data_2PSR # _entry.id 2PSR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.375 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2PSR pdb_00002psr 10.2210/pdb2psr/pdb WWPDB D_1000178506 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2PSR _pdbx_database_status.recvd_initial_deposition_date 1998-09-17 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Brodersen, D.E.' 1 'Nyborg, J.' 2 'Kjeldgaard, M.' 3 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;Zinc-binding site of an S100 protein revealed. Two crystal structures of Ca2+-bound human psoriasin (S100A7) in the Zn2+-loaded and Zn2+-free states. ; Biochemistry 38 1695 1704 1999 BICHAW US 0006-2960 0033 ? 10026247 10.1021/bi982483d 1 'EF-Hands at Atomic Resolution: The Structure of Human Psoriasin (S100A7) Solved by MAD Phasing' Structure 6 477 ? 1998 STRUE6 UK 0969-2126 2005 ? ? ? 2 'Crystallization and Preliminary X-Ray Diffraction Studies of Psoriasin' 'Acta Crystallogr.,Sect.D' 53 119 ? 1997 ABCRE6 DK 0907-4449 0766 ? ? ? 3 ;Molecular Cloning, Occurrence, and Expression of a Novel Partially Secreted Protein "Psoriasin" that is Highly Up-Regulated in Psoriatic Skin ; J.Invest.Dermatol. 97 701 ? 1991 JIDEAE US 0022-202X 2196 ? ? ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Brodersen, D.E.' 1 ? primary 'Nyborg, J.' 2 ? primary 'Kjeldgaard, M.' 3 ? 1 'Brodersen, D.E.' 4 ? 1 'Etzerodt, M.' 5 ? 1 'Madsen, P.' 6 ? 1 'Celis, J.E.' 7 ? 1 'Thogersen, H.C.' 8 ? 1 'Nyborg, J.' 9 ? 1 'Kjeldgaard, M.' 10 ? 2 'Nolsoe, S.' 11 ? 2 'Thirup, S.' 12 ? 2 'Etzerodt, M.' 13 ? 2 'Thogersen, H.C.' 14 ? 2 'Nyborg, J.' 15 ? 3 'Madsen, P.' 16 ? 3 'Rasmussen, H.H.' 17 ? 3 'Leffers, H.' 18 ? 3 'Honore, B.' 19 ? 3 'Dejgaard, K.' 20 ? 3 'Olsen, E.' 21 ? 3 'Kiil, J.' 22 ? 3 'Walbum, E.' 23 ? 3 'Andersen, A.H.' 24 ? 3 'Basse, B.' 25 ? 3 'Lauridsen, J.B.' 26 ? 3 'Ratz, G.P.' 27 ? 3 'Celis, A.' 28 ? 3 'Vandekerckhove, J.' 29 ? 3 'Celis, J.E.' 30 ? # _cell.entry_id 2PSR _cell.length_a 51.958 _cell.length_b 51.958 _cell.length_c 116.027 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2PSR _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man PSORIASIN 11343.784 1 ? ? ? 'CA2+ AND ZN2+ BOUND FORM' 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 106 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name S100A7 # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGD IATDYHKQSHGAAPCSGGSQ ; _entity_poly.pdbx_seq_one_letter_code_can ;SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGD IATDYHKQSHGAAPCSGGSQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 THR n 1 4 GLN n 1 5 ALA n 1 6 GLU n 1 7 ARG n 1 8 SER n 1 9 ILE n 1 10 ILE n 1 11 GLY n 1 12 MET n 1 13 ILE n 1 14 ASP n 1 15 MET n 1 16 PHE n 1 17 HIS n 1 18 LYS n 1 19 TYR n 1 20 THR n 1 21 ARG n 1 22 ARG n 1 23 ASP n 1 24 ASP n 1 25 LYS n 1 26 ILE n 1 27 ASP n 1 28 LYS n 1 29 PRO n 1 30 SER n 1 31 LEU n 1 32 LEU n 1 33 THR n 1 34 MET n 1 35 MET n 1 36 LYS n 1 37 GLU n 1 38 ASN n 1 39 PHE n 1 40 PRO n 1 41 ASN n 1 42 PHE n 1 43 LEU n 1 44 SER n 1 45 ALA n 1 46 CYS n 1 47 ASP n 1 48 LYS n 1 49 LYS n 1 50 GLY n 1 51 THR n 1 52 ASN n 1 53 TYR n 1 54 LEU n 1 55 ALA n 1 56 ASP n 1 57 VAL n 1 58 PHE n 1 59 GLU n 1 60 LYS n 1 61 LYS n 1 62 ASP n 1 63 LYS n 1 64 ASN n 1 65 GLU n 1 66 ASP n 1 67 LYS n 1 68 LYS n 1 69 ILE n 1 70 ASP n 1 71 PHE n 1 72 SER n 1 73 GLU n 1 74 PHE n 1 75 LEU n 1 76 SER n 1 77 LEU n 1 78 LEU n 1 79 GLY n 1 80 ASP n 1 81 ILE n 1 82 ALA n 1 83 THR n 1 84 ASP n 1 85 TYR n 1 86 HIS n 1 87 LYS n 1 88 GLN n 1 89 SER n 1 90 HIS n 1 91 GLY n 1 92 ALA n 1 93 ALA n 1 94 PRO n 1 95 CYS n 1 96 SER n 1 97 GLY n 1 98 GLY n 1 99 SER n 1 100 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell KERATINOCYTES _entity_src_gen.pdbx_gene_src_cellular_location 'CYTOPLASMIC, OR MAY BE SECRETED BY A NON-CLASSICAL SECRETORY PATHWAY' _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PT7H6FX-PS.4 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code S10A7_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P31151 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;SNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGD IATDYHKQSHGAAPCSGGSQ ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2PSR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 100 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P31151 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 100 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 100 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 2PSR _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.06 _exptl_crystal.density_percent_sol 59.7 _exptl_crystal.description ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.7 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details 'pH 6.7' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type MARRESEARCH _diffrn_detector.pdbx_collection_date 1995-09 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.862 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'EMBL/DESY, HAMBURG BEAMLINE BW7B' _diffrn_source.pdbx_synchrotron_site 'EMBL/DESY, HAMBURG' _diffrn_source.pdbx_synchrotron_beamline BW7B _diffrn_source.pdbx_wavelength 0.862 _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 2PSR _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.1 _reflns.d_resolution_high 2.05 _reflns.number_obs 10791 _reflns.number_all ? _reflns.percent_possible_obs 98.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value 0.113 _reflns.pdbx_netI_over_sigmaI 15.9 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 7.0 _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.05 _reflns_shell.d_res_low 2.12 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value 0.423 _reflns_shell.meanI_over_sigI_obs 5.0 _reflns_shell.pdbx_redundancy 6.9 _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 2PSR _refine.ls_number_reflns_obs ? _refine.ls_number_reflns_all 10777 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 100.00 _refine.ls_d_res_high 2.05 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.2146 _refine.ls_R_factor_all 0.2165 _refine.ls_R_factor_R_work ? _refine.ls_R_factor_R_free 0.2645 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 541 _refine.ls_number_parameters 3513 _refine.ls_number_restraints 3122 _refine.occupancy_min ? _refine.occupancy_max ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'MOEWS & KRETSINGER, J.MOL.BIOL. 91(1973) 201-228' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_ls_cross_valid_method 'FREE R' _refine.details ? _refine.pdbx_starting_model 1PSR _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'ENGH AND HUBER' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2PSR _refine_analyze.Luzzati_coordinate_error_obs ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues 0 _refine_analyze.occupancy_sum_hydrogen 0.00 _refine_analyze.occupancy_sum_non_hydrogen 876.89 _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 769 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 106 _refine_hist.number_atoms_total 877 _refine_hist.d_res_high 2.05 _refine_hist.d_res_low 100.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function s_bond_d 0.005 ? ? ? 'X-RAY DIFFRACTION' ? s_angle_d 0.019 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_dist 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_from_restr_planes 0.313 ? ? ? 'X-RAY DIFFRACTION' ? s_zero_chiral_vol 0.027 ? ? ? 'X-RAY DIFFRACTION' ? s_non_zero_chiral_vol 0.034 ? ? ? 'X-RAY DIFFRACTION' ? s_anti_bump_dis_restr 0.006 ? ? ? 'X-RAY DIFFRACTION' ? s_rigid_bond_adp_cmpnt 0.000 ? ? ? 'X-RAY DIFFRACTION' ? s_similar_adp_cmpnt 0.077 ? ? ? 'X-RAY DIFFRACTION' ? s_approx_iso_adps 0.000 ? ? ? 'X-RAY DIFFRACTION' ? # _pdbx_refine.entry_id 2PSR _pdbx_refine.R_factor_all_no_cutoff 0.2165 _pdbx_refine.R_factor_obs_no_cutoff 0.2146 _pdbx_refine.free_R_factor_no_cutoff 0.2645 _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff 5.0 _pdbx_refine.free_R_val_test_set_ct_no_cutoff 541 _pdbx_refine.R_factor_all_4sig_cutoff 0.1983 _pdbx_refine.R_factor_obs_4sig_cutoff 0.1963 _pdbx_refine.free_R_factor_4sig_cutoff 0.2455 _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff 5.3 _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff 456 _pdbx_refine.number_reflns_obs_4sig_cutoff 9118 _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.free_R_error_no_cutoff ? # _struct.entry_id 2PSR _struct.title 'HUMAN PSORIASIN (S100A7) CA2+ AND ZN2+ BOUND FORM (CRYSTAL FORM II)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2PSR _struct_keywords.pdbx_keywords 'EF-HAND PROTEIN' _struct_keywords.text 'CA-BINDING, ZN-BINDING, PSORIASIS, S100 PROTEIN FAMILY, EF-HAND PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 A1 GLN A 4 ? LYS A 18 ? GLN A 4 LYS A 18 1 ? 15 HELX_P HELX_P2 A2 LYS A 28 ? PHE A 39 ? LYS A 28 PHE A 39 1 ? 12 HELX_P HELX_P3 "A2'" ASN A 41 ? LYS A 48 ? ASN A 41 LYS A 48 1 ? 8 HELX_P HELX_P4 A3 TYR A 53 ? LYS A 61 ? TYR A 53 LYS A 61 1 ? 9 HELX_P HELX_P5 A4 PHE A 71 ? HIS A 90 ? PHE A 71 HIS A 90 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 46 SG ? ? ? 1_555 A CYS 95 SG ? ? A CYS 46 A CYS 95 1_555 ? ? ? ? ? ? ? 2.030 ? ? metalc1 metalc ? ? A HIS 17 NE2 ? ? ? 7_555 C ZN . ZN ? ? A HIS 17 A ZN 103 1_555 ? ? ? ? ? ? ? 1.908 ? ? metalc2 metalc ? ? A ASP 24 OD1 ? ? ? 7_555 C ZN . ZN ? ? A ASP 24 A ZN 103 1_555 ? ? ? ? ? ? ? 2.147 ? ? metalc3 metalc ? ? A ASP 24 OD2 ? ? ? 7_555 C ZN . ZN ? ? A ASP 24 A ZN 103 1_555 ? ? ? ? ? ? ? 2.493 ? ? metalc4 metalc ? ? A ASP 62 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 62 A CA 102 1_555 ? ? ? ? ? ? ? 2.421 ? ? metalc5 metalc ? ? A ASN 64 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 64 A CA 102 1_555 ? ? ? ? ? ? ? 2.187 ? ? metalc6 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 66 A CA 102 1_555 ? ? ? ? ? ? ? 2.447 ? ? metalc7 metalc ? ? A LYS 68 O ? ? ? 1_555 B CA . CA ? ? A LYS 68 A CA 102 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc8 metalc ? ? A GLU 73 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 73 A CA 102 1_555 ? ? ? ? ? ? ? 2.491 ? ? metalc9 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 73 A CA 102 1_555 ? ? ? ? ? ? ? 2.560 ? ? metalc10 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 86 A ZN 103 1_555 ? ? ? ? ? ? ? 2.061 ? ? metalc11 metalc ? ? A HIS 90 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 90 A ZN 103 1_555 ? ? ? ? ? ? ? 1.931 ? ? metalc12 metalc ? ? B CA . CA ? ? ? 1_555 D HOH . O ? ? A CA 102 A HOH 306 1_555 ? ? ? ? ? ? ? 2.228 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 26 ? ASP A 27 ? ILE A 26 ASP A 27 A 2 LYS A 68 ? ILE A 69 ? LYS A 68 ILE A 69 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id O _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 26 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id O _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 26 _pdbx_struct_sheet_hbond.range_2_label_atom_id N _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 69 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id N _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 69 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details CAA Unknown ? ? ? ? 5 'REGULATORY CA2+ BINDING SITE' ZNA Unknown ? ? ? ? 4 'ZN2+ BINDING SITE' AC1 Software A CA 102 ? 6 'BINDING SITE FOR RESIDUE CA A 102' AC2 Software A ZN 103 ? 4 'BINDING SITE FOR RESIDUE ZN A 103' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 CAA 5 ASP A 62 ? ASP A 62 . ? 1_555 ? 2 CAA 5 ASN A 64 ? ASN A 64 . ? 1_555 ? 3 CAA 5 ASP A 66 ? ASP A 66 . ? 1_555 ? 4 CAA 5 LYS A 68 ? LYS A 68 . ? 1_555 ? 5 CAA 5 GLU A 73 ? GLU A 73 . ? 1_555 ? 6 ZNA 4 HIS A 17 ? HIS A 17 . ? 1_555 ? 7 ZNA 4 ASP A 24 ? ASP A 24 . ? 1_555 ? 8 ZNA 4 HIS A 86 ? HIS A 86 . ? 1_555 ? 9 ZNA 4 HIS A 90 ? HIS A 90 . ? 1_555 ? 10 AC1 6 ASP A 62 ? ASP A 62 . ? 1_555 ? 11 AC1 6 ASN A 64 ? ASN A 64 . ? 1_555 ? 12 AC1 6 ASP A 66 ? ASP A 66 . ? 1_555 ? 13 AC1 6 LYS A 68 ? LYS A 68 . ? 1_555 ? 14 AC1 6 GLU A 73 ? GLU A 73 . ? 1_555 ? 15 AC1 6 HOH D . ? HOH A 306 . ? 1_555 ? 16 AC2 4 HIS A 17 ? HIS A 17 . ? 7_555 ? 17 AC2 4 ASP A 24 ? ASP A 24 . ? 7_555 ? 18 AC2 4 HIS A 86 ? HIS A 86 . ? 1_555 ? 19 AC2 4 HIS A 90 ? HIS A 90 . ? 1_555 ? # _database_PDB_matrix.entry_id 2PSR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2PSR _atom_sites.fract_transf_matrix[1][1] 0.019246 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019246 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008619 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 1 SER SER A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLN 4 4 4 GLN GLN A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 ARG 7 7 7 ARG ARG A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 MET 12 12 12 MET MET A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 MET 15 15 15 MET MET A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 HIS 17 17 17 HIS HIS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 TYR 19 19 19 TYR TYR A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 MET 35 35 35 MET MET A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ASN 38 38 38 ASN ASN A . n A 1 39 PHE 39 39 39 PHE PHE A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 PHE 42 42 42 PHE PHE A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 LYS 67 67 67 LYS LYS A . n A 1 68 LYS 68 68 68 LYS LYS A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 GLU 73 73 73 GLU GLU A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 SER 76 76 76 SER SER A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 HIS 90 90 90 HIS HIS A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 PRO 94 94 94 PRO PRO A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 GLY 97 97 ? ? ? A . n A 1 98 GLY 98 98 ? ? ? A . n A 1 99 SER 99 99 ? ? ? A . n A 1 100 GLN 100 100 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 102 102 CA CA A . C 3 ZN 1 103 103 ZN ZN A . D 4 HOH 1 201 201 HOH HOH A . D 4 HOH 2 202 202 HOH HOH A . D 4 HOH 3 203 203 HOH HOH A . D 4 HOH 4 204 204 HOH HOH A . D 4 HOH 5 205 205 HOH HOH A . D 4 HOH 6 206 206 HOH HOH A . D 4 HOH 7 207 207 HOH HOH A . D 4 HOH 8 208 208 HOH HOH A . D 4 HOH 9 209 209 HOH HOH A . D 4 HOH 10 210 210 HOH HOH A . D 4 HOH 11 211 211 HOH HOH A . D 4 HOH 12 212 212 HOH HOH A . D 4 HOH 13 213 213 HOH HOH A . D 4 HOH 14 214 214 HOH HOH A . D 4 HOH 15 215 215 HOH HOH A . D 4 HOH 16 216 216 HOH HOH A . D 4 HOH 17 217 217 HOH HOH A . D 4 HOH 18 218 218 HOH HOH A . D 4 HOH 19 219 219 HOH HOH A . D 4 HOH 20 220 220 HOH HOH A . D 4 HOH 21 221 221 HOH HOH A . D 4 HOH 22 222 222 HOH HOH A . D 4 HOH 23 223 223 HOH HOH A . D 4 HOH 24 224 224 HOH HOH A . D 4 HOH 25 225 225 HOH HOH A . D 4 HOH 26 226 226 HOH HOH A . D 4 HOH 27 227 227 HOH HOH A . D 4 HOH 28 228 228 HOH HOH A . D 4 HOH 29 229 229 HOH HOH A . D 4 HOH 30 230 230 HOH HOH A . D 4 HOH 31 231 231 HOH HOH A . D 4 HOH 32 232 232 HOH HOH A . D 4 HOH 33 233 233 HOH HOH A . D 4 HOH 34 234 234 HOH HOH A . D 4 HOH 35 235 235 HOH HOH A . D 4 HOH 36 236 236 HOH HOH A . D 4 HOH 37 237 237 HOH HOH A . D 4 HOH 38 238 238 HOH HOH A . D 4 HOH 39 239 239 HOH HOH A . D 4 HOH 40 240 240 HOH HOH A . D 4 HOH 41 241 241 HOH HOH A . D 4 HOH 42 242 242 HOH HOH A . D 4 HOH 43 243 243 HOH HOH A . D 4 HOH 44 244 244 HOH HOH A . D 4 HOH 45 245 245 HOH HOH A . D 4 HOH 46 246 246 HOH HOH A . D 4 HOH 47 247 247 HOH HOH A . D 4 HOH 48 248 248 HOH HOH A . D 4 HOH 49 249 249 HOH HOH A . D 4 HOH 50 250 250 HOH HOH A . D 4 HOH 51 251 251 HOH HOH A . D 4 HOH 52 252 252 HOH HOH A . D 4 HOH 53 253 253 HOH HOH A . D 4 HOH 54 254 254 HOH HOH A . D 4 HOH 55 255 255 HOH HOH A . D 4 HOH 56 256 256 HOH HOH A . D 4 HOH 57 257 257 HOH HOH A . D 4 HOH 58 258 258 HOH HOH A . D 4 HOH 59 259 259 HOH HOH A . D 4 HOH 60 260 260 HOH HOH A . D 4 HOH 61 261 261 HOH HOH A . D 4 HOH 62 262 262 HOH HOH A . D 4 HOH 63 263 263 HOH HOH A . D 4 HOH 64 264 264 HOH HOH A . D 4 HOH 65 265 265 HOH HOH A . D 4 HOH 66 266 266 HOH HOH A . D 4 HOH 67 267 267 HOH HOH A . D 4 HOH 68 268 268 HOH HOH A . D 4 HOH 69 269 269 HOH HOH A . D 4 HOH 70 270 270 HOH HOH A . D 4 HOH 71 271 271 HOH HOH A . D 4 HOH 72 272 272 HOH HOH A . D 4 HOH 73 273 273 HOH HOH A . D 4 HOH 74 274 274 HOH HOH A . D 4 HOH 75 275 275 HOH HOH A . D 4 HOH 76 276 276 HOH HOH A . D 4 HOH 77 277 277 HOH HOH A . D 4 HOH 78 278 278 HOH HOH A . D 4 HOH 79 279 279 HOH HOH A . D 4 HOH 80 280 280 HOH HOH A . D 4 HOH 81 281 281 HOH HOH A . D 4 HOH 82 282 282 HOH HOH A . D 4 HOH 83 283 283 HOH HOH A . D 4 HOH 84 284 284 HOH HOH A . D 4 HOH 85 285 285 HOH HOH A . D 4 HOH 86 286 286 HOH HOH A . D 4 HOH 87 287 287 HOH HOH A . D 4 HOH 88 288 288 HOH HOH A . D 4 HOH 89 289 289 HOH HOH A . D 4 HOH 90 290 290 HOH HOH A . D 4 HOH 91 291 291 HOH HOH A . D 4 HOH 92 292 292 HOH HOH A . D 4 HOH 93 293 293 HOH HOH A . D 4 HOH 94 294 294 HOH HOH A . D 4 HOH 95 295 295 HOH HOH A . D 4 HOH 96 296 296 HOH HOH A . D 4 HOH 97 297 297 HOH HOH A . D 4 HOH 98 298 298 HOH HOH A . D 4 HOH 99 299 299 HOH HOH A . D 4 HOH 100 300 300 HOH HOH A . D 4 HOH 101 301 301 HOH HOH A . D 4 HOH 102 302 302 HOH HOH A . D 4 HOH 103 303 303 HOH HOH A . D 4 HOH 104 304 304 HOH HOH A . D 4 HOH 105 305 305 HOH HOH A . D 4 HOH 106 306 306 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA,PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2820 ? 1 MORE -117 ? 1 'SSA (A^2)' 10020 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 17 ? A HIS 17 ? 7_555 ZN ? C ZN . ? A ZN 103 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 7_555 95.7 ? 2 NE2 ? A HIS 17 ? A HIS 17 ? 7_555 ZN ? C ZN . ? A ZN 103 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 7_555 149.4 ? 3 OD1 ? A ASP 24 ? A ASP 24 ? 7_555 ZN ? C ZN . ? A ZN 103 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 7_555 55.2 ? 4 NE2 ? A HIS 17 ? A HIS 17 ? 7_555 ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 108.8 ? 5 OD1 ? A ASP 24 ? A ASP 24 ? 7_555 ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 128.7 ? 6 OD2 ? A ASP 24 ? A ASP 24 ? 7_555 ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 86.9 ? 7 NE2 ? A HIS 17 ? A HIS 17 ? 7_555 ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 90 ? A HIS 90 ? 1_555 109.4 ? 8 OD1 ? A ASP 24 ? A ASP 24 ? 7_555 ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 90 ? A HIS 90 ? 1_555 102.8 ? 9 OD2 ? A ASP 24 ? A ASP 24 ? 7_555 ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 90 ? A HIS 90 ? 1_555 88.4 ? 10 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 ZN ? C ZN . ? A ZN 103 ? 1_555 NE2 ? A HIS 90 ? A HIS 90 ? 1_555 109.8 ? 11 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OD1 ? A ASN 64 ? A ASN 64 ? 1_555 79.8 ? 12 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 81.9 ? 13 OD1 ? A ASN 64 ? A ASN 64 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 80.2 ? 14 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 O ? A LYS 68 ? A LYS 68 ? 1_555 83.3 ? 15 OD1 ? A ASN 64 ? A ASN 64 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 O ? A LYS 68 ? A LYS 68 ? 1_555 156.5 ? 16 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 O ? A LYS 68 ? A LYS 68 ? 1_555 81.4 ? 17 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 113.7 ? 18 OD1 ? A ASN 64 ? A ASN 64 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 125.2 ? 19 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 151.0 ? 20 O ? A LYS 68 ? A LYS 68 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 76.7 ? 21 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 97.2 ? 22 OD1 ? A ASN 64 ? A ASN 64 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 75.4 ? 23 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 155.4 ? 24 O ? A LYS 68 ? A LYS 68 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 123.1 ? 25 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 51.0 ? 26 OD1 ? A ASP 62 ? A ASP 62 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 O ? D HOH . ? A HOH 306 ? 1_555 161.9 ? 27 OD1 ? A ASN 64 ? A ASN 64 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 O ? D HOH . ? A HOH 306 ? 1_555 93.4 ? 28 OD1 ? A ASP 66 ? A ASP 66 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 O ? D HOH . ? A HOH 306 ? 1_555 80.4 ? 29 O ? A LYS 68 ? A LYS 68 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 O ? D HOH . ? A HOH 306 ? 1_555 97.8 ? 30 OE1 ? A GLU 73 ? A GLU 73 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 O ? D HOH . ? A HOH 306 ? 1_555 83.9 ? 31 OE2 ? A GLU 73 ? A GLU 73 ? 1_555 CA ? B CA . ? A CA 102 ? 1_555 O ? D HOH . ? A HOH 306 ? 1_555 97.3 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-06-15 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2023-08-09 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Version format compliance' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' diffrn_source 3 4 'Structure model' pdbx_initial_refinement_model 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' struct_conn 6 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_symmetry' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_symmetry' 22 4 'Structure model' '_pdbx_struct_conn_angle.value' 23 4 'Structure model' '_struct_conn.pdbx_dist_value' 24 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 25 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 26 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 27 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 29 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 30 4 'Structure model' '_struct_conn.ptnr1_symmetry' 31 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 32 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 33 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 35 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 36 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 37 4 'Structure model' '_struct_conn.ptnr2_symmetry' 38 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 39 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 40 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal DENZO 'data reduction' . ? 1 SCALEPACK 'data scaling' . ? 2 AMoRE phasing . ? 3 SHELXL-97 refinement . ? 4 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id GLU _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 73 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.073 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 97 ? A GLY 97 2 1 Y 1 A GLY 98 ? A GLY 98 3 1 Y 1 A SER 99 ? A SER 99 4 1 Y 1 A GLN 100 ? A GLN 100 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'ZINC ION' ZN 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1PSR _pdbx_initial_refinement_model.details ? #