADECCVDTVFEGDMVTRSCEKTTGNFTECPGLTPIA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  LEU n 
1 3  CYS n 
1 4  SER n 
1 5  GLU n 
1 6  ASN n 
1 7  GLY n 
1 8  ASP n 
1 9  CYS n 
1 10 ALA n 
1 11 ALA n 
1 12 ASP n 
1 13 GLU n 
1 14 CYS n 
1 15 CYS n 
1 16 VAL n 
1 17 ASP n 
1 18 THR n 
1 19 VAL n 
1 20 PHE n 
1 21 GLU n 
1 22 GLY n 
1 23 ASP n 
1 24 MET n 
1 25 VAL n 
1 26 THR n 
1 27 ARG n 
1 28 SER n 
1 29 CYS n 
1 30 GLU n 
1 31 LYS n 
1 32 THR n 
1 33 THR n 
1 34 GLY n 
1 35 ASN n 
1 36 PHE n 
1 37 THR n 
1 38 GLU n 
1 39 CYS n 
1 40 PRO n 
1 41 GLY n 
1 42 LEU n 
1 43 THR n 
1 44 PRO n 
1 45 ILE n 
1 46 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'blacklegged tick,deer tick,shoulder tick' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Ixodes scapularis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     6945 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               'pET-32a (+)' 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  1  1  GLY GLY A . n 
A 1 2  LEU 2  2  2  LEU LEU A . n 
A 1 3  CYS 3  3  3  CYS CYS A . n 
A 1 4  SER 4  4  4  SER SER A . n 
A 1 5  GLU 5  5  5  GLU GLU A . n 
A 1 6  ASN 6  6  6  ASN ASN A . n 
A 1 7  GLY 7  7  7  GLY GLY A . n 
A 1 8  ASP 8  8  8  ASP ASP A . n 
A 1 9  CYS 9  9  9  CYS CYS A . n 
A 1 10 ALA 10 10 10 ALA ALA A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 ASP 12 12 12 ASP ASP A . n 
A 1 13 GLU 13 13 13 GLU GLU A . n 
A 1 14 CYS 14 14 14 CYS CYS A . n 
A 1 15 CYS 15 15 15 CYS CYS A . n 
A 1 16 VAL 16 16 16 VAL VAL A . n 
A 1 17 ASP 17 17 17 ASP ASP A . n 
A 1 18 THR 18 18 18 THR THR A . n 
A 1 19 VAL 19 19 19 VAL VAL A . n 
A 1 20 PHE 20 20 20 PHE PHE A . n 
A 1 21 GLU 21 21 21 GLU GLU A . n 
A 1 22 GLY 22 22 22 GLY GLY A . n 
A 1 23 ASP 23 23 23 ASP ASP A . n 
A 1 24 MET 24 24 24 MET MET A . n 
A 1 25 VAL 25 25 25 VAL VAL A . n 
A 1 26 THR 26 26 26 THR THR A . n 
A 1 27 ARG 27 27 27 ARG ARG A . n 
A 1 28 SER 28 28 28 SER SER A . n 
A 1 29 CYS 29 29 29 CYS CYS A . n 
A 1 30 GLU 30 30 30 GLU GLU A . n 
A 1 31 LYS 31 31 31 LYS LYS A . n 
A 1 32 THR 32 32 32 THR THR A . n 
A 1 33 THR 33 33 33 THR THR A . n 
A 1 34 GLY 34 34 34 GLY GLY A . n 
A 1 35 ASN 35 35 35 ASN ASN A . n 
A 1 36 PHE 36 36 36 PHE PHE A . n 
A 1 37 THR 37 37 37 THR THR A . n 
A 1 38 GLU 38 38 38 GLU GLU A . n 
A 1 39 CYS 39 39 39 CYS CYS A . n 
A 1 40 PRO 40 40 40 PRO PRO A . n 
A 1 41 GLY 41 41 41 GLY GLY A . n 
A 1 42 LEU 42 42 42 LEU LEU A . n 
A 1 43 THR 43 43 43 THR THR A . n 
A 1 44 PRO 44 44 44 PRO PRO A . n 
A 1 45 ILE 45 45 45 ILE ILE A . n 
A 1 46 ALA 46 46 46 ALA ALA A . n 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2NDI 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2NDI 
_struct.title                     'Solution structure of the toxin ISTX-I from Ixodes scapularis' 
_struct.pdbx_model_details        'minimized average structure, model1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        2NDI 
_struct_keywords.pdbx_keywords   TOXIN 
_struct_keywords.text            'toxin peptide, TOXIN' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q4PN35_IXOSC 
_struct_ref.pdbx_db_accession          Q4PN35 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   LCSENGDCAADECCVDTVFEGDMVTRSCEKTTGNFTECPGLTPIA 
_struct_ref.pdbx_align_begin           42 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2NDI 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 46 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q4PN35 
_struct_ref_seq.db_align_beg                  42 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  86 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       46 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             2NDI 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q4PN35 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'expression tag' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 3  SG ? ? ? 1_555 A CYS 15 SG ? ? A CYS 3  A CYS 15 1_555 ? ? ? ? ? ? ? 2.019 ? ? 
disulf2 disulf ? ? A CYS 9  SG ? ? ? 1_555 A CYS 29 SG ? ? A CYS 9  A CYS 29 1_555 ? ? ? ? ? ? ? 2.011 ? ? 
disulf3 disulf ? ? A CYS 14 SG ? ? ? 1_555 A CYS 39 SG ? ? A CYS 14 A CYS 39 1_555 ? ? ? ? ? ? ? 2.022 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_modification_feature.ordinal 
_pdbx_modification_feature.label_comp_id 
_pdbx_modification_feature.label_asym_id 
_pdbx_modification_feature.label_seq_id 
_pdbx_modification_feature.label_alt_id 
_pdbx_modification_feature.modified_residue_label_comp_id 
_pdbx_modification_feature.modified_residue_label_asym_id 
_pdbx_modification_feature.modified_residue_label_seq_id 
_pdbx_modification_feature.modified_residue_label_alt_id 
_pdbx_modification_feature.auth_comp_id 
_pdbx_modification_feature.auth_asym_id 
_pdbx_modification_feature.auth_seq_id 
_pdbx_modification_feature.PDB_ins_code 
_pdbx_modification_feature.symmetry 
_pdbx_modification_feature.modified_residue_auth_comp_id 
_pdbx_modification_feature.modified_residue_auth_asym_id 
_pdbx_modification_feature.modified_residue_auth_seq_id 
_pdbx_modification_feature.modified_residue_PDB_ins_code 
_pdbx_modification_feature.modified_residue_symmetry 
_pdbx_modification_feature.comp_id_linking_atom 
_pdbx_modification_feature.modified_residue_id_linking_atom 
_pdbx_modification_feature.modified_residue_id 
_pdbx_modification_feature.ref_pcm_id 
_pdbx_modification_feature.ref_comp_id 
_pdbx_modification_feature.type 
_pdbx_modification_feature.category 
1 CYS A 3  ? CYS A 15 ? CYS A 3  ? 1_555 CYS A 15 ? 1_555 SG SG . . . None 'Disulfide bridge' 
2 CYS A 9  ? CYS A 29 ? CYS A 9  ? 1_555 CYS A 29 ? 1_555 SG SG . . . None 'Disulfide bridge' 
3 CYS A 14 ? CYS A 39 ? CYS A 14 ? 1_555 CYS A 39 ? 1_555 SG SG . . . None 'Disulfide bridge' 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 CYS A 14 ? THR A 18 ? CYS A 14 THR A 18 
A 2 THR A 26 ? GLU A 30 ? THR A 26 GLU A 30 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   THR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    18 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    THR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     18 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   THR 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    26 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    THR 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     26 
# 
_pdbx_entry_details.entry_id                   2NDI 
_pdbx_entry_details.compound_details           ? 
_pdbx_entry_details.source_details             ? 
_pdbx_entry_details.nonpolymer_details         ? 
_pdbx_entry_details.sequence_details           ? 
_pdbx_entry_details.has_ligand_of_interest     ? 
_pdbx_entry_details.has_protein_modification   Y 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    17 
_pdbx_validate_close_contact.auth_atom_id_1   H2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLY 
_pdbx_validate_close_contact.auth_seq_id_1    1 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   H 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   LEU 
_pdbx_validate_close_contact.auth_seq_id_2    2 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.29 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  VAL A 19 ? ? 179.53  117.64  
2  1  CYS A 29 ? ? -175.14 137.55  
3  2  VAL A 19 ? ? 179.27  118.34  
4  2  PHE A 20 ? ? -98.13  -64.06  
5  2  CYS A 29 ? ? -172.09 116.26  
6  2  THR A 33 ? ? -151.03 89.44   
7  2  THR A 37 ? ? -129.50 -145.93 
8  3  VAL A 19 ? ? 177.04  119.57  
9  3  PHE A 20 ? ? -98.16  -65.94  
10 3  CYS A 29 ? ? -171.92 101.56  
11 3  THR A 33 ? ? -154.16 84.27   
12 3  CYS A 39 ? ? -43.55  160.23  
13 4  VAL A 19 ? ? -178.33 116.64  
14 4  CYS A 29 ? ? -173.65 116.99  
15 4  THR A 33 ? ? -153.01 82.68   
16 5  VAL A 19 ? ? 177.00  119.25  
17 5  PHE A 20 ? ? -93.61  -94.19  
18 5  CYS A 29 ? ? -172.86 116.22  
19 5  THR A 33 ? ? -151.31 88.85   
20 5  THR A 37 ? ? -133.36 -144.84 
21 6  ASP A 8  ? ? -48.29  -76.55  
22 6  VAL A 19 ? ? -179.05 117.02  
23 6  PHE A 20 ? ? -100.89 -63.85  
24 6  CYS A 29 ? ? -175.01 117.62  
25 6  THR A 33 ? ? -152.96 89.70   
26 7  VAL A 19 ? ? 178.07  117.02  
27 7  THR A 33 ? ? -78.40  45.20   
28 7  THR A 37 ? ? -133.98 -150.28 
29 8  VAL A 19 ? ? 176.18  118.39  
30 8  PHE A 20 ? ? -98.03  -63.18  
31 8  CYS A 29 ? ? -176.24 128.35  
32 8  ILE A 45 ? ? -43.48  153.79  
33 9  VAL A 19 ? ? 178.09  119.25  
34 9  PHE A 20 ? ? -94.42  -95.01  
35 9  CYS A 29 ? ? -175.42 130.86  
36 10 SER A 4  ? ? 76.20   -33.13  
37 10 VAL A 19 ? ? 176.38  119.56  
38 10 PHE A 20 ? ? -95.24  -94.39  
39 10 CYS A 29 ? ? -170.60 134.85  
40 11 SER A 4  ? ? 74.18   -36.42  
41 11 VAL A 19 ? ? 178.67  118.92  
42 11 PHE A 20 ? ? -98.40  -92.07  
43 11 THR A 33 ? ? -150.19 84.90   
44 12 SER A 4  ? ? 75.53   -34.68  
45 12 VAL A 19 ? ? 179.32  116.91  
46 12 PHE A 20 ? ? -73.77  -92.63  
47 12 GLU A 21 ? ? -90.22  -65.26  
48 12 CYS A 29 ? ? -170.58 129.91  
49 12 THR A 33 ? ? -151.43 85.08   
50 13 VAL A 19 ? ? 178.38  117.28  
51 13 PHE A 20 ? ? -103.97 -62.36  
52 13 THR A 33 ? ? -154.77 88.28   
53 13 THR A 37 ? ? -126.86 -145.71 
54 13 ILE A 45 ? ? -37.99  144.88  
55 14 VAL A 19 ? ? 178.41  118.17  
56 14 PHE A 20 ? ? -90.03  -62.57  
57 14 CYS A 29 ? ? -173.41 115.25  
58 14 THR A 33 ? ? -152.21 82.49   
59 15 VAL A 19 ? ? -178.77 116.92  
60 15 CYS A 29 ? ? -169.36 114.89  
61 15 CYS A 39 ? ? -41.08  164.40  
62 16 VAL A 16 ? ? -165.87 117.98  
63 16 VAL A 19 ? ? 177.72  119.52  
64 16 PHE A 20 ? ? -94.19  -94.10  
65 16 THR A 33 ? ? -154.05 89.43   
66 16 THR A 37 ? ? -125.85 -144.96 
67 17 SER A 4  ? ? 75.17   -32.66  
68 17 VAL A 19 ? ? 179.54  117.01  
69 17 PHE A 20 ? ? -104.12 -62.80  
70 17 THR A 33 ? ? -152.29 88.81   
71 17 THR A 37 ? ? -124.85 -145.20 
72 18 GLU A 5  ? ? -153.10 47.46   
73 18 ASN A 6  ? ? 60.18   -5.96   
74 18 VAL A 19 ? ? 177.08  119.10  
75 18 PHE A 20 ? ? -94.32  -95.09  
76 18 CYS A 29 ? ? -172.57 115.16  
77 18 THR A 33 ? ? -152.84 89.47   
78 18 THR A 37 ? ? -127.70 -146.79 
79 19 VAL A 19 ? ? -179.57 117.25  
80 19 PHE A 20 ? ? -95.93  -62.18  
81 19 CYS A 29 ? ? -172.90 115.78  
82 19 THR A 33 ? ? -153.34 89.49   
83 19 THR A 37 ? ? -134.52 -157.66 
84 20 VAL A 19 ? ? 179.34  117.11  
85 20 PHE A 20 ? ? -100.57 -71.19  
86 20 THR A 33 ? ? -152.91 89.03   
87 20 THR A 37 ? ? -132.77 -156.21 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2NDI 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2NDI 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
_pdbx_nmr_sample_details.contents         '1mM ISTX-I-1, 8mM ISTX-I-2, 10mM MES-3, 20mM sodium chloride-4, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
ISTX-I-1            1  ? mM ? 1 
ISTX-I-2            8  ? mM ? 1 
MES-3               10 ? mM ? 1 
'sodium chloride-4' 20 ? mM ? 1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id    1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength   0.02 
_pdbx_nmr_exptl_sample_conditions.pH               5.7 
_pdbx_nmr_exptl_sample_conditions.pressure         ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units   ? 
_pdbx_nmr_exptl_sample_conditions.temperature      298 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-13C HSQC' 
1 2 1 '2D 1H-1H NOESY' 
1 3 1 '2D TOCSY-HSQC'  
# 
_pdbx_nmr_refine.entry_id           2NDI 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Schwieters, Kuszewski, Tjandra and Clore' refinement           'X-PLOR NIH' 1 ? 
'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2 ? 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N N N 1   
ALA CA   C N S 2   
ALA C    C N N 3   
ALA O    O N N 4   
ALA CB   C N N 5   
ALA OXT  O N N 6   
ALA H    H N N 7   
ALA H2   H N N 8   
ALA HA   H N N 9   
ALA HB1  H N N 10  
ALA HB2  H N N 11  
ALA HB3  H N N 12  
ALA HXT  H N N 13  
ARG N    N N N 14  
ARG CA   C N S 15  
ARG C    C N N 16  
ARG O    O N N 17  
ARG CB   C N N 18  
ARG CG   C N N 19  
ARG CD   C N N 20  
ARG NE   N N N 21  
ARG CZ   C N N 22  
ARG NH1  N N N 23  
ARG NH2  N N N 24  
ARG OXT  O N N 25  
ARG H    H N N 26  
ARG H2   H N N 27  
ARG HA   H N N 28  
ARG HB2  H N N 29  
ARG HB3  H N N 30  
ARG HG2  H N N 31  
ARG HG3  H N N 32  
ARG HD2  H N N 33  
ARG HD3  H N N 34  
ARG HE   H N N 35  
ARG HH11 H N N 36  
ARG HH12 H N N 37  
ARG HH21 H N N 38  
ARG HH22 H N N 39  
ARG HXT  H N N 40  
ASN N    N N N 41  
ASN CA   C N S 42  
ASN C    C N N 43  
ASN O    O N N 44  
ASN CB   C N N 45  
ASN CG   C N N 46  
ASN OD1  O N N 47  
ASN ND2  N N N 48  
ASN OXT  O N N 49  
ASN H    H N N 50  
ASN H2   H N N 51  
ASN HA   H N N 52  
ASN HB2  H N N 53  
ASN HB3  H N N 54  
ASN HD21 H N N 55  
ASN HD22 H N N 56  
ASN HXT  H N N 57  
ASP N    N N N 58  
ASP CA   C N S 59  
ASP C    C N N 60  
ASP O    O N N 61  
ASP CB   C N N 62  
ASP CG   C N N 63  
ASP OD1  O N N 64  
ASP OD2  O N N 65  
ASP OXT  O N N 66  
ASP H    H N N 67  
ASP H2   H N N 68  
ASP HA   H N N 69  
ASP HB2  H N N 70  
ASP HB3  H N N 71  
ASP HD2  H N N 72  
ASP HXT  H N N 73  
CYS N    N N N 74  
CYS CA   C N R 75  
CYS C    C N N 76  
CYS O    O N N 77  
CYS CB   C N N 78  
CYS SG   S N N 79  
CYS OXT  O N N 80  
CYS H    H N N 81  
CYS H2   H N N 82  
CYS HA   H N N 83  
CYS HB2  H N N 84  
CYS HB3  H N N 85  
CYS HG   H N N 86  
CYS HXT  H N N 87  
GLU N    N N N 88  
GLU CA   C N S 89  
GLU C    C N N 90  
GLU O    O N N 91  
GLU CB   C N N 92  
GLU CG   C N N 93  
GLU CD   C N N 94  
GLU OE1  O N N 95  
GLU OE2  O N N 96  
GLU OXT  O N N 97  
GLU H    H N N 98  
GLU H2   H N N 99  
GLU HA   H N N 100 
GLU HB2  H N N 101 
GLU HB3  H N N 102 
GLU HG2  H N N 103 
GLU HG3  H N N 104 
GLU HE2  H N N 105 
GLU HXT  H N N 106 
GLY N    N N N 107 
GLY CA   C N N 108 
GLY C    C N N 109 
GLY O    O N N 110 
GLY OXT  O N N 111 
GLY H    H N N 112 
GLY H2   H N N 113 
GLY HA2  H N N 114 
GLY HA3  H N N 115 
GLY HXT  H N N 116 
ILE N    N N N 117 
ILE CA   C N S 118 
ILE C    C N N 119 
ILE O    O N N 120 
ILE CB   C N S 121 
ILE CG1  C N N 122 
ILE CG2  C N N 123 
ILE CD1  C N N 124 
ILE OXT  O N N 125 
ILE H    H N N 126 
ILE H2   H N N 127 
ILE HA   H N N 128 
ILE HB   H N N 129 
ILE HG12 H N N 130 
ILE HG13 H N N 131 
ILE HG21 H N N 132 
ILE HG22 H N N 133 
ILE HG23 H N N 134 
ILE HD11 H N N 135 
ILE HD12 H N N 136 
ILE HD13 H N N 137 
ILE HXT  H N N 138 
LEU N    N N N 139 
LEU CA   C N S 140 
LEU C    C N N 141 
LEU O    O N N 142 
LEU CB   C N N 143 
LEU CG   C N N 144 
LEU CD1  C N N 145 
LEU CD2  C N N 146 
LEU OXT  O N N 147 
LEU H    H N N 148 
LEU H2   H N N 149 
LEU HA   H N N 150 
LEU HB2  H N N 151 
LEU HB3  H N N 152 
LEU HG   H N N 153 
LEU HD11 H N N 154 
LEU HD12 H N N 155 
LEU HD13 H N N 156 
LEU HD21 H N N 157 
LEU HD22 H N N 158 
LEU HD23 H N N 159 
LEU HXT  H N N 160 
LYS N    N N N 161 
LYS CA   C N S 162 
LYS C    C N N 163 
LYS O    O N N 164 
LYS CB   C N N 165 
LYS CG   C N N 166 
LYS CD   C N N 167 
LYS CE   C N N 168 
LYS NZ   N N N 169 
LYS OXT  O N N 170 
LYS H    H N N 171 
LYS H2   H N N 172 
LYS HA   H N N 173 
LYS HB2  H N N 174 
LYS HB3  H N N 175 
LYS HG2  H N N 176 
LYS HG3  H N N 177 
LYS HD2  H N N 178 
LYS HD3  H N N 179 
LYS HE2  H N N 180 
LYS HE3  H N N 181 
LYS HZ1  H N N 182 
LYS HZ2  H N N 183 
LYS HZ3  H N N 184 
LYS HXT  H N N 185 
MET N    N N N 186 
MET CA   C N S 187 
MET C    C N N 188 
MET O    O N N 189 
MET CB   C N N 190 
MET CG   C N N 191 
MET SD   S N N 192 
MET CE   C N N 193 
MET OXT  O N N 194 
MET H    H N N 195 
MET H2   H N N 196 
MET HA   H N N 197 
MET HB2  H N N 198 
MET HB3  H N N 199 
MET HG2  H N N 200 
MET HG3  H N N 201 
MET HE1  H N N 202 
MET HE2  H N N 203 
MET HE3  H N N 204 
MET HXT  H N N 205 
PHE N    N N N 206 
PHE CA   C N S 207 
PHE C    C N N 208 
PHE O    O N N 209 
PHE CB   C N N 210 
PHE CG   C Y N 211 
PHE CD1  C Y N 212 
PHE CD2  C Y N 213 
PHE CE1  C Y N 214 
PHE CE2  C Y N 215 
PHE CZ   C Y N 216 
PHE OXT  O N N 217 
PHE H    H N N 218 
PHE H2   H N N 219 
PHE HA   H N N 220 
PHE HB2  H N N 221 
PHE HB3  H N N 222 
PHE HD1  H N N 223 
PHE HD2  H N N 224 
PHE HE1  H N N 225 
PHE HE2  H N N 226 
PHE HZ   H N N 227 
PHE HXT  H N N 228 
PRO N    N N N 229 
PRO CA   C N S 230 
PRO C    C N N 231 
PRO O    O N N 232 
PRO CB   C N N 233 
PRO CG   C N N 234 
PRO CD   C N N 235 
PRO OXT  O N N 236 
PRO H    H N N 237 
PRO HA   H N N 238 
PRO HB2  H N N 239 
PRO HB3  H N N 240 
PRO HG2  H N N 241 
PRO HG3  H N N 242 
PRO HD2  H N N 243 
PRO HD3  H N N 244 
PRO HXT  H N N 245 
SER N    N N N 246 
SER CA   C N S 247 
SER C    C N N 248 
SER O    O N N 249 
SER CB   C N N 250 
SER OG   O N N 251 
SER OXT  O N N 252 
SER H    H N N 253 
SER H2   H N N 254 
SER HA   H N N 255 
SER HB2  H N N 256 
SER HB3  H N N 257 
SER HG   H N N 258 
SER HXT  H N N 259 
THR N    N N N 260 
THR CA   C N S 261 
THR C    C N N 262 
THR O    O N N 263 
THR CB   C N R 264 
THR OG1  O N N 265 
THR CG2  C N N 266 
THR OXT  O N N 267 
THR H    H N N 268 
THR H2   H N N 269 
THR HA   H N N 270 
THR HB   H N N 271 
THR HG1  H N N 272 
THR HG21 H N N 273 
THR HG22 H N N 274 
THR HG23 H N N 275 
THR HXT  H N N 276 
VAL N    N N N 277 
VAL CA   C N S 278 
VAL C    C N N 279 
VAL O    O N N 280 
VAL CB   C N N 281 
VAL CG1  C N N 282 
VAL CG2  C N N 283 
VAL OXT  O N N 284 
VAL H    H N N 285 
VAL H2   H N N 286 
VAL HA   H N N 287 
VAL HB   H N N 288 
VAL HG11 H N N 289 
VAL HG12 H N N 290 
VAL HG13 H N N 291 
VAL HG21 H N N 292 
VAL HG22 H N N 293 
VAL HG23 H N N 294 
VAL HXT  H N N 295 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLU N   CA   sing N N 83  
GLU N   H    sing N N 84  
GLU N   H2   sing N N 85  
GLU CA  C    sing N N 86  
GLU CA  CB   sing N N 87  
GLU CA  HA   sing N N 88  
GLU C   O    doub N N 89  
GLU C   OXT  sing N N 90  
GLU CB  CG   sing N N 91  
GLU CB  HB2  sing N N 92  
GLU CB  HB3  sing N N 93  
GLU CG  CD   sing N N 94  
GLU CG  HG2  sing N N 95  
GLU CG  HG3  sing N N 96  
GLU CD  OE1  doub N N 97  
GLU CD  OE2  sing N N 98  
GLU OE2 HE2  sing N N 99  
GLU OXT HXT  sing N N 100 
GLY N   CA   sing N N 101 
GLY N   H    sing N N 102 
GLY N   H2   sing N N 103 
GLY CA  C    sing N N 104 
GLY CA  HA2  sing N N 105 
GLY CA  HA3  sing N N 106 
GLY C   O    doub N N 107 
GLY C   OXT  sing N N 108 
GLY OXT HXT  sing N N 109 
ILE N   CA   sing N N 110 
ILE N   H    sing N N 111 
ILE N   H2   sing N N 112 
ILE CA  C    sing N N 113 
ILE CA  CB   sing N N 114 
ILE CA  HA   sing N N 115 
ILE C   O    doub N N 116 
ILE C   OXT  sing N N 117 
ILE CB  CG1  sing N N 118 
ILE CB  CG2  sing N N 119 
ILE CB  HB   sing N N 120 
ILE CG1 CD1  sing N N 121 
ILE CG1 HG12 sing N N 122 
ILE CG1 HG13 sing N N 123 
ILE CG2 HG21 sing N N 124 
ILE CG2 HG22 sing N N 125 
ILE CG2 HG23 sing N N 126 
ILE CD1 HD11 sing N N 127 
ILE CD1 HD12 sing N N 128 
ILE CD1 HD13 sing N N 129 
ILE OXT HXT  sing N N 130 
LEU N   CA   sing N N 131 
LEU N   H    sing N N 132 
LEU N   H2   sing N N 133 
LEU CA  C    sing N N 134 
LEU CA  CB   sing N N 135 
LEU CA  HA   sing N N 136 
LEU C   O    doub N N 137 
LEU C   OXT  sing N N 138 
LEU CB  CG   sing N N 139 
LEU CB  HB2  sing N N 140 
LEU CB  HB3  sing N N 141 
LEU CG  CD1  sing N N 142 
LEU CG  CD2  sing N N 143 
LEU CG  HG   sing N N 144 
LEU CD1 HD11 sing N N 145 
LEU CD1 HD12 sing N N 146 
LEU CD1 HD13 sing N N 147 
LEU CD2 HD21 sing N N 148 
LEU CD2 HD22 sing N N 149 
LEU CD2 HD23 sing N N 150 
LEU OXT HXT  sing N N 151 
LYS N   CA   sing N N 152 
LYS N   H    sing N N 153 
LYS N   H2   sing N N 154 
LYS CA  C    sing N N 155 
LYS CA  CB   sing N N 156 
LYS CA  HA   sing N N 157 
LYS C   O    doub N N 158 
LYS C   OXT  sing N N 159 
LYS CB  CG   sing N N 160 
LYS CB  HB2  sing N N 161 
LYS CB  HB3  sing N N 162 
LYS CG  CD   sing N N 163 
LYS CG  HG2  sing N N 164 
LYS CG  HG3  sing N N 165 
LYS CD  CE   sing N N 166 
LYS CD  HD2  sing N N 167 
LYS CD  HD3  sing N N 168 
LYS CE  NZ   sing N N 169 
LYS CE  HE2  sing N N 170 
LYS CE  HE3  sing N N 171 
LYS NZ  HZ1  sing N N 172 
LYS NZ  HZ2  sing N N 173 
LYS NZ  HZ3  sing N N 174 
LYS OXT HXT  sing N N 175 
MET N   CA   sing N N 176 
MET N   H    sing N N 177 
MET N   H2   sing N N 178 
MET CA  C    sing N N 179 
MET CA  CB   sing N N 180 
MET CA  HA   sing N N 181 
MET C   O    doub N N 182 
MET C   OXT  sing N N 183 
MET CB  CG   sing N N 184 
MET CB  HB2  sing N N 185 
MET CB  HB3  sing N N 186 
MET CG  SD   sing N N 187 
MET CG  HG2  sing N N 188 
MET CG  HG3  sing N N 189 
MET SD  CE   sing N N 190 
MET CE  HE1  sing N N 191 
MET CE  HE2  sing N N 192 
MET CE  HE3  sing N N 193 
MET OXT HXT  sing N N 194 
PHE N   CA   sing N N 195 
PHE N   H    sing N N 196 
PHE N   H2   sing N N 197 
PHE CA  C    sing N N 198 
PHE CA  CB   sing N N 199 
PHE CA  HA   sing N N 200 
PHE C   O    doub N N 201 
PHE C   OXT  sing N N 202 
PHE CB  CG   sing N N 203 
PHE CB  HB2  sing N N 204 
PHE CB  HB3  sing N N 205 
PHE CG  CD1  doub Y N 206 
PHE CG  CD2  sing Y N 207 
PHE CD1 CE1  sing Y N 208 
PHE CD1 HD1  sing N N 209 
PHE CD2 CE2  doub Y N 210 
PHE CD2 HD2  sing N N 211 
PHE CE1 CZ   doub Y N 212 
PHE CE1 HE1  sing N N 213 
PHE CE2 CZ   sing Y N 214 
PHE CE2 HE2  sing N N 215 
PHE CZ  HZ   sing N N 216 
PHE OXT HXT  sing N N 217 
PRO N   CA   sing N N 218 
PRO N   CD   sing N N 219 
PRO N   H    sing N N 220 
PRO CA  C    sing N N 221 
PRO CA  CB   sing N N 222 
PRO CA  HA   sing N N 223 
PRO C   O    doub N N 224 
PRO C   OXT  sing N N 225 
PRO CB  CG   sing N N 226 
PRO CB  HB2  sing N N 227 
PRO CB  HB3  sing N N 228 
PRO CG  CD   sing N N 229 
PRO CG  HG2  sing N N 230 
PRO CG  HG3  sing N N 231 
PRO CD  HD2  sing N N 232 
PRO CD  HD3  sing N N 233 
PRO OXT HXT  sing N N 234 
SER N   CA   sing N N 235 
SER N   H    sing N N 236 
SER N   H2   sing N N 237 
SER CA  C    sing N N 238 
SER CA  CB   sing N N 239 
SER CA  HA   sing N N 240 
SER C   O    doub N N 241 
SER C   OXT  sing N N 242 
SER CB  OG   sing N N 243 
SER CB  HB2  sing N N 244 
SER CB  HB3  sing N N 245 
SER OG  HG   sing N N 246 
SER OXT HXT  sing N N 247 
THR N   CA   sing N N 248 
THR N   H    sing N N 249 
THR N   H2   sing N N 250 
THR CA  C    sing N N 251 
THR CA  CB   sing N N 252 
THR CA  HA   sing N N 253 
THR C   O    doub N N 254 
THR C   OXT  sing N N 255 
THR CB  OG1  sing N N 256 
THR CB  CG2  sing N N 257 
THR CB  HB   sing N N 258 
THR OG1 HG1  sing N N 259 
THR CG2 HG21 sing N N 260 
THR CG2 HG22 sing N N 261 
THR CG2 HG23 sing N N 262 
THR OXT HXT  sing N N 263 
VAL N   CA   sing N N 264 
VAL N   H    sing N N 265 
VAL N   H2   sing N N 266 
VAL CA  C    sing N N 267 
VAL CA  CB   sing N N 268 
VAL CA  HA   sing N N 269 
VAL C   O    doub N N 270 
VAL C   OXT  sing N N 271 
VAL CB  CG1  sing N N 272 
VAL CB  CG2  sing N N 273 
VAL CB  HB   sing N N 274 
VAL CG1 HG11 sing N N 275 
VAL CG1 HG12 sing N N 276 
VAL CG1 HG13 sing N N 277 
VAL CG2 HG21 sing N N 278 
VAL CG2 HG22 sing N N 279 
VAL CG2 HG23 sing N N 280 
VAL OXT HXT  sing N N 281 
# 
_pdbx_nmr_spectrometer.field_strength    800 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AVANCE 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_atom_sites.entry_id                    2NDI 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_