data_2PFC # _entry.id 2PFC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2PFC RCSB RCSB042314 WWPDB D_1000042314 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2PFC _pdbx_database_status.recvd_initial_deposition_date 2007-04-04 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, F.' 1 'Sacchettini, J.C.' 2 # _citation.id primary _citation.title 'Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence.' _citation.journal_abbrev Chem.Biol. _citation.journal_volume 14 _citation.page_first 543 _citation.page_last 551 _citation.year 2007 _citation.journal_id_ASTM CBOLE2 _citation.country UK _citation.journal_id_ISSN 1074-5521 _citation.journal_id_CSD 2050 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17524985 _citation.pdbx_database_id_DOI 10.1016/j.chembiol.2007.04.005 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wang, F.' 1 primary 'Langley, R.' 2 primary 'Gulten, G.' 3 primary 'Wang, L.' 4 primary 'Sacchettini, J.C.' 5 # _cell.entry_id 2PFC _cell.length_a 101.767 _cell.length_b 101.767 _cell.length_c 101.767 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2PFC _symmetry.space_group_name_H-M 'I 21 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 199 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Hypothetical protein Rv0098/MT0107' 20549.479 1 ? ? ? ? 2 non-polymer syn 'PALMITIC ACID' 256.424 1 ? ? ? ? 3 water nat water 18.015 24 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQYSATEDSVLAYGNFTIGESAYIRSTGHFNAVELIL CFNQLAYSAFAPAVLNEEIRVLRGWSIDDYCQHQLSSMLIRKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCV IEFWDENGGAASGEIELAALNIP ; _entity_poly.pdbx_seq_one_letter_code_can ;MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQYSATEDSVLAYGNFTIGESAYIRSTGHFNAVELIL CFNQLAYSAFAPAVLNEEIRVLRGWSIDDYCQHQLSSMLIRKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCV IEFWDENGGAASGEIELAALNIP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 HIS n 1 4 THR n 1 5 ASP n 1 6 LEU n 1 7 THR n 1 8 PRO n 1 9 CYS n 1 10 THR n 1 11 ARG n 1 12 VAL n 1 13 LEU n 1 14 ALA n 1 15 SER n 1 16 SER n 1 17 GLY n 1 18 THR n 1 19 VAL n 1 20 PRO n 1 21 ILE n 1 22 ALA n 1 23 GLU n 1 24 GLU n 1 25 LEU n 1 26 LEU n 1 27 ALA n 1 28 ARG n 1 29 VAL n 1 30 LEU n 1 31 GLU n 1 32 PRO n 1 33 TYR n 1 34 SER n 1 35 CYS n 1 36 LYS n 1 37 GLY n 1 38 CYS n 1 39 ARG n 1 40 TYR n 1 41 LEU n 1 42 ILE n 1 43 ASP n 1 44 ALA n 1 45 GLN n 1 46 TYR n 1 47 SER n 1 48 ALA n 1 49 THR n 1 50 GLU n 1 51 ASP n 1 52 SER n 1 53 VAL n 1 54 LEU n 1 55 ALA n 1 56 TYR n 1 57 GLY n 1 58 ASN n 1 59 PHE n 1 60 THR n 1 61 ILE n 1 62 GLY n 1 63 GLU n 1 64 SER n 1 65 ALA n 1 66 TYR n 1 67 ILE n 1 68 ARG n 1 69 SER n 1 70 THR n 1 71 GLY n 1 72 HIS n 1 73 PHE n 1 74 ASN n 1 75 ALA n 1 76 VAL n 1 77 GLU n 1 78 LEU n 1 79 ILE n 1 80 LEU n 1 81 CYS n 1 82 PHE n 1 83 ASN n 1 84 GLN n 1 85 LEU n 1 86 ALA n 1 87 TYR n 1 88 SER n 1 89 ALA n 1 90 PHE n 1 91 ALA n 1 92 PRO n 1 93 ALA n 1 94 VAL n 1 95 LEU n 1 96 ASN n 1 97 GLU n 1 98 GLU n 1 99 ILE n 1 100 ARG n 1 101 VAL n 1 102 LEU n 1 103 ARG n 1 104 GLY n 1 105 TRP n 1 106 SER n 1 107 ILE n 1 108 ASP n 1 109 ASP n 1 110 TYR n 1 111 CYS n 1 112 GLN n 1 113 HIS n 1 114 GLN n 1 115 LEU n 1 116 SER n 1 117 SER n 1 118 MET n 1 119 LEU n 1 120 ILE n 1 121 ARG n 1 122 LYS n 1 123 ALA n 1 124 SER n 1 125 SER n 1 126 ARG n 1 127 PHE n 1 128 ARG n 1 129 LYS n 1 130 PRO n 1 131 LEU n 1 132 ASN n 1 133 PRO n 1 134 GLN n 1 135 LYS n 1 136 PHE n 1 137 SER n 1 138 ALA n 1 139 ARG n 1 140 LEU n 1 141 LEU n 1 142 CYS n 1 143 ARG n 1 144 ASP n 1 145 LEU n 1 146 GLN n 1 147 VAL n 1 148 ILE n 1 149 GLU n 1 150 ARG n 1 151 THR n 1 152 TRP n 1 153 ARG n 1 154 TYR n 1 155 LEU n 1 156 LYS n 1 157 VAL n 1 158 PRO n 1 159 CYS n 1 160 VAL n 1 161 ILE n 1 162 GLU n 1 163 PHE n 1 164 TRP n 1 165 ASP n 1 166 GLU n 1 167 ASN n 1 168 GLY n 1 169 GLY n 1 170 ALA n 1 171 ALA n 1 172 SER n 1 173 GLY n 1 174 GLU n 1 175 ILE n 1 176 GLU n 1 177 LEU n 1 178 ALA n 1 179 ALA n 1 180 LEU n 1 181 ASN n 1 182 ILE n 1 183 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Mycobacterium _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium tuberculosis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1773 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21DE3 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type pET28b _entity_src_gen.pdbx_host_org_vector plasmid _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y098_MYCTU _struct_ref.pdbx_db_accession P64685 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQYSATEDSVLAYGNFTIGESAYIRSTGHFNAVELIL CFNQLAYSAFAPAVLNEEIRVLRGWSIDDYCQHQLSSMLIRKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCV IEFWDENGGAASGEIELAALNIP ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2PFC _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 183 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P64685 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 183 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 183 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PLM non-polymer . 'PALMITIC ACID' ? 'C16 H32 O2' 256.424 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2PFC _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.14 _exptl_crystal.density_percent_sol 42.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '0.1 M Hepes, 15% isopropanol, 0.2M NaCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 289K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 121 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 23-ID-B _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 2PFC _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 2.19 _reflns.d_resolution_low 41.56 _reflns.number_all ? _reflns.number_obs 7549 _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs 0.081 _reflns.pdbx_Rsym_value 0.084 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 12.2 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.entry_id 2PFC _refine.ls_number_reflns_obs 7549 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 41.56 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 100.00 _refine.ls_R_factor_obs 0.2368 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.23506 _refine.ls_R_factor_R_free 0.27311 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 378 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.940 _refine.correlation_coeff_Fo_to_Fc_free 0.947 _refine.B_iso_mean 53.694 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.415 _refine.pdbx_overall_ESU_R_Free 0.266 _refine.overall_SU_ML 0.210 _refine.overall_SU_B 8.423 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1272 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 14 _refine_hist.number_atoms_solvent 24 _refine_hist.number_atoms_total 1310 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 41.56 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.018 0.022 ? 1313 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 2.131 1.968 ? 1774 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 16.070 5.000 ? 157 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 38.697 23.115 ? 61 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 19.290 15.000 ? 215 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 15.154 15.000 ? 11 'X-RAY DIFFRACTION' ? r_chiral_restr 0.161 0.200 ? 194 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.020 ? 994 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.276 0.200 ? 595 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.321 0.200 ? 870 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.167 0.200 ? 45 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.286 0.200 ? 29 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.152 0.200 ? 3 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.096 1.500 ? 824 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 1.758 2.000 ? 1275 'X-RAY DIFFRACTION' ? r_scbond_it 2.577 3.000 ? 571 'X-RAY DIFFRACTION' ? r_scangle_it 3.873 4.500 ? 499 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.30 _refine_ls_shell.d_res_low 2.362 _refine_ls_shell.number_reflns_R_work 538 _refine_ls_shell.R_factor_R_work 0.271 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.32 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 26 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2PFC _struct.title 'Structure of Mycobacterium tuberculosis Rv0098' _struct.pdbx_descriptor 'Hypothetical protein Rv0098/MT0107' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2PFC _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' _struct_keywords.text 'tuberculosis, thioesterase, virulence, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 24 ? LEU A 30 ? GLU A 24 LEU A 30 1 ? 7 HELX_P HELX_P2 2 LEU A 30 ? CYS A 35 ? LEU A 30 CYS A 35 1 ? 6 HELX_P HELX_P3 3 ASN A 74 ? ASN A 96 ? ASN A 74 ASN A 96 1 ? 23 HELX_P HELX_P4 4 ILE A 99 ? ARG A 103 ? ILE A 99 ARG A 103 5 ? 5 HELX_P HELX_P5 5 SER A 106 ? SER A 117 ? SER A 106 SER A 117 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 142 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 159 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 142 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 159 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.197 _struct_conn.pdbx_value_order ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 173 A . ? GLY 173 A GLU 174 A ? GLU 174 A 1 4.05 2 ILE 182 A . ? ILE 182 A PRO 183 A ? PRO 183 A 1 21.73 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 41 ? ALA A 48 ? LEU A 41 ALA A 48 A 2 VAL A 53 ? PHE A 59 ? VAL A 53 PHE A 59 A 3 PHE A 136 ? CYS A 142 ? PHE A 136 CYS A 142 A 4 TYR A 154 ? TRP A 164 ? TYR A 154 TRP A 164 A 5 ALA A 170 ? ALA A 179 ? ALA A 170 ALA A 179 A 6 ARG A 126 ? PHE A 127 ? ARG A 126 PHE A 127 B 1 MET A 118 ? ALA A 123 ? MET A 118 ALA A 123 B 2 ALA A 170 ? ALA A 179 ? ALA A 170 ALA A 179 B 3 TYR A 154 ? TRP A 164 ? TYR A 154 TRP A 164 B 4 GLN A 146 ? ILE A 148 ? GLN A 146 ILE A 148 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 42 ? N ILE A 42 O ASN A 58 ? O ASN A 58 A 2 3 N PHE A 59 ? N PHE A 59 O PHE A 136 ? O PHE A 136 A 3 4 N LEU A 141 ? N LEU A 141 O VAL A 160 ? O VAL A 160 A 4 5 N ILE A 161 ? N ILE A 161 O GLY A 173 ? O GLY A 173 A 5 6 O SER A 172 ? O SER A 172 N ARG A 126 ? N ARG A 126 B 1 2 N LEU A 119 ? N LEU A 119 O ALA A 178 ? O ALA A 178 B 2 3 O GLY A 173 ? O GLY A 173 N ILE A 161 ? N ILE A 161 B 3 4 O LYS A 156 ? O LYS A 156 N GLN A 146 ? N GLN A 146 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 8 _struct_site.details 'BINDING SITE FOR RESIDUE PLM A 184' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 8 ASN A 83 ? ASN A 83 . ? 1_555 ? 2 AC1 8 TYR A 87 ? TYR A 87 . ? 1_555 ? 3 AC1 8 PHE A 90 ? PHE A 90 . ? 1_555 ? 4 AC1 8 LEU A 102 ? LEU A 102 . ? 1_555 ? 5 AC1 8 ALA A 179 ? ALA A 179 . ? 1_555 ? 6 AC1 8 HOH C . ? HOH A 185 . ? 1_555 ? 7 AC1 8 HOH C . ? HOH A 187 . ? 1_555 ? 8 AC1 8 HOH C . ? HOH A 208 . ? 1_555 ? # _database_PDB_matrix.entry_id 2PFC _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2PFC _atom_sites.fract_transf_matrix[1][1] 0.009826 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009826 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009826 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 HIS 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 ASP 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 THR 7 7 ? ? ? A . n A 1 8 PRO 8 8 ? ? ? A . n A 1 9 CYS 9 9 ? ? ? A . n A 1 10 THR 10 10 ? ? ? A . n A 1 11 ARG 11 11 ? ? ? A . n A 1 12 VAL 12 12 ? ? ? A . n A 1 13 LEU 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 SER 15 15 ? ? ? A . n A 1 16 SER 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 THR 18 18 ? ? ? A . n A 1 19 VAL 19 19 ? ? ? A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 SER 34 34 34 SER SER A . n A 1 35 CYS 35 35 35 CYS CYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 ASP 43 43 43 ASP ASP A . n A 1 44 ALA 44 44 44 ALA ALA A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 TYR 46 46 46 TYR TYR A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 ASN 58 58 58 ASN ASN A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 GLY 62 62 62 GLY GLY A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 TYR 66 66 66 TYR TYR A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 PHE 73 73 73 PHE PHE A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 GLU 77 77 77 GLU GLU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 CYS 81 81 81 CYS CYS A . n A 1 82 PHE 82 82 82 PHE PHE A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 GLN 84 84 84 GLN GLN A . n A 1 85 LEU 85 85 85 LEU LEU A . n A 1 86 ALA 86 86 86 ALA ALA A . n A 1 87 TYR 87 87 87 TYR TYR A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ALA 91 91 91 ALA ALA A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 ARG 100 100 100 ARG ARG A . n A 1 101 VAL 101 101 101 VAL VAL A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 GLY 104 104 104 GLY GLY A . n A 1 105 TRP 105 105 105 TRP TRP A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 CYS 111 111 111 CYS CYS A . n A 1 112 GLN 112 112 112 GLN GLN A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 GLN 114 114 114 GLN GLN A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 SER 117 117 117 SER SER A . n A 1 118 MET 118 118 118 MET MET A . n A 1 119 LEU 119 119 119 LEU LEU A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ARG 121 121 121 ARG ARG A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 ALA 123 123 123 ALA ALA A . n A 1 124 SER 124 124 124 SER SER A . n A 1 125 SER 125 125 125 SER SER A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 LEU 131 131 131 LEU LEU A . n A 1 132 ASN 132 132 132 ASN ASN A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 GLN 134 134 134 GLN GLN A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 PHE 136 136 136 PHE PHE A . n A 1 137 SER 137 137 137 SER SER A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 CYS 142 142 142 CYS CYS A . n A 1 143 ARG 143 143 143 ARG ARG A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLN 146 146 146 GLN GLN A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 GLU 149 149 ? ? ? A . n A 1 150 ARG 150 150 ? ? ? A . n A 1 151 THR 151 151 ? ? ? A . n A 1 152 TRP 152 152 152 TRP TRP A . n A 1 153 ARG 153 153 153 ARG ARG A . n A 1 154 TYR 154 154 154 TYR TYR A . n A 1 155 LEU 155 155 155 LEU LEU A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 PRO 158 158 158 PRO PRO A . n A 1 159 CYS 159 159 159 CYS CYS A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 GLU 162 162 162 GLU GLU A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 TRP 164 164 164 TRP TRP A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 GLU 166 166 ? ? ? A . n A 1 167 ASN 167 167 167 ASN ASN A . n A 1 168 GLY 168 168 168 GLY GLY A . n A 1 169 GLY 169 169 169 GLY GLY A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 ALA 171 171 171 ALA ALA A . n A 1 172 SER 172 172 172 SER SER A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 ALA 178 178 178 ALA ALA A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ASN 181 181 181 ASN ASN A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 PRO 183 183 183 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 PLM 1 184 184 PLM FAT A . C 3 HOH 1 185 185 HOH HOH A . C 3 HOH 2 186 186 HOH HOH A . C 3 HOH 3 187 187 HOH HOH A . C 3 HOH 4 188 188 HOH HOH A . C 3 HOH 5 189 189 HOH HOH A . C 3 HOH 6 190 190 HOH HOH A . C 3 HOH 7 191 191 HOH HOH A . C 3 HOH 8 192 192 HOH HOH A . C 3 HOH 9 193 193 HOH HOH A . C 3 HOH 10 194 194 HOH HOH A . C 3 HOH 11 195 195 HOH HOH A . C 3 HOH 12 196 196 HOH HOH A . C 3 HOH 13 197 197 HOH HOH A . C 3 HOH 14 198 198 HOH HOH A . C 3 HOH 15 199 199 HOH HOH A . C 3 HOH 16 200 200 HOH HOH A . C 3 HOH 17 201 201 HOH HOH A . C 3 HOH 18 202 202 HOH HOH A . C 3 HOH 19 203 203 HOH HOH A . C 3 HOH 20 204 204 HOH HOH A . C 3 HOH 21 205 205 HOH HOH A . C 3 HOH 22 206 206 HOH HOH A . C 3 HOH 23 207 207 HOH HOH A . C 3 HOH 24 208 208 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 14_655 -x+1,-y+1/2,z -1.0000000000 0.0000000000 0.0000000000 101.7670000000 0.0000000000 -1.0000000000 0.0000000000 50.8835000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 189 ? C HOH . 2 1 A HOH 197 ? C HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-08 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 HKL-2000 'data reduction' . ? 2 HKL-2000 'data scaling' . ? 3 SHARP phasing . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A PHE 73 ? ? OE2 A GLU 77 ? ? 2.02 2 1 OD2 A ASP 165 ? ? O A GLY 168 ? ? 2.05 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A LEU 155 ? ? CA A LEU 155 ? ? C A LEU 155 ? ? 130.21 111.00 19.21 2.70 N 2 1 C A GLY 173 ? ? N A GLU 174 ? ? CA A GLU 174 ? ? 140.08 121.70 18.38 2.50 Y 3 1 C A LEU 180 ? ? N A ASN 181 ? ? CA A ASN 181 ? ? 105.73 121.70 -15.97 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 24 ? ? 86.18 -41.59 2 1 CYS A 35 ? ? -67.65 11.39 3 1 ASP A 51 ? ? -146.21 20.65 4 1 GLU A 63 ? ? 171.36 161.26 5 1 ARG A 68 ? ? -41.67 -78.94 6 1 SER A 69 ? ? 173.65 112.79 7 1 ASN A 74 ? ? 73.77 126.13 8 1 ARG A 128 ? ? -104.88 -133.05 9 1 PRO A 130 ? ? -44.62 158.70 10 1 LYS A 135 ? ? -162.51 106.03 11 1 LEU A 155 ? ? -52.68 98.17 12 1 GLU A 174 ? ? 73.47 75.05 13 1 ASN A 181 ? ? -80.55 -109.87 14 1 ILE A 182 ? ? 77.50 142.78 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 TYR A 154 ? ? LEU A 155 ? ? 123.83 2 1 PHE A 163 ? ? TRP A 164 ? ? 128.61 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 N 1 A PLM 184 ? CD ? B PLM 1 CD 2 1 N 1 A PLM 184 ? CE ? B PLM 1 CE 3 1 N 1 A PLM 184 ? CF ? B PLM 1 CF 4 1 N 1 A PLM 184 ? CG ? B PLM 1 CG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A HIS 3 ? A HIS 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A ASP 5 ? A ASP 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A THR 7 ? A THR 7 8 1 Y 1 A PRO 8 ? A PRO 8 9 1 Y 1 A CYS 9 ? A CYS 9 10 1 Y 1 A THR 10 ? A THR 10 11 1 Y 1 A ARG 11 ? A ARG 11 12 1 Y 1 A VAL 12 ? A VAL 12 13 1 Y 1 A LEU 13 ? A LEU 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A SER 15 ? A SER 15 16 1 Y 1 A SER 16 ? A SER 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A THR 18 ? A THR 18 19 1 Y 1 A VAL 19 ? A VAL 19 20 1 Y 1 A GLU 149 ? A GLU 149 21 1 Y 1 A ARG 150 ? A ARG 150 22 1 Y 1 A THR 151 ? A THR 151 23 1 Y 1 A GLU 166 ? A GLU 166 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'PALMITIC ACID' PLM 3 water HOH #