data_2NSV # _entry.id 2NSV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2NSV pdb_00002nsv 10.2210/pdb2nsv/pdb RCSB RCSB040260 ? ? WWPDB D_1000040260 ? ? BMRB 7326 ? 10.13018/BMR7326 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-21 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2020-02-05 4 'Structure model' 1 3 2023-06-14 5 'Structure model' 1 4 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 4 'Structure model' 'Database references' 7 4 'Structure model' Other 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_database_status 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_database_status 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 11 5 'Structure model' pdbx_entry_details 12 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_nmr_spectrometer.model' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' 5 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' 6 5 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.entry_id 2NSV _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2006-11-06 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data REL # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type BMRB 7326 'Homonuclear NMR Assignment of the Pheromone En-1' unspecified PDB 2NSW . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Placzek, W.J.' 1 'Etezady-Esfarjani, T.' 2 'Herrmann, T.' 3 'Peti, W.' 4 'Wuthrich, K.' 5 # _citation.id primary _citation.title 'NMR Solution Structures of the Pheromones En-1 and En-2 from the Antarctic Ciliated Protozoan Euplotes Nobilii' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Placzek, W.J.' 1 ? primary 'Etezady-Esfarjani, T.' 2 ? primary 'Herrmann, T.' 3 ? primary 'Alimenti, C.' 4 ? primary 'Luporini, P.' 5 ? primary 'Peti, W.' 6 ? primary 'Wuthrich, K.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method nat _entity.pdbx_description 'Mating pheromone En-1' _entity.formula_weight 5630.084 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NPEDWFTPDTCAYGDSNTAWTTCTTPGQTCYTCCSSCFDVVGEQACQMSAQC _entity_poly.pdbx_seq_one_letter_code_can NPEDWFTPDTCAYGDSNTAWTTCTTPGQTCYTCCSSCFDVVGEQACQMSAQC _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 PRO n 1 3 GLU n 1 4 ASP n 1 5 TRP n 1 6 PHE n 1 7 THR n 1 8 PRO n 1 9 ASP n 1 10 THR n 1 11 CYS n 1 12 ALA n 1 13 TYR n 1 14 GLY n 1 15 ASP n 1 16 SER n 1 17 ASN n 1 18 THR n 1 19 ALA n 1 20 TRP n 1 21 THR n 1 22 THR n 1 23 CYS n 1 24 THR n 1 25 THR n 1 26 PRO n 1 27 GLY n 1 28 GLN n 1 29 THR n 1 30 CYS n 1 31 TYR n 1 32 THR n 1 33 CYS n 1 34 CYS n 1 35 SER n 1 36 SER n 1 37 CYS n 1 38 PHE n 1 39 ASP n 1 40 VAL n 1 41 VAL n 1 42 GLY n 1 43 GLU n 1 44 GLN n 1 45 ALA n 1 46 CYS n 1 47 GLN n 1 48 MET n 1 49 SER n 1 50 ALA n 1 51 GLN n 1 52 CYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num ? _entity_src_nat.pdbx_end_seq_num ? _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Euplotes nobilii' _entity_src_nat.pdbx_ncbi_taxonomy_id 184062 _entity_src_nat.genus Euplotes _entity_src_nat.species ? _entity_src_nat.strain ? _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 1 ASN ASN A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ASP 4 4 4 ASP ASP A . n A 1 5 TRP 5 5 5 TRP TRP A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 PRO 8 8 8 PRO PRO A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 CYS 11 11 11 CYS CYS A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 TRP 20 20 20 TRP TRP A . n A 1 21 THR 21 21 21 THR THR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 CYS 23 23 23 CYS CYS A . n A 1 24 THR 24 24 24 THR THR A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 THR 29 29 29 THR THR A . n A 1 30 CYS 30 30 30 CYS CYS A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 VAL 41 41 41 VAL VAL A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 MET 48 48 48 MET MET A . n A 1 49 SER 49 49 49 SER SER A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 CYS 52 52 52 CYS CYS A . n # _exptl.entry_id 2NSV _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2NSV _struct.title 'NMR Solution Structure of the Pheromone En-1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2NSV _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' _struct_keywords.text 'Euplotes nobilii pheromone, disulfide-rich, all alpha helical, SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MEN1_EUPNO _struct_ref.pdbx_db_accession P83441 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NPEDWFTPDTCAYGDSNTAWTTCTTPGQTCYTCCSSCFDVVGEQACQMSAQC _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2NSV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 52 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P83441 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 52 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 52 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 15 ? THR A 24 ? ASP A 15 THR A 24 1 ? 10 HELX_P HELX_P2 2 THR A 29 ? CYS A 34 ? THR A 29 CYS A 34 1 ? 6 HELX_P HELX_P3 3 SER A 35 ? CYS A 37 ? SER A 35 CYS A 37 5 ? 3 HELX_P HELX_P4 4 VAL A 40 ? ALA A 50 ? VAL A 40 ALA A 50 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 37 SG ? ? A CYS 11 A CYS 37 1_555 ? ? ? ? ? ? ? 1.963 ? ? disulf2 disulf ? ? A CYS 23 SG ? ? ? 1_555 A CYS 33 SG ? ? A CYS 23 A CYS 33 1_555 ? ? ? ? ? ? ? 1.995 ? ? disulf3 disulf ? ? A CYS 30 SG ? ? ? 1_555 A CYS 52 SG ? ? A CYS 30 A CYS 52 1_555 ? ? ? ? ? ? ? 2.091 ? ? disulf4 disulf ? ? A CYS 34 SG ? ? ? 1_555 A CYS 46 SG ? ? A CYS 34 A CYS 46 1_555 ? ? ? ? ? ? ? 1.911 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 11 ? CYS A 37 ? CYS A 11 ? 1_555 CYS A 37 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 23 ? CYS A 33 ? CYS A 23 ? 1_555 CYS A 33 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 30 ? CYS A 52 ? CYS A 30 ? 1_555 CYS A 52 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 34 ? CYS A 46 ? CYS A 34 ? 1_555 CYS A 46 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 2NSV _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A THR 18 ? ? H A THR 22 ? ? 1.51 2 1 O A CYS 46 ? ? H A ALA 50 ? ? 1.54 3 1 O A CYS 33 ? ? H A SER 36 ? ? 1.58 4 2 O A VAL 41 ? ? H A ALA 45 ? ? 1.50 5 3 O A THR 32 ? ? HG A SER 35 ? ? 1.47 6 3 H A THR 7 ? ? O A CYS 37 ? ? 1.47 7 3 O A THR 18 ? ? H A THR 22 ? ? 1.55 8 3 O A VAL 41 ? ? H A ALA 45 ? ? 1.57 9 4 O A THR 18 ? ? H A THR 22 ? ? 1.51 10 4 O A VAL 41 ? ? H A ALA 45 ? ? 1.54 11 5 O A VAL 41 ? ? H A ALA 45 ? ? 1.51 12 5 O A THR 18 ? ? HG1 A THR 22 ? ? 1.57 13 5 O A THR 18 ? ? H A THR 22 ? ? 1.60 14 6 O A VAL 41 ? ? H A ALA 45 ? ? 1.51 15 6 O A THR 18 ? ? H A THR 22 ? ? 1.53 16 6 O A CYS 33 ? ? H A CYS 37 ? ? 1.55 17 7 O A VAL 41 ? ? H A ALA 45 ? ? 1.55 18 7 O A THR 18 ? ? H A THR 22 ? ? 1.56 19 8 O A VAL 41 ? ? H A ALA 45 ? ? 1.48 20 8 O A THR 18 ? ? H A THR 22 ? ? 1.53 21 9 O A VAL 41 ? ? H A ALA 45 ? ? 1.56 22 10 O A THR 18 ? ? H A THR 22 ? ? 1.50 23 10 O A CYS 33 ? ? H A SER 36 ? ? 1.59 24 10 O A CYS 46 ? ? H A ALA 50 ? ? 1.60 25 11 O A VAL 41 ? ? H A ALA 45 ? ? 1.48 26 12 O A THR 18 ? ? H A THR 22 ? ? 1.53 27 12 O A CYS 33 ? ? H A SER 36 ? ? 1.57 28 13 O A THR 18 ? ? H A THR 22 ? ? 1.55 29 13 O A VAL 41 ? ? H A ALA 45 ? ? 1.56 30 14 O A THR 18 ? ? H A THR 22 ? ? 1.53 31 15 O A VAL 41 ? ? H A ALA 45 ? ? 1.49 32 15 O A THR 18 ? ? H A THR 22 ? ? 1.53 33 16 O A THR 18 ? ? H A THR 22 ? ? 1.49 34 16 O A VAL 41 ? ? H A ALA 45 ? ? 1.57 35 17 O A VAL 41 ? ? H A ALA 45 ? ? 1.48 36 19 O A VAL 41 ? ? H A ALA 45 ? ? 1.53 37 20 O A THR 18 ? ? H A THR 22 ? ? 1.51 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -74.98 49.76 2 1 TRP A 5 ? ? -115.96 -156.45 3 1 PHE A 6 ? ? 58.02 125.81 4 1 THR A 10 ? ? -141.08 46.20 5 1 THR A 29 ? ? -116.24 51.04 6 1 CYS A 37 ? ? -142.11 17.06 7 1 ASP A 39 ? ? -104.80 -80.27 8 1 VAL A 40 ? ? -130.57 -47.51 9 1 GLN A 51 ? ? -101.07 53.62 10 2 TRP A 5 ? ? -121.66 -155.36 11 2 PHE A 6 ? ? 56.87 117.94 12 2 THR A 10 ? ? -145.07 39.99 13 2 THR A 29 ? ? -109.28 41.26 14 2 ASP A 39 ? ? -112.67 -104.71 15 2 ALA A 50 ? ? -63.04 82.50 16 3 TRP A 5 ? ? -123.09 -154.21 17 3 PHE A 6 ? ? 56.89 116.35 18 3 THR A 10 ? ? -144.33 39.86 19 3 ALA A 12 ? ? -97.43 52.50 20 3 CYS A 30 ? ? -56.15 -71.34 21 3 CYS A 37 ? ? -140.98 -48.61 22 3 ASP A 39 ? ? -108.15 -104.40 23 3 VAL A 41 ? ? -71.52 -73.50 24 3 ALA A 50 ? ? -59.08 100.20 25 3 GLN A 51 ? ? -90.55 54.81 26 4 TRP A 5 ? ? -130.88 -153.59 27 4 PHE A 6 ? ? 58.00 119.87 28 4 THR A 10 ? ? -144.93 40.16 29 4 ALA A 12 ? ? -99.15 53.12 30 4 ASP A 39 ? ? -107.83 -104.40 31 4 VAL A 41 ? ? -71.30 -71.61 32 4 ALA A 50 ? ? -44.98 95.99 33 4 GLN A 51 ? ? -112.06 54.23 34 5 TRP A 5 ? ? -129.21 -152.21 35 5 PHE A 6 ? ? 57.57 120.18 36 5 THR A 10 ? ? -143.83 39.68 37 5 CYS A 37 ? ? -144.02 18.66 38 5 ASP A 39 ? ? -110.10 -103.72 39 5 VAL A 41 ? ? -71.99 -72.30 40 5 ALA A 50 ? ? -63.40 82.20 41 5 GLN A 51 ? ? -91.45 53.41 42 6 TRP A 5 ? ? -122.08 -154.40 43 6 PHE A 6 ? ? 57.57 119.47 44 6 THR A 10 ? ? -143.51 39.97 45 6 ASP A 39 ? ? -111.03 -104.87 46 6 ALA A 50 ? ? -62.40 82.30 47 7 TRP A 5 ? ? -117.11 -155.43 48 7 PHE A 6 ? ? 57.35 119.56 49 7 ALA A 12 ? ? -93.35 50.47 50 7 ASP A 39 ? ? -110.95 -104.72 51 7 ALA A 50 ? ? -49.64 98.52 52 7 GLN A 51 ? ? -102.08 54.79 53 8 TRP A 5 ? ? -123.22 -154.03 54 8 PHE A 6 ? ? 57.69 122.04 55 8 THR A 29 ? ? -109.45 41.52 56 8 CYS A 37 ? ? -140.10 17.59 57 8 ASP A 39 ? ? -110.01 -104.03 58 8 VAL A 41 ? ? -72.03 -74.70 59 8 ALA A 50 ? ? -45.80 95.91 60 8 GLN A 51 ? ? -112.40 53.82 61 9 TRP A 5 ? ? -102.94 -158.95 62 9 PHE A 6 ? ? 57.71 120.28 63 9 CYS A 37 ? ? -93.56 30.43 64 9 ASP A 39 ? ? -112.89 -105.10 65 9 ALA A 50 ? ? -45.49 105.05 66 9 GLN A 51 ? ? -103.95 53.25 67 10 TRP A 5 ? ? -117.79 -153.33 68 10 PHE A 6 ? ? 58.95 124.43 69 10 THR A 10 ? ? -145.14 45.39 70 10 ALA A 12 ? ? -96.56 52.11 71 10 THR A 24 ? ? -84.95 47.34 72 10 SER A 36 ? ? -144.24 17.74 73 10 ASP A 39 ? ? -102.29 -85.24 74 10 VAL A 40 ? ? -130.47 -42.62 75 10 ALA A 50 ? ? -45.32 109.14 76 10 GLN A 51 ? ? -119.81 53.32 77 11 TRP A 5 ? ? -124.71 -154.13 78 11 PHE A 6 ? ? 58.07 121.77 79 11 ASP A 39 ? ? -108.66 -104.35 80 11 VAL A 41 ? ? -71.51 -74.62 81 11 ALA A 50 ? ? -48.30 94.53 82 11 GLN A 51 ? ? -110.27 54.48 83 12 TRP A 5 ? ? -123.02 -153.30 84 12 PHE A 6 ? ? 58.63 126.70 85 12 THR A 10 ? ? -144.96 44.69 86 12 SER A 36 ? ? -140.08 17.48 87 12 CYS A 37 ? ? -141.30 17.13 88 12 ASP A 39 ? ? -98.34 -82.89 89 12 VAL A 40 ? ? -129.99 -50.30 90 12 ALA A 50 ? ? -50.88 106.28 91 12 GLN A 51 ? ? -106.45 52.65 92 13 TRP A 5 ? ? -100.06 -160.37 93 13 PHE A 6 ? ? 58.29 125.20 94 13 THR A 10 ? ? -145.17 41.52 95 13 CYS A 37 ? ? -93.54 31.35 96 13 ASP A 39 ? ? -113.09 -104.67 97 13 ALA A 50 ? ? -62.79 82.77 98 14 TRP A 5 ? ? -112.73 -153.67 99 14 PHE A 6 ? ? 57.97 121.53 100 14 THR A 10 ? ? -145.21 40.78 101 14 CYS A 30 ? ? -66.96 -71.96 102 14 ASP A 39 ? ? -116.41 -104.48 103 14 VAL A 40 ? ? -93.76 -66.41 104 14 ALA A 50 ? ? -66.93 72.48 105 15 TRP A 5 ? ? -114.79 -154.25 106 15 PHE A 6 ? ? 58.05 124.74 107 15 THR A 10 ? ? -144.66 43.17 108 15 ASP A 39 ? ? -109.58 -104.54 109 15 VAL A 41 ? ? -69.77 -70.92 110 15 ALA A 50 ? ? -45.97 101.97 111 15 GLN A 51 ? ? -117.99 53.17 112 16 TRP A 5 ? ? -102.88 -154.66 113 16 PHE A 6 ? ? 57.98 120.01 114 16 THR A 10 ? ? -144.87 39.86 115 16 ALA A 12 ? ? -97.30 52.46 116 16 ASP A 39 ? ? -112.86 -106.15 117 16 ALA A 50 ? ? -45.41 101.46 118 16 GLN A 51 ? ? -100.79 53.57 119 17 TRP A 5 ? ? -126.34 -151.90 120 17 PHE A 6 ? ? 59.12 128.99 121 17 THR A 10 ? ? -144.01 43.79 122 17 CYS A 37 ? ? -141.17 15.56 123 17 ASP A 39 ? ? -106.09 -104.44 124 17 VAL A 41 ? ? -72.11 -75.28 125 17 ALA A 50 ? ? -59.11 86.71 126 17 GLN A 51 ? ? -100.49 56.18 127 18 TRP A 5 ? ? -106.04 -152.42 128 18 PHE A 6 ? ? 58.45 124.75 129 18 CYS A 37 ? ? -140.27 16.26 130 18 ASP A 39 ? ? -95.76 -83.07 131 18 ALA A 50 ? ? -46.03 98.35 132 18 GLN A 51 ? ? -108.01 53.91 133 19 TRP A 5 ? ? -100.36 -162.65 134 19 PHE A 6 ? ? 57.87 118.43 135 19 CYS A 37 ? ? -93.82 30.77 136 19 ASP A 39 ? ? -113.49 -104.63 137 19 ALA A 50 ? ? -62.09 87.71 138 20 TRP A 5 ? ? -92.34 -154.63 139 20 PHE A 6 ? ? 58.04 117.89 140 20 THR A 10 ? ? -141.07 41.10 141 20 THR A 29 ? ? -117.85 50.87 142 20 CYS A 37 ? ? -94.04 30.67 143 20 ASP A 39 ? ? -115.24 -105.93 144 20 ALA A 50 ? ? -48.86 105.86 145 20 GLN A 51 ? ? -100.97 53.88 # _pdbx_nmr_ensemble.entry_id 2NSV _pdbx_nmr_ensemble.conformers_calculated_total_number 80 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2NSV _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.9 mM En-1, 20 mM phosphate buffer, pH 6.0, 90 % H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength '20 mM' _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_exptl.experiment_id 1 _pdbx_nmr_exptl.solution_id 1 _pdbx_nmr_exptl.conditions_id 1 _pdbx_nmr_exptl.type '2D NOESY' # loop_ _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.classification _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal DYANA ? refinement 'Guntert, P.' 1 ATNOS ? 'data analysis' 'Herrmann, T.' 2 CANDID ? 'data analysis' 'Herrmann, T.' 3 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CYS N N N N 47 CYS CA C N R 48 CYS C C N N 49 CYS O O N N 50 CYS CB C N N 51 CYS SG S N N 52 CYS OXT O N N 53 CYS H H N N 54 CYS H2 H N N 55 CYS HA H N N 56 CYS HB2 H N N 57 CYS HB3 H N N 58 CYS HG H N N 59 CYS HXT H N N 60 GLN N N N N 61 GLN CA C N S 62 GLN C C N N 63 GLN O O N N 64 GLN CB C N N 65 GLN CG C N N 66 GLN CD C N N 67 GLN OE1 O N N 68 GLN NE2 N N N 69 GLN OXT O N N 70 GLN H H N N 71 GLN H2 H N N 72 GLN HA H N N 73 GLN HB2 H N N 74 GLN HB3 H N N 75 GLN HG2 H N N 76 GLN HG3 H N N 77 GLN HE21 H N N 78 GLN HE22 H N N 79 GLN HXT H N N 80 GLU N N N N 81 GLU CA C N S 82 GLU C C N N 83 GLU O O N N 84 GLU CB C N N 85 GLU CG C N N 86 GLU CD C N N 87 GLU OE1 O N N 88 GLU OE2 O N N 89 GLU OXT O N N 90 GLU H H N N 91 GLU H2 H N N 92 GLU HA H N N 93 GLU HB2 H N N 94 GLU HB3 H N N 95 GLU HG2 H N N 96 GLU HG3 H N N 97 GLU HE2 H N N 98 GLU HXT H N N 99 GLY N N N N 100 GLY CA C N N 101 GLY C C N N 102 GLY O O N N 103 GLY OXT O N N 104 GLY H H N N 105 GLY H2 H N N 106 GLY HA2 H N N 107 GLY HA3 H N N 108 GLY HXT H N N 109 MET N N N N 110 MET CA C N S 111 MET C C N N 112 MET O O N N 113 MET CB C N N 114 MET CG C N N 115 MET SD S N N 116 MET CE C N N 117 MET OXT O N N 118 MET H H N N 119 MET H2 H N N 120 MET HA H N N 121 MET HB2 H N N 122 MET HB3 H N N 123 MET HG2 H N N 124 MET HG3 H N N 125 MET HE1 H N N 126 MET HE2 H N N 127 MET HE3 H N N 128 MET HXT H N N 129 PHE N N N N 130 PHE CA C N S 131 PHE C C N N 132 PHE O O N N 133 PHE CB C N N 134 PHE CG C Y N 135 PHE CD1 C Y N 136 PHE CD2 C Y N 137 PHE CE1 C Y N 138 PHE CE2 C Y N 139 PHE CZ C Y N 140 PHE OXT O N N 141 PHE H H N N 142 PHE H2 H N N 143 PHE HA H N N 144 PHE HB2 H N N 145 PHE HB3 H N N 146 PHE HD1 H N N 147 PHE HD2 H N N 148 PHE HE1 H N N 149 PHE HE2 H N N 150 PHE HZ H N N 151 PHE HXT H N N 152 PRO N N N N 153 PRO CA C N S 154 PRO C C N N 155 PRO O O N N 156 PRO CB C N N 157 PRO CG C N N 158 PRO CD C N N 159 PRO OXT O N N 160 PRO H H N N 161 PRO HA H N N 162 PRO HB2 H N N 163 PRO HB3 H N N 164 PRO HG2 H N N 165 PRO HG3 H N N 166 PRO HD2 H N N 167 PRO HD3 H N N 168 PRO HXT H N N 169 SER N N N N 170 SER CA C N S 171 SER C C N N 172 SER O O N N 173 SER CB C N N 174 SER OG O N N 175 SER OXT O N N 176 SER H H N N 177 SER H2 H N N 178 SER HA H N N 179 SER HB2 H N N 180 SER HB3 H N N 181 SER HG H N N 182 SER HXT H N N 183 THR N N N N 184 THR CA C N S 185 THR C C N N 186 THR O O N N 187 THR CB C N R 188 THR OG1 O N N 189 THR CG2 C N N 190 THR OXT O N N 191 THR H H N N 192 THR H2 H N N 193 THR HA H N N 194 THR HB H N N 195 THR HG1 H N N 196 THR HG21 H N N 197 THR HG22 H N N 198 THR HG23 H N N 199 THR HXT H N N 200 TRP N N N N 201 TRP CA C N S 202 TRP C C N N 203 TRP O O N N 204 TRP CB C N N 205 TRP CG C Y N 206 TRP CD1 C Y N 207 TRP CD2 C Y N 208 TRP NE1 N Y N 209 TRP CE2 C Y N 210 TRP CE3 C Y N 211 TRP CZ2 C Y N 212 TRP CZ3 C Y N 213 TRP CH2 C Y N 214 TRP OXT O N N 215 TRP H H N N 216 TRP H2 H N N 217 TRP HA H N N 218 TRP HB2 H N N 219 TRP HB3 H N N 220 TRP HD1 H N N 221 TRP HE1 H N N 222 TRP HE3 H N N 223 TRP HZ2 H N N 224 TRP HZ3 H N N 225 TRP HH2 H N N 226 TRP HXT H N N 227 TYR N N N N 228 TYR CA C N S 229 TYR C C N N 230 TYR O O N N 231 TYR CB C N N 232 TYR CG C Y N 233 TYR CD1 C Y N 234 TYR CD2 C Y N 235 TYR CE1 C Y N 236 TYR CE2 C Y N 237 TYR CZ C Y N 238 TYR OH O N N 239 TYR OXT O N N 240 TYR H H N N 241 TYR H2 H N N 242 TYR HA H N N 243 TYR HB2 H N N 244 TYR HB3 H N N 245 TYR HD1 H N N 246 TYR HD2 H N N 247 TYR HE1 H N N 248 TYR HE2 H N N 249 TYR HH H N N 250 TYR HXT H N N 251 VAL N N N N 252 VAL CA C N S 253 VAL C C N N 254 VAL O O N N 255 VAL CB C N N 256 VAL CG1 C N N 257 VAL CG2 C N N 258 VAL OXT O N N 259 VAL H H N N 260 VAL H2 H N N 261 VAL HA H N N 262 VAL HB H N N 263 VAL HG11 H N N 264 VAL HG12 H N N 265 VAL HG13 H N N 266 VAL HG21 H N N 267 VAL HG22 H N N 268 VAL HG23 H N N 269 VAL HXT H N N 270 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 CYS N CA sing N N 44 CYS N H sing N N 45 CYS N H2 sing N N 46 CYS CA C sing N N 47 CYS CA CB sing N N 48 CYS CA HA sing N N 49 CYS C O doub N N 50 CYS C OXT sing N N 51 CYS CB SG sing N N 52 CYS CB HB2 sing N N 53 CYS CB HB3 sing N N 54 CYS SG HG sing N N 55 CYS OXT HXT sing N N 56 GLN N CA sing N N 57 GLN N H sing N N 58 GLN N H2 sing N N 59 GLN CA C sing N N 60 GLN CA CB sing N N 61 GLN CA HA sing N N 62 GLN C O doub N N 63 GLN C OXT sing N N 64 GLN CB CG sing N N 65 GLN CB HB2 sing N N 66 GLN CB HB3 sing N N 67 GLN CG CD sing N N 68 GLN CG HG2 sing N N 69 GLN CG HG3 sing N N 70 GLN CD OE1 doub N N 71 GLN CD NE2 sing N N 72 GLN NE2 HE21 sing N N 73 GLN NE2 HE22 sing N N 74 GLN OXT HXT sing N N 75 GLU N CA sing N N 76 GLU N H sing N N 77 GLU N H2 sing N N 78 GLU CA C sing N N 79 GLU CA CB sing N N 80 GLU CA HA sing N N 81 GLU C O doub N N 82 GLU C OXT sing N N 83 GLU CB CG sing N N 84 GLU CB HB2 sing N N 85 GLU CB HB3 sing N N 86 GLU CG CD sing N N 87 GLU CG HG2 sing N N 88 GLU CG HG3 sing N N 89 GLU CD OE1 doub N N 90 GLU CD OE2 sing N N 91 GLU OE2 HE2 sing N N 92 GLU OXT HXT sing N N 93 GLY N CA sing N N 94 GLY N H sing N N 95 GLY N H2 sing N N 96 GLY CA C sing N N 97 GLY CA HA2 sing N N 98 GLY CA HA3 sing N N 99 GLY C O doub N N 100 GLY C OXT sing N N 101 GLY OXT HXT sing N N 102 MET N CA sing N N 103 MET N H sing N N 104 MET N H2 sing N N 105 MET CA C sing N N 106 MET CA CB sing N N 107 MET CA HA sing N N 108 MET C O doub N N 109 MET C OXT sing N N 110 MET CB CG sing N N 111 MET CB HB2 sing N N 112 MET CB HB3 sing N N 113 MET CG SD sing N N 114 MET CG HG2 sing N N 115 MET CG HG3 sing N N 116 MET SD CE sing N N 117 MET CE HE1 sing N N 118 MET CE HE2 sing N N 119 MET CE HE3 sing N N 120 MET OXT HXT sing N N 121 PHE N CA sing N N 122 PHE N H sing N N 123 PHE N H2 sing N N 124 PHE CA C sing N N 125 PHE CA CB sing N N 126 PHE CA HA sing N N 127 PHE C O doub N N 128 PHE C OXT sing N N 129 PHE CB CG sing N N 130 PHE CB HB2 sing N N 131 PHE CB HB3 sing N N 132 PHE CG CD1 doub Y N 133 PHE CG CD2 sing Y N 134 PHE CD1 CE1 sing Y N 135 PHE CD1 HD1 sing N N 136 PHE CD2 CE2 doub Y N 137 PHE CD2 HD2 sing N N 138 PHE CE1 CZ doub Y N 139 PHE CE1 HE1 sing N N 140 PHE CE2 CZ sing Y N 141 PHE CE2 HE2 sing N N 142 PHE CZ HZ sing N N 143 PHE OXT HXT sing N N 144 PRO N CA sing N N 145 PRO N CD sing N N 146 PRO N H sing N N 147 PRO CA C sing N N 148 PRO CA CB sing N N 149 PRO CA HA sing N N 150 PRO C O doub N N 151 PRO C OXT sing N N 152 PRO CB CG sing N N 153 PRO CB HB2 sing N N 154 PRO CB HB3 sing N N 155 PRO CG CD sing N N 156 PRO CG HG2 sing N N 157 PRO CG HG3 sing N N 158 PRO CD HD2 sing N N 159 PRO CD HD3 sing N N 160 PRO OXT HXT sing N N 161 SER N CA sing N N 162 SER N H sing N N 163 SER N H2 sing N N 164 SER CA C sing N N 165 SER CA CB sing N N 166 SER CA HA sing N N 167 SER C O doub N N 168 SER C OXT sing N N 169 SER CB OG sing N N 170 SER CB HB2 sing N N 171 SER CB HB3 sing N N 172 SER OG HG sing N N 173 SER OXT HXT sing N N 174 THR N CA sing N N 175 THR N H sing N N 176 THR N H2 sing N N 177 THR CA C sing N N 178 THR CA CB sing N N 179 THR CA HA sing N N 180 THR C O doub N N 181 THR C OXT sing N N 182 THR CB OG1 sing N N 183 THR CB CG2 sing N N 184 THR CB HB sing N N 185 THR OG1 HG1 sing N N 186 THR CG2 HG21 sing N N 187 THR CG2 HG22 sing N N 188 THR CG2 HG23 sing N N 189 THR OXT HXT sing N N 190 TRP N CA sing N N 191 TRP N H sing N N 192 TRP N H2 sing N N 193 TRP CA C sing N N 194 TRP CA CB sing N N 195 TRP CA HA sing N N 196 TRP C O doub N N 197 TRP C OXT sing N N 198 TRP CB CG sing N N 199 TRP CB HB2 sing N N 200 TRP CB HB3 sing N N 201 TRP CG CD1 doub Y N 202 TRP CG CD2 sing Y N 203 TRP CD1 NE1 sing Y N 204 TRP CD1 HD1 sing N N 205 TRP CD2 CE2 doub Y N 206 TRP CD2 CE3 sing Y N 207 TRP NE1 CE2 sing Y N 208 TRP NE1 HE1 sing N N 209 TRP CE2 CZ2 sing Y N 210 TRP CE3 CZ3 doub Y N 211 TRP CE3 HE3 sing N N 212 TRP CZ2 CH2 doub Y N 213 TRP CZ2 HZ2 sing N N 214 TRP CZ3 CH2 sing Y N 215 TRP CZ3 HZ3 sing N N 216 TRP CH2 HH2 sing N N 217 TRP OXT HXT sing N N 218 TYR N CA sing N N 219 TYR N H sing N N 220 TYR N H2 sing N N 221 TYR CA C sing N N 222 TYR CA CB sing N N 223 TYR CA HA sing N N 224 TYR C O doub N N 225 TYR C OXT sing N N 226 TYR CB CG sing N N 227 TYR CB HB2 sing N N 228 TYR CB HB3 sing N N 229 TYR CG CD1 doub Y N 230 TYR CG CD2 sing Y N 231 TYR CD1 CE1 sing Y N 232 TYR CD1 HD1 sing N N 233 TYR CD2 CE2 doub Y N 234 TYR CD2 HD2 sing N N 235 TYR CE1 CZ doub Y N 236 TYR CE1 HE1 sing N N 237 TYR CE2 CZ sing Y N 238 TYR CE2 HE2 sing N N 239 TYR CZ OH sing N N 240 TYR OH HH sing N N 241 TYR OXT HXT sing N N 242 VAL N CA sing N N 243 VAL N H sing N N 244 VAL N H2 sing N N 245 VAL CA C sing N N 246 VAL CA CB sing N N 247 VAL CA HA sing N N 248 VAL C O doub N N 249 VAL C OXT sing N N 250 VAL CB CG1 sing N N 251 VAL CB CG2 sing N N 252 VAL CB HB sing N N 253 VAL CG1 HG11 sing N N 254 VAL CG1 HG12 sing N N 255 VAL CG1 HG13 sing N N 256 VAL CG2 HG21 sing N N 257 VAL CG2 HG22 sing N N 258 VAL CG2 HG23 sing N N 259 VAL OXT HXT sing N N 260 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength 1 ? Bruker AVANCE 600 2 ? Bruker AVANCE 900 # _atom_sites.entry_id 2NSV _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_