data_2P3M # _entry.id 2P3M # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2P3M pdb_00002p3m 10.2210/pdb2p3m/pdb RCSB RCSB041923 ? ? WWPDB D_1000041923 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2VBS . unspecified PDB 2VBU . unspecified PDB 2VBT . unspecified PDB 2VBV . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2P3M _pdbx_database_status.recvd_initial_deposition_date 2007-03-09 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Coles, M.' 1 'Truffault, V.' 2 'Djuranovic, S.' 3 'Martin, J.' 4 'Lupas, A.N.' 5 # _citation.id primary _citation.title 'A CTP-Dependent Archaeal Riboflavin Kinase Forms a Bridge in the Evolution of Cradle-Loop Barrels.' _citation.journal_abbrev Structure _citation.journal_volume 15 _citation.page_first 1577 _citation.page_last 1590 _citation.year 2007 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18073108 _citation.pdbx_database_id_DOI 10.1016/j.str.2007.09.027 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ammelburg, M.' 1 ? primary 'Hartmann, M.D.' 2 ? primary 'Djuranovic, S.' 3 ? primary 'Alva, V.' 4 ? primary 'Koretke, K.K.' 5 ? primary 'Martin, J.' 6 ? primary 'Sauer, G.' 7 ? primary 'Truffault, V.' 8 ? primary 'Zeth, K.' 9 ? primary 'Lupas, A.N.' 10 ? primary 'Coles, M.' 11 ? # _cell.entry_id 2P3M _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2P3M _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Riboflavin Kinase MJ0056' _entity.formula_weight 15709.521 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec 2.7.1.161 _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPI KILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE ; _entity_poly.pdbx_seq_one_letter_code_can ;MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPI KILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 VAL n 1 3 LYS n 1 4 LEU n 1 5 MET n 1 6 ILE n 1 7 ILE n 1 8 GLU n 1 9 GLY n 1 10 GLU n 1 11 VAL n 1 12 VAL n 1 13 SER n 1 14 GLY n 1 15 LEU n 1 16 GLY n 1 17 GLU n 1 18 GLY n 1 19 ARG n 1 20 TYR n 1 21 PHE n 1 22 LEU n 1 23 SER n 1 24 LEU n 1 25 PRO n 1 26 PRO n 1 27 TYR n 1 28 LYS n 1 29 GLU n 1 30 ILE n 1 31 PHE n 1 32 LYS n 1 33 LYS n 1 34 ILE n 1 35 LEU n 1 36 GLY n 1 37 PHE n 1 38 GLU n 1 39 PRO n 1 40 TYR n 1 41 GLU n 1 42 GLY n 1 43 THR n 1 44 LEU n 1 45 ASN n 1 46 LEU n 1 47 LYS n 1 48 LEU n 1 49 ASP n 1 50 ARG n 1 51 GLU n 1 52 PHE n 1 53 ASP n 1 54 ILE n 1 55 ASN n 1 56 LYS n 1 57 PHE n 1 58 LYS n 1 59 TYR n 1 60 ILE n 1 61 GLU n 1 62 THR n 1 63 GLU n 1 64 ASP n 1 65 PHE n 1 66 GLU n 1 67 PHE n 1 68 ASN n 1 69 GLY n 1 70 LYS n 1 71 ARG n 1 72 PHE n 1 73 PHE n 1 74 GLY n 1 75 VAL n 1 76 LYS n 1 77 VAL n 1 78 LEU n 1 79 PRO n 1 80 ILE n 1 81 LYS n 1 82 ILE n 1 83 LEU n 1 84 ILE n 1 85 GLY n 1 86 ASN n 1 87 LYS n 1 88 LYS n 1 89 ILE n 1 90 ASP n 1 91 GLY n 1 92 ALA n 1 93 ILE n 1 94 VAL n 1 95 VAL n 1 96 PRO n 1 97 LYS n 1 98 LYS n 1 99 THR n 1 100 TYR n 1 101 HIS n 1 102 SER n 1 103 SER n 1 104 GLU n 1 105 ILE n 1 106 ILE n 1 107 GLU n 1 108 ILE n 1 109 ILE n 1 110 ALA n 1 111 PRO n 1 112 MET n 1 113 LYS n 1 114 LEU n 1 115 ARG n 1 116 GLU n 1 117 GLN n 1 118 PHE n 1 119 ASN n 1 120 LEU n 1 121 LYS n 1 122 ASP n 1 123 GLY n 1 124 ASP n 1 125 VAL n 1 126 ILE n 1 127 LYS n 1 128 ILE n 1 129 LEU n 1 130 ILE n 1 131 LYS n 1 132 GLY n 1 133 ASP n 1 134 LYS n 1 135 ASP n 1 136 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Methanocaldococcus _entity_src_gen.pdbx_gene_src_gene Mj0056 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Methanocaldococcus jannaschii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 2190 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET30b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y056_METJA _struct_ref.pdbx_db_accession Q60365 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVKLMIIEGEVVSGLGEGRYFLSLPPYKEIFKKILGFEPYEGTLNLKLDREFDINKFKYIETEDFEFNGKRFFGVKVLPI KILIGNKKIDGAIVVPKKTYHSSEIIEIIAPMKLREQFNLKDGDVIKILIKGDKDE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2P3M _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 136 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q60365 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 136 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 136 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '2D NOESY' 1 2 1 '3D_15N-SEPARATED_ NOESY' 1 3 1 3D_NNH_NOESY 1 4 1 HNHA 1 5 1 HNHB 1 6 1 3D_13C-SEPARATED_NOESY 1 7 1 3D_CNH_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 300 _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.pressure AMBIENT _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength '150 mM' _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents ;0.65 MM MJ0056 UNLABELLED MM PHOSPHATE BUFFER; 150 MM NAC 90% H2O,10% D2O; 0.65 MM MJ0056 U-15N; 30 MM PHOSPHATE BUFFER; 150 MM 90% H2O, 10% D2O; 0.65 MM MJ005 15N,13C; 30 MM PHOSPHATE BUFFER 150 MM NACL ; _pdbx_nmr_sample_details.solvent_system ? # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 DMX Bruker 600 ? 2 AVANCE Bruker 750 ? 3 AVANCE Bruker 900 ? # _pdbx_nmr_refine.entry_id 2P3M _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details 'STRUCTURE SOLVED USING 839, DISTANCE RESTRAINTS, 56 HBOND RESTRAINTS, 399 DIHEDRAL RESTRAINTS AND 180 J-COUPLING RESTRAINTS.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2P3M _pdbx_nmr_details.text 'REPRESENTATIVE CONFORMER IS THE REGULARISED AVERAGE STRUCTURE' # _pdbx_nmr_ensemble.entry_id 2P3M _pdbx_nmr_ensemble.conformers_calculated_total_number 50 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2P3M _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'minimized average structure' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement 'X-PLOR NIH' 2.9.4 BRUNGER 1 'structure solution' XwinNMR 3.1 ? 2 'structure solution' Sparky ? ? 3 'structure solution' 'X-PLOR NIH' 2.9.4 ? 4 # _exptl.entry_id 2P3M _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type ? # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _struct.entry_id 2P3M _struct.title 'Solution structure of Mj0056' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details 'minimized average' # _struct_keywords.entry_id 2P3M _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text 'RIFT barrel, phosphotransferase, riboflavin kinase, TRANSFERASE' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LEU A 24 ? GLY A 36 ? LEU A 24 GLY A 36 1 ? 13 HELX_P HELX_P2 2 ASP A 53 ? PHE A 57 ? ASP A 53 PHE A 57 5 ? 5 HELX_P HELX_P3 3 LYS A 113 ? PHE A 118 ? LYS A 113 PHE A 118 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 8 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? anti-parallel A 7 8 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 60 ? THR A 62 ? ILE A 60 THR A 62 A 2 VAL A 75 ? ILE A 84 ? VAL A 75 ILE A 84 A 3 VAL A 125 ? ILE A 130 ? VAL A 125 ILE A 130 A 4 MET A 5 ? VAL A 12 ? MET A 5 VAL A 12 A 5 LEU A 44 ? LYS A 47 ? LEU A 44 LYS A 47 A 6 ILE A 105 ? ILE A 109 ? ILE A 105 ILE A 109 A 7 LYS A 87 ? PRO A 96 ? LYS A 87 PRO A 96 A 8 VAL A 75 ? ILE A 84 ? VAL A 75 ILE A 84 B 1 PHE A 65 ? PHE A 67 ? PHE A 65 PHE A 67 B 2 LYS A 70 ? PHE A 72 ? LYS A 70 PHE A 72 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 60 ? N ILE A 60 O VAL A 77 ? O VAL A 77 A 2 3 N LEU A 83 ? N LEU A 83 O LYS A 127 ? O LYS A 127 A 3 4 O ILE A 128 ? O ILE A 128 N ILE A 7 ? N ILE A 7 A 4 5 N VAL A 12 ? N VAL A 12 O ASN A 45 ? O ASN A 45 A 5 6 N LEU A 46 ? N LEU A 46 O ILE A 106 ? O ILE A 106 A 6 7 O GLU A 107 ? O GLU A 107 N VAL A 94 ? N VAL A 94 A 7 8 O VAL A 95 ? O VAL A 95 N LYS A 76 ? N LYS A 76 B 1 2 N PHE A 67 ? N PHE A 67 O LYS A 70 ? O LYS A 70 # _database_PDB_matrix.entry_id 2P3M _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2P3M _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 LYS 3 3 3 LYS LYS A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 SER 13 13 13 SER SER A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 GLY 18 18 18 GLY GLY A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 SER 23 23 23 SER SER A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 PHE 31 31 31 PHE PHE A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 LYS 33 33 33 LYS LYS A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 THR 43 43 43 THR THR A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 ARG 50 50 50 ARG ARG A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 ASP 53 53 53 ASP ASP A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ASN 55 55 55 ASN ASN A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 PHE 57 57 57 PHE PHE A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ARG 71 71 71 ARG ARG A . n A 1 72 PHE 72 72 72 PHE PHE A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 ILE 80 80 80 ILE ILE A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ILE 84 84 84 ILE ILE A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 LYS 88 88 88 LYS LYS A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 LYS 97 97 97 LYS LYS A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 TYR 100 100 100 TYR TYR A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 SER 103 103 103 SER SER A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 MET 112 112 112 MET MET A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 LEU 114 114 114 LEU LEU A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 GLN 117 117 117 GLN GLN A . n A 1 118 PHE 118 118 118 PHE PHE A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 ASP 122 122 122 ASP ASP A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ASP 124 124 124 ASP ASP A . n A 1 125 VAL 125 125 125 VAL VAL A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 LYS 131 131 131 LYS LYS A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 ASP 133 133 133 ASP ASP A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 GLU 136 136 136 GLU GLU A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 15 ? ? -155.16 -46.69 2 2 TYR A 100 ? ? -94.90 -60.01 3 3 LEU A 15 ? ? -154.97 -47.45 4 3 PHE A 21 ? ? -148.24 33.67 5 3 LYS A 134 ? ? -154.27 -59.82 6 4 PHE A 21 ? ? -154.81 35.35 7 4 ASP A 133 ? ? -155.04 -60.05 8 5 LEU A 15 ? ? -155.07 -52.57 9 6 LEU A 15 ? ? -143.04 -49.04 10 7 ASP A 133 ? ? -154.99 33.31 11 8 LEU A 15 ? ? -153.55 -60.05 12 9 LEU A 15 ? ? -99.40 30.76 13 10 ASP A 133 ? ? -155.07 78.86 14 11 LEU A 15 ? ? -155.11 -45.69 15 12 GLU A 17 ? ? -163.53 100.50 16 13 GLU A 17 ? ? -99.77 32.48 17 14 LEU A 15 ? ? -155.11 -46.84 18 14 ASP A 135 ? ? -138.34 -48.26 19 15 VAL A 2 ? ? -152.53 68.50 20 15 LEU A 15 ? ? -155.11 -47.80 21 16 ARG A 19 ? ? -141.79 38.69 22 17 GLU A 17 ? ? -99.95 32.64 23 18 SER A 23 ? ? -94.65 31.25 24 19 LYS A 3 ? ? -140.84 50.58 25 20 LEU A 15 ? ? -143.39 -48.68 #