data_2PXT # _entry.id 2PXT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.350 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2PXT pdb_00002pxt 10.2210/pdb2pxt/pdb NDB PR0282 ? ? RCSB RCSB042900 ? ? WWPDB D_1000042900 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 1DUL _pdbx_database_related.details 'Original structure solved by Batey, et al.' _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2PXT _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-05-14 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Keel, A.Y.' 1 'Rambo, R.P.' 2 'Batey, R.T.' 3 'Kieft, J.S.' 4 # _citation.id primary _citation.title 'A General Strategy to Solve the Phase Problem in RNA Crystallography.' _citation.journal_abbrev Structure _citation.journal_volume 15 _citation.page_first 761 _citation.page_last 772 _citation.year 2007 _citation.journal_id_ASTM STRUE6 _citation.country UK _citation.journal_id_ISSN 0969-2126 _citation.journal_id_CSD 2005 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17637337 _citation.pdbx_database_id_DOI 10.1016/j.str.2007.06.003 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Keel, A.Y.' 1 ? primary 'Rambo, R.P.' 2 ? primary 'Batey, R.T.' 3 ? primary 'Kieft, J.S.' 4 ? # _cell.length_a 134.380 _cell.length_b 78.520 _cell.length_c 32.600 _cell.angle_alpha 90.000 _cell.angle_beta 94.990 _cell.angle_gamma 90.000 _cell.entry_id 2PXT _cell.pdbx_unique_axis ? _cell.Z_PDB 4 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.entry_id 2PXT _symmetry.Int_Tables_number 5 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn '4.5 S RNA' 15884.532 1 ? 'C132U, U133G, A175C' 'DOMAIN IV' ? 2 polymer man 'Signal recognition particle protein' 12336.646 1 ? ? 'C TERMINAL DOMAIN (RESIDUES 328-432)' ? 3 non-polymer syn 'COBALT HEXAMMINE(III)' 161.116 8 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'Fifty-four homolog, p48' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 polyribonucleotide no no GCUGCUGUUUACCAGGUCAGGUCCGAAAGGAAGCAGCCAAGGCAGCGGC GCUGCUGUUUACCAGGUCAGGUCCGAAAGGAAGCAGCCAAGGCAGCGGC B ? 2 'polypeptide(L)' no yes ;FDLNDFLEQLRQMKN(MSE)GG(MSE)ASL(MSE)GKLPG(MSE)GQIPDNVKSQ(MSE)DDKVLVR(MSE)EAIINS (MSE)T(MSE)KERAKPEIIKGSRKRRIAAGSG(MSE)QVQDVNRLLKQFDD(MSE)QR(MSE)(MSE)KK(MSE) ; ;FDLNDFLEQLRQMKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGM QVQDVNRLLKQFDDMQRMMKKM ; A ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 G n 1 2 C n 1 3 U n 1 4 G n 1 5 C n 1 6 U n 1 7 G n 1 8 U n 1 9 U n 1 10 U n 1 11 A n 1 12 C n 1 13 C n 1 14 A n 1 15 G n 1 16 G n 1 17 U n 1 18 C n 1 19 A n 1 20 G n 1 21 G n 1 22 U n 1 23 C n 1 24 C n 1 25 G n 1 26 A n 1 27 A n 1 28 A n 1 29 G n 1 30 G n 1 31 A n 1 32 A n 1 33 G n 1 34 C n 1 35 A n 1 36 G n 1 37 C n 1 38 C n 1 39 A n 1 40 A n 1 41 G n 1 42 G n 1 43 C n 1 44 A n 1 45 G n 1 46 C n 1 47 G n 1 48 G n 1 49 C n 2 1 PHE n 2 2 ASP n 2 3 LEU n 2 4 ASN n 2 5 ASP n 2 6 PHE n 2 7 LEU n 2 8 GLU n 2 9 GLN n 2 10 LEU n 2 11 ARG n 2 12 GLN n 2 13 MET n 2 14 LYS n 2 15 ASN n 2 16 MSE n 2 17 GLY n 2 18 GLY n 2 19 MSE n 2 20 ALA n 2 21 SER n 2 22 LEU n 2 23 MSE n 2 24 GLY n 2 25 LYS n 2 26 LEU n 2 27 PRO n 2 28 GLY n 2 29 MSE n 2 30 GLY n 2 31 GLN n 2 32 ILE n 2 33 PRO n 2 34 ASP n 2 35 ASN n 2 36 VAL n 2 37 LYS n 2 38 SER n 2 39 GLN n 2 40 MSE n 2 41 ASP n 2 42 ASP n 2 43 LYS n 2 44 VAL n 2 45 LEU n 2 46 VAL n 2 47 ARG n 2 48 MSE n 2 49 GLU n 2 50 ALA n 2 51 ILE n 2 52 ILE n 2 53 ASN n 2 54 SER n 2 55 MSE n 2 56 THR n 2 57 MSE n 2 58 LYS n 2 59 GLU n 2 60 ARG n 2 61 ALA n 2 62 LYS n 2 63 PRO n 2 64 GLU n 2 65 ILE n 2 66 ILE n 2 67 LYS n 2 68 GLY n 2 69 SER n 2 70 ARG n 2 71 LYS n 2 72 ARG n 2 73 ARG n 2 74 ILE n 2 75 ALA n 2 76 ALA n 2 77 GLY n 2 78 SER n 2 79 GLY n 2 80 MSE n 2 81 GLN n 2 82 VAL n 2 83 GLN n 2 84 ASP n 2 85 VAL n 2 86 ASN n 2 87 ARG n 2 88 LEU n 2 89 LEU n 2 90 LYS n 2 91 GLN n 2 92 PHE n 2 93 ASP n 2 94 ASP n 2 95 MSE n 2 96 GLN n 2 97 ARG n 2 98 MSE n 2 99 MSE n 2 100 LYS n 2 101 LYS n 2 102 MSE n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Escherichia _entity_src_gen.pdbx_gene_src_gene ffh _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 562 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(pLysS)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific ? _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id ? _pdbx_entity_src_syn.details synthetic # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP SRP54_ECOLI P0AGD7 2 ;FDLNDFLEQLRQMKNMGGMASLMGKLPGMGQIPDNVKSQMDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGCGM QVQDVNRLLKQFDDMQRMMKKM ; 329 ? 2 PDB 2PXT 2PXT 1 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2PXT A 1 ? 102 ? P0AGD7 329 ? 430 ? 1 82 2 2 2PXT B 1 ? 49 ? 2PXT 130 ? 178 ? 130 178 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2PXT MSE A 16 G UNP P0AGD7 MET 344 'modified residue' 9 1 1 2PXT MSE A 19 J UNP P0AGD7 MET 347 'modified residue' 9 2 1 2PXT MSE A 23 N UNP P0AGD7 MET 351 'modified residue' 9 3 1 2PXT MSE A 29 T UNP P0AGD7 MET 357 'modified residue' 9 4 1 2PXT MSE A 40 E UNP P0AGD7 MET 368 'modified residue' 10 5 1 2PXT MSE A 48 ? UNP P0AGD7 MET 376 'modified residue' 28 6 1 2PXT MSE A 55 ? UNP P0AGD7 MET 383 'modified residue' 35 7 1 2PXT MSE A 57 ? UNP P0AGD7 MET 385 'modified residue' 37 8 1 2PXT SER A 78 ? UNP P0AGD7 CYS 406 'engineered mutation' 58 9 1 2PXT MSE A 80 ? UNP P0AGD7 MET 408 'modified residue' 60 10 1 2PXT MSE A 95 ? UNP P0AGD7 MET 423 'modified residue' 75 11 1 2PXT MSE A 98 ? UNP P0AGD7 MET 426 'modified residue' 78 12 1 2PXT MSE A 99 ? UNP P0AGD7 MET 427 'modified residue' 79 13 1 2PXT MSE A 102 ? UNP P0AGD7 MET 430 'modified residue' 82 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 NCO non-polymer . 'COBALT HEXAMMINE(III)' ? 'Co H18 N6 3' 161.116 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 2PXT _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.04 _exptl_crystal.density_percent_sol 59.48 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.pdbx_details '20Mm NaOH-MES pH 5.6, 200mM KCl, 10% Isopropanol, 5mM Cobalt Hexamine, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range . # loop_ _exptl_crystal_grow_comp.crystal_id _exptl_crystal_grow_comp.id _exptl_crystal_grow_comp.sol_id _exptl_crystal_grow_comp.name _exptl_crystal_grow_comp.conc _exptl_crystal_grow_comp.volume _exptl_crystal_grow_comp.details 1 1 1 NaOH-MES ? ? ? 1 2 1 KCl ? ? ? 1 3 1 Isopropanol ? ? ? 1 4 1 'Cobalt Hexamine' ? ? ? 1 5 1 H2O ? ? ? 1 6 2 NaOH-MES ? ? ? 1 7 2 KCl ? ? ? 1 8 2 Isopropanol ? ? ? 1 9 2 'Cobalt Hexamine' ? ? ? # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 ? ? 1 2 ? ? 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'RIGAKU RAXIS' _diffrn_detector.pdbx_collection_date 2006-07-11 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.5418 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type RIGAKU _diffrn_source.pdbx_wavelength_list 1.5418 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? # _reflns.entry_id 2PXT _reflns.d_resolution_high 1.650 _reflns.d_resolution_low 39.260 _reflns.number_obs 29971 _reflns.pdbx_scaling_rejects 1445 _reflns.pdbx_Rmerge_I_obs 0.085 _reflns.pdbx_netI_over_sigmaI 8.900 _reflns.pdbx_chi_squared 0.970 _reflns.pdbx_redundancy 6.380 _reflns.percent_possible_obs 73.700 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal 1.65 1.71 ? 142 ? 0.357 2.4 ? 1.080 1.69 ? 84 2.10 ? 1 1.71 1.78 ? 2741 ? 0.419 2.8 ? 0.870 3.35 ? 818 20.30 ? 2 1.78 1.86 ? 6605 ? 0.445 2.8 ? 0.880 3.70 ? 1783 44.10 ? 3 1.86 1.96 ? 12480 ? 0.462 2.9 ? 0.860 4.20 ? 2968 72.90 ? 4 1.96 2.08 ? 22828 ? 0.516 3.1 ? 0.890 5.86 ? 3895 96.60 ? 5 2.08 2.24 ? 28243 ? 0.516 3.4 ? 0.900 6.94 ? 4071 100.00 ? 6 2.24 2.46 ? 28902 ? 0.455 4.2 ? 1.020 7.12 ? 4054 100.00 ? 7 2.46 2.82 ? 29713 ? 0.317 5.5 ? 1.030 7.27 ? 4071 100.00 ? 8 2.82 3.55 ? 30130 ? 0.090 12.3 ? 1.000 7.28 ? 4099 100.00 ? 9 3.55 39.26 ? 30878 ? 0.051 27.6 ? 1.050 7.25 ? 4128 99.90 ? 10 # _refine.entry_id 2PXT _refine.ls_d_res_high 2.500 _refine.ls_d_res_low 50.000 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 99.800 _refine.ls_number_reflns_obs 22888 _refine.ls_R_factor_R_work 0.2231 _refine.ls_R_factor_R_free 0.2454 _refine.ls_percent_reflns_R_free 9.800 _refine.ls_number_reflns_R_free 2246 _refine.B_iso_mean 59.148 _refine.solvent_model_param_bsol 65.040 _refine.aniso_B[1][1] 7.287 _refine.aniso_B[2][2] -16.022 _refine.aniso_B[3][3] 8.736 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] 6.354 _refine.aniso_B[2][3] 0.000 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs ? _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values ? _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.details ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 533 _refine_hist.pdbx_number_atoms_nucleic_acid 1052 _refine_hist.pdbx_number_atoms_ligand 56 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1641 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 50.000 # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 CNS_TOPPAR:protein_rep.param ? 'X-RAY DIFFRACTION' 2 CNS_TOPPAR:dna-rna_rep.param ? 'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param ? 'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param ? 'X-RAY DIFFRACTION' 5 CNS_TOPPAR:cohex.param ? 'X-RAY DIFFRACTION' # _struct.entry_id 2PXT _struct.title 'Variant 15 of Ribonucleoprotein Core of the E. Coli Signal Recognition Particle' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2PXT _struct_keywords.text 'GU PAIR, HEXAMINE, RNA PHASING, RNA, CATION BINDING, SIGNALING PROTEIN-RNA COMPLEX' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN/RNA' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 3 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN B 4 ? GLN B 9 ? ASN A 4 GLN A 9 1 ? 6 HELX_P HELX_P2 2 LYS B 43 ? ASN B 53 ? LYS A 23 ASN A 33 1 ? 11 HELX_P HELX_P3 3 THR B 56 ? LYS B 62 ? THR A 36 LYS A 42 1 ? 7 HELX_P HELX_P4 4 PRO B 63 ? ILE B 66 ? PRO A 43 ILE A 46 5 ? 4 HELX_P HELX_P5 5 LYS B 67 ? SER B 78 ? LYS A 47 SER A 58 1 ? 12 HELX_P HELX_P6 6 GLN B 81 ? MSE B 98 ? GLN A 61 MSE A 78 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? B ARG 47 C ? ? ? 1_555 B MSE 48 N ? ? A ARG 27 A MSE 28 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale2 covale both ? B MSE 48 C ? ? ? 1_555 B GLU 49 N ? ? A MSE 28 A GLU 29 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale3 covale both ? B SER 54 C ? ? ? 1_555 B MSE 55 N ? ? A SER 34 A MSE 35 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale4 covale both ? B MSE 55 C ? ? ? 1_555 B THR 56 N ? ? A MSE 35 A THR 36 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale5 covale both ? B THR 56 C ? ? ? 1_555 B MSE 57 N ? ? A THR 36 A MSE 37 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale6 covale both ? B MSE 57 C ? ? ? 1_555 B LYS 58 N ? ? A MSE 37 A LYS 38 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale7 covale both ? B GLY 79 C ? ? ? 1_555 B MSE 80 N ? ? A GLY 59 A MSE 60 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? B MSE 80 C ? ? ? 1_555 B GLN 81 N ? ? A MSE 60 A GLN 61 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale9 covale both ? B ASP 94 C ? ? ? 1_555 B MSE 95 N ? ? A ASP 74 A MSE 75 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale10 covale both ? B MSE 95 C ? ? ? 1_555 B GLN 96 N ? ? A MSE 75 A GLN 76 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale11 covale both ? B ARG 97 C ? ? ? 1_555 B MSE 98 N ? ? A ARG 77 A MSE 78 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale12 covale both ? B MSE 98 C ? ? ? 1_555 B MSE 99 N ? ? A MSE 78 A MSE 79 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale13 covale both ? B MSE 99 C ? ? ? 1_555 B LYS 100 N ? ? A MSE 79 A LYS 80 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale14 covale both ? B LYS 101 C ? ? ? 1_555 B MSE 102 N ? ? A LYS 81 A MSE 82 1_555 ? ? ? ? ? ? ? 1.331 ? ? hydrog1 hydrog ? ? A G 1 N1 ? ? ? 1_555 A C 49 N3 ? ? B G 130 B C 178 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog2 hydrog ? ? A G 1 N2 ? ? ? 1_555 A C 49 O2 ? ? B G 130 B C 178 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog3 hydrog ? ? A G 1 O6 ? ? ? 1_555 A C 49 N4 ? ? B G 130 B C 178 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog4 hydrog ? ? A C 2 N3 ? ? ? 1_555 A G 48 N1 ? ? B C 131 B G 177 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog5 hydrog ? ? A C 2 N4 ? ? ? 1_555 A G 48 O6 ? ? B C 131 B G 177 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog6 hydrog ? ? A C 2 O2 ? ? ? 1_555 A G 48 N2 ? ? B C 131 B G 177 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog7 hydrog ? ? A U 3 N3 ? ? ? 1_555 A G 47 O6 ? ? B U 132 B G 176 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog8 hydrog ? ? A U 3 O2 ? ? ? 1_555 A G 47 N1 ? ? B U 132 B G 176 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog9 hydrog ? ? A G 4 N1 ? ? ? 1_555 A C 46 N3 ? ? B G 133 B C 175 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog10 hydrog ? ? A G 4 N2 ? ? ? 1_555 A C 46 O2 ? ? B G 133 B C 175 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog11 hydrog ? ? A G 4 O6 ? ? ? 1_555 A C 46 N4 ? ? B G 133 B C 175 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog12 hydrog ? ? A C 5 N3 ? ? ? 1_555 A G 45 N1 ? ? B C 134 B G 174 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog13 hydrog ? ? A C 5 N4 ? ? ? 1_555 A G 45 O6 ? ? B C 134 B G 174 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog14 hydrog ? ? A C 5 O2 ? ? ? 1_555 A G 45 N2 ? ? B C 134 B G 174 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog15 hydrog ? ? A U 6 N3 ? ? ? 1_555 A A 44 N1 ? ? B U 135 B A 173 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog16 hydrog ? ? A U 6 O4 ? ? ? 1_555 A A 44 N6 ? ? B U 135 B A 173 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog17 hydrog ? ? A G 7 N1 ? ? ? 1_555 A C 43 N3 ? ? B G 136 B C 172 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog18 hydrog ? ? A G 7 N2 ? ? ? 1_555 A C 43 O2 ? ? B G 136 B C 172 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog19 hydrog ? ? A G 7 O6 ? ? ? 1_555 A C 43 N4 ? ? B G 136 B C 172 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog20 hydrog ? ? A U 8 N3 ? ? ? 1_555 A G 42 O6 ? ? B U 137 B G 171 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog21 hydrog ? ? A U 8 O2 ? ? ? 1_555 A G 42 N1 ? ? B U 137 B G 171 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog22 hydrog ? ? A U 9 N3 ? ? ? 1_555 A G 41 O6 ? ? B U 138 B G 170 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog23 hydrog ? ? A U 9 O2 ? ? ? 1_555 A G 41 N1 ? ? B U 138 B G 170 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog24 hydrog ? ? A U 10 N3 ? ? ? 1_555 A A 40 N1 ? ? B U 139 B A 169 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog25 hydrog ? ? A U 10 O4 ? ? ? 1_555 A A 40 N6 ? ? B U 139 B A 169 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog26 hydrog ? ? A G 15 N1 ? ? ? 1_555 A C 38 N3 ? ? B G 144 B C 167 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog27 hydrog ? ? A G 15 N2 ? ? ? 1_555 A C 38 O2 ? ? B G 144 B C 167 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog28 hydrog ? ? A G 15 O6 ? ? ? 1_555 A C 38 N4 ? ? B G 144 B C 167 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog29 hydrog ? ? A G 16 N1 ? ? ? 1_555 A C 37 N3 ? ? B G 145 B C 166 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog30 hydrog ? ? A G 16 N2 ? ? ? 1_555 A C 37 O2 ? ? B G 145 B C 166 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog31 hydrog ? ? A G 16 O6 ? ? ? 1_555 A C 37 N4 ? ? B G 145 B C 166 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog32 hydrog ? ? A U 17 N3 ? ? ? 1_555 A G 36 O6 ? ? B U 146 B G 165 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog33 hydrog ? ? A U 17 O2 ? ? ? 1_555 A G 36 N1 ? ? B U 146 B G 165 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? ? hydrog34 hydrog ? ? A C 18 O2 ? ? ? 1_555 A C 34 N4 ? ? B C 147 B C 163 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? ? ? hydrog35 hydrog ? ? A C 18 O2 ? ? ? 1_555 A A 35 N6 ? ? B C 147 B A 164 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? ? ? hydrog36 hydrog ? ? A A 19 N6 ? ? ? 1_555 A C 34 N3 ? ? B A 148 B C 163 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? ? hydrog37 hydrog ? ? A A 19 N7 ? ? ? 1_555 A C 34 N4 ? ? B A 148 B C 163 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? ? hydrog38 hydrog ? ? A G 20 O6 ? ? ? 1_555 A G 33 N2 ? ? B G 149 B G 162 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? ? ? hydrog39 hydrog ? ? A G 21 N1 ? ? ? 1_555 A A 32 N1 ? ? B G 150 B A 161 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? ? hydrog40 hydrog ? ? A G 21 O6 ? ? ? 1_555 A A 32 N6 ? ? B G 150 B A 161 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? ? hydrog41 hydrog ? ? A U 22 N3 ? ? ? 1_555 A A 31 N1 ? ? B U 151 B A 160 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog42 hydrog ? ? A U 22 O4 ? ? ? 1_555 A A 31 N6 ? ? B U 151 B A 160 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog43 hydrog ? ? A C 23 N3 ? ? ? 1_555 A G 30 N1 ? ? B C 152 B G 159 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog44 hydrog ? ? A C 23 N4 ? ? ? 1_555 A G 30 O6 ? ? B C 152 B G 159 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog45 hydrog ? ? A C 23 O2 ? ? ? 1_555 A G 30 N2 ? ? B C 152 B G 159 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog46 hydrog ? ? A C 24 N3 ? ? ? 1_555 A G 29 N1 ? ? B C 153 B G 158 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog47 hydrog ? ? A C 24 N4 ? ? ? 1_555 A G 29 O6 ? ? B C 153 B G 158 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog48 hydrog ? ? A C 24 O2 ? ? ? 1_555 A G 29 N2 ? ? B C 153 B G 158 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? hydrog49 hydrog ? ? A G 25 N2 ? ? ? 1_555 A A 28 N7 ? ? B G 154 B A 157 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? hydrog ? ? # _atom_sites.entry_id 2PXT _atom_sites.fract_transf_matrix[1][1] 0.007442 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000650 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012736 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.030792 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CO N O P SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 G 1 130 130 G G B . n A 1 2 C 2 131 131 C C B . n A 1 3 U 3 132 132 U U B . n A 1 4 G 4 133 133 G G B . n A 1 5 C 5 134 134 C C B . n A 1 6 U 6 135 135 U U B . n A 1 7 G 7 136 136 G G B . n A 1 8 U 8 137 137 U U B . n A 1 9 U 9 138 138 U U B . n A 1 10 U 10 139 139 U U B . n A 1 11 A 11 140 140 A A B . n A 1 12 C 12 141 141 C C B . n A 1 13 C 13 142 142 C C B . n A 1 14 A 14 143 143 A A B . n A 1 15 G 15 144 144 G G B . n A 1 16 G 16 145 145 G G B . n A 1 17 U 17 146 146 U U B . n A 1 18 C 18 147 147 C C B . n A 1 19 A 19 148 148 A A B . n A 1 20 G 20 149 149 G G B . n A 1 21 G 21 150 150 G G B . n A 1 22 U 22 151 151 U U B . n A 1 23 C 23 152 152 C C B . n A 1 24 C 24 153 153 C C B . n A 1 25 G 25 154 154 G G B . n A 1 26 A 26 155 155 A A B . n A 1 27 A 27 156 156 A A B . n A 1 28 A 28 157 157 A A B . n A 1 29 G 29 158 158 G G B . n A 1 30 G 30 159 159 G G B . n A 1 31 A 31 160 160 A A B . n A 1 32 A 32 161 161 A A B . n A 1 33 G 33 162 162 G G B . n A 1 34 C 34 163 163 C C B . n A 1 35 A 35 164 164 A A B . n A 1 36 G 36 165 165 G G B . n A 1 37 C 37 166 166 C C B . n A 1 38 C 38 167 167 C C B . n A 1 39 A 39 168 168 A A B . n A 1 40 A 40 169 169 A A B . n A 1 41 G 41 170 170 G G B . n A 1 42 G 42 171 171 G G B . n A 1 43 C 43 172 172 C C B . n A 1 44 A 44 173 173 A A B . n A 1 45 G 45 174 174 G G B . n A 1 46 C 46 175 175 C C B . n A 1 47 G 47 176 176 G G B . n A 1 48 G 48 177 177 G G B . n A 1 49 C 49 178 178 C C B . n B 2 1 PHE 1 1 1 PHE PHE A . n B 2 2 ASP 2 2 2 ASP ASP A . n B 2 3 LEU 3 3 3 LEU LEU A . n B 2 4 ASN 4 4 4 ASN ASN A . n B 2 5 ASP 5 5 5 ASP ASP A . n B 2 6 PHE 6 6 6 PHE PHE A . n B 2 7 LEU 7 7 7 LEU LEU A . n B 2 8 GLU 8 8 8 GLU GLU A . n B 2 9 GLN 9 9 9 GLN GLN A . n B 2 10 LEU 10 9 ? ? ? A A n B 2 11 ARG 11 9 ? ? ? A B n B 2 12 GLN 12 9 ? ? ? A C n B 2 13 MET 13 9 ? ? ? A D n B 2 14 LYS 14 9 ? ? ? A E n B 2 15 ASN 15 9 ? ? ? A F n B 2 16 MSE 16 9 ? ? ? A G n B 2 17 GLY 17 9 ? ? ? A H n B 2 18 GLY 18 9 ? ? ? A I n B 2 19 MSE 19 9 ? ? ? A J n B 2 20 ALA 20 9 ? ? ? A K n B 2 21 SER 21 9 ? ? ? A L n B 2 22 LEU 22 9 ? ? ? A M n B 2 23 MSE 23 9 ? ? ? A N n B 2 24 GLY 24 9 ? ? ? A O n B 2 25 LYS 25 9 ? ? ? A P n B 2 26 LEU 26 9 ? ? ? A Q n B 2 27 PRO 27 9 ? ? ? A R n B 2 28 GLY 28 9 ? ? ? A S n B 2 29 MSE 29 9 ? ? ? A T n B 2 30 GLY 30 9 ? ? ? A U n B 2 31 GLN 31 9 ? ? ? A V n B 2 32 ILE 32 9 ? ? ? A W n B 2 33 PRO 33 9 ? ? ? A X n B 2 34 ASP 34 9 ? ? ? A Y n B 2 35 ASN 35 9 ? ? ? A Z n B 2 36 VAL 36 10 ? ? ? A A n B 2 37 LYS 37 10 ? ? ? A B n B 2 38 SER 38 10 ? ? ? A C n B 2 39 GLN 39 10 ? ? ? A D n B 2 40 MSE 40 10 ? ? ? A E n B 2 41 ASP 41 10 ? ? ? A F n B 2 42 ASP 42 10 ? ? ? A G n B 2 43 LYS 43 23 23 LYS LYS A . n B 2 44 VAL 44 24 24 VAL VAL A . n B 2 45 LEU 45 25 25 LEU ALA A . n B 2 46 VAL 46 26 26 VAL ALA A . n B 2 47 ARG 47 27 27 ARG ALA A . n B 2 48 MSE 48 28 28 MSE MSE A . n B 2 49 GLU 49 29 29 GLU GLU A . n B 2 50 ALA 50 30 30 ALA ALA A . n B 2 51 ILE 51 31 31 ILE ILE A . n B 2 52 ILE 52 32 32 ILE ILE A . n B 2 53 ASN 53 33 33 ASN ASN A . n B 2 54 SER 54 34 34 SER SER A . n B 2 55 MSE 55 35 35 MSE MSE A . n B 2 56 THR 56 36 36 THR THR A . n B 2 57 MSE 57 37 37 MSE MSE A . n B 2 58 LYS 58 38 38 LYS LYS A . n B 2 59 GLU 59 39 39 GLU GLU A . n B 2 60 ARG 60 40 40 ARG ARG A . n B 2 61 ALA 61 41 41 ALA ALA A . n B 2 62 LYS 62 42 42 LYS LYS A . n B 2 63 PRO 63 43 43 PRO PRO A . n B 2 64 GLU 64 44 44 GLU GLU A . n B 2 65 ILE 65 45 45 ILE ILE A . n B 2 66 ILE 66 46 46 ILE ILE A . n B 2 67 LYS 67 47 47 LYS LYS A . n B 2 68 GLY 68 48 48 GLY GLY A . n B 2 69 SER 69 49 49 SER SER A . n B 2 70 ARG 70 50 50 ARG ARG A . n B 2 71 LYS 71 51 51 LYS LYS A . n B 2 72 ARG 72 52 52 ARG ARG A . n B 2 73 ARG 73 53 53 ARG ARG A . n B 2 74 ILE 74 54 54 ILE ILE A . n B 2 75 ALA 75 55 55 ALA ALA A . n B 2 76 ALA 76 56 56 ALA ALA A . n B 2 77 GLY 77 57 57 GLY GLY A . n B 2 78 SER 78 58 58 SER SER A . n B 2 79 GLY 79 59 59 GLY GLY A . n B 2 80 MSE 80 60 60 MSE MSE A . n B 2 81 GLN 81 61 61 GLN GLN A . n B 2 82 VAL 82 62 62 VAL VAL A . n B 2 83 GLN 83 63 63 GLN GLN A . n B 2 84 ASP 84 64 64 ASP ASP A . n B 2 85 VAL 85 65 65 VAL VAL A . n B 2 86 ASN 86 66 66 ASN ASN A . n B 2 87 ARG 87 67 67 ARG ALA A . n B 2 88 LEU 88 68 68 LEU LEU A . n B 2 89 LEU 89 69 69 LEU LEU A . n B 2 90 LYS 90 70 70 LYS LYS A . n B 2 91 GLN 91 71 71 GLN GLN A . n B 2 92 PHE 92 72 72 PHE PHE A . n B 2 93 ASP 93 73 73 ASP ASP A . n B 2 94 ASP 94 74 74 ASP ASP A . n B 2 95 MSE 95 75 75 MSE MSE A . n B 2 96 GLN 96 76 76 GLN ALA A . n B 2 97 ARG 97 77 77 ARG ARG A . n B 2 98 MSE 98 78 78 MSE MSE A . n B 2 99 MSE 99 79 79 MSE MSE A . n B 2 100 LYS 100 80 80 LYS ALA A . n B 2 101 LYS 101 81 81 LYS LYS A . n B 2 102 MSE 102 82 82 MSE MSE A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 NCO 1 201 201 NCO NCO B . D 3 NCO 1 202 202 NCO NCO B . E 3 NCO 1 203 203 NCO NCO B . F 3 NCO 1 204 204 NCO NCO B . G 3 NCO 1 205 205 NCO NCO B . H 3 NCO 1 206 206 NCO NCO B . I 3 NCO 1 207 207 NCO NCO B . J 3 NCO 1 208 208 NCO NCO B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 B MSE 48 A MSE 28 ? MET SELENOMETHIONINE 2 B MSE 55 A MSE 35 ? MET SELENOMETHIONINE 3 B MSE 57 A MSE 37 ? MET SELENOMETHIONINE 4 B MSE 80 A MSE 60 ? MET SELENOMETHIONINE 5 B MSE 95 A MSE 75 ? MET SELENOMETHIONINE 6 B MSE 98 A MSE 78 ? MET SELENOMETHIONINE 7 B MSE 99 A MSE 79 ? MET SELENOMETHIONINE 8 B MSE 102 A MSE 82 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H,I,J # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-07 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2018-03-07 4 'Structure model' 1 3 2021-10-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' diffrn_source 2 4 'Structure model' database_2 3 4 'Structure model' struct_conn 4 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_diffrn_source.source' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 5 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_phasing_MR.entry_id 2PXT _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation general _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc 0.855 _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation ? _pdbx_phasing_MR.d_res_low_rotation ? _pdbx_phasing_MR.d_res_high_translation 4.000 _pdbx_phasing_MR.d_res_low_translation 15.000 _pdbx_phasing_MR.packing 0.383 _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation 99.700 _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation 0.000 _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal d*TREK 9.4L 'Feb 10 2005' package 'Pflugrath, J.W.' jwp@RigakuMSC.com 'data scaling' http://www.msc.com/protein/dtrek.html ? ? 1 CNS . ? package 'Axel T. Brunger' axel.brunger@yale.edu refinement http://cns.csb.yale.edu/v1.1/ Fortran_77 ? 2 PDB_EXTRACT 2.000 'April. 3, 2006' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 3 CrystalClear . ? ? ? ? 'data collection' ? ? ? 4 d*TREK . ? ? ? ? 'data reduction' ? ? ? 5 CNS . ? ? ? ? phasing ? ? ? 6 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 47 ? ? -100.69 -154.56 2 1 MSE A 60 ? ? -104.15 -166.27 3 1 LYS A 80 ? ? -80.72 34.35 4 1 LYS A 81 ? ? -151.23 53.40 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id A _pdbx_validate_planes.auth_asym_id B _pdbx_validate_planes.auth_seq_id 156 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.055 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 23 ? CG ? B LYS 43 CG 2 1 Y 1 A LYS 23 ? CD ? B LYS 43 CD 3 1 Y 1 A LYS 23 ? CE ? B LYS 43 CE 4 1 Y 1 A LYS 23 ? NZ ? B LYS 43 NZ 5 1 Y 1 A VAL 24 ? CG1 ? B VAL 44 CG1 6 1 Y 1 A VAL 24 ? CG2 ? B VAL 44 CG2 7 1 Y 1 A LEU 25 ? CG ? B LEU 45 CG 8 1 Y 1 A LEU 25 ? CD1 ? B LEU 45 CD1 9 1 Y 1 A LEU 25 ? CD2 ? B LEU 45 CD2 10 1 Y 1 A VAL 26 ? CG1 ? B VAL 46 CG1 11 1 Y 1 A VAL 26 ? CG2 ? B VAL 46 CG2 12 1 Y 1 A ARG 27 ? CG ? B ARG 47 CG 13 1 Y 1 A ARG 27 ? CD ? B ARG 47 CD 14 1 Y 1 A ARG 27 ? NE ? B ARG 47 NE 15 1 Y 1 A ARG 27 ? CZ ? B ARG 47 CZ 16 1 Y 1 A ARG 27 ? NH1 ? B ARG 47 NH1 17 1 Y 1 A ARG 27 ? NH2 ? B ARG 47 NH2 18 1 Y 1 A ARG 67 ? CG ? B ARG 87 CG 19 1 Y 1 A ARG 67 ? CD ? B ARG 87 CD 20 1 Y 1 A ARG 67 ? NE ? B ARG 87 NE 21 1 Y 1 A ARG 67 ? CZ ? B ARG 87 CZ 22 1 Y 1 A ARG 67 ? NH1 ? B ARG 87 NH1 23 1 Y 1 A ARG 67 ? NH2 ? B ARG 87 NH2 24 1 Y 1 A GLN 76 ? CG ? B GLN 96 CG 25 1 Y 1 A GLN 76 ? CD ? B GLN 96 CD 26 1 Y 1 A GLN 76 ? OE1 ? B GLN 96 OE1 27 1 Y 1 A GLN 76 ? NE2 ? B GLN 96 NE2 28 1 Y 1 A LYS 80 ? CG ? B LYS 100 CG 29 1 Y 1 A LYS 80 ? CD ? B LYS 100 CD 30 1 Y 1 A LYS 80 ? CE ? B LYS 100 CE 31 1 Y 1 A LYS 80 ? NZ ? B LYS 100 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A LEU 9 A B LEU 10 2 1 Y 1 A ARG 9 B B ARG 11 3 1 Y 1 A GLN 9 C B GLN 12 4 1 Y 1 A MET 9 D B MET 13 5 1 Y 1 A LYS 9 E B LYS 14 6 1 Y 1 A ASN 9 F B ASN 15 7 1 Y 1 A MSE 9 G B MSE 16 8 1 Y 1 A GLY 9 H B GLY 17 9 1 Y 1 A GLY 9 I B GLY 18 10 1 Y 1 A MSE 9 J B MSE 19 11 1 Y 1 A ALA 9 K B ALA 20 12 1 Y 1 A SER 9 L B SER 21 13 1 Y 1 A LEU 9 M B LEU 22 14 1 Y 1 A MSE 9 N B MSE 23 15 1 Y 1 A GLY 9 O B GLY 24 16 1 Y 1 A LYS 9 P B LYS 25 17 1 Y 1 A LEU 9 Q B LEU 26 18 1 Y 1 A PRO 9 R B PRO 27 19 1 Y 1 A GLY 9 S B GLY 28 20 1 Y 1 A MSE 9 T B MSE 29 21 1 Y 1 A GLY 9 U B GLY 30 22 1 Y 1 A GLN 9 V B GLN 31 23 1 Y 1 A ILE 9 W B ILE 32 24 1 Y 1 A PRO 9 X B PRO 33 25 1 Y 1 A ASP 9 Y B ASP 34 26 1 Y 1 A ASN 9 Z B ASN 35 27 1 Y 1 A VAL 10 A B VAL 36 28 1 Y 1 A LYS 10 B B LYS 37 29 1 Y 1 A SER 10 C B SER 38 30 1 Y 1 A GLN 10 D B GLN 39 31 1 Y 1 A MSE 10 E B MSE 40 32 1 Y 1 A ASP 10 F B ASP 41 33 1 Y 1 A ASP 10 G B ASP 42 # loop_ _ndb_struct_conf_na.entry_id _ndb_struct_conf_na.feature 2PXT 'double helix' 2PXT 'a-form double helix' 2PXT tetraloop 2PXT 'mismatched base pair' 2PXT 'internal loop' # loop_ _ndb_struct_na_base_pair.model_number _ndb_struct_na_base_pair.i_label_asym_id _ndb_struct_na_base_pair.i_label_comp_id _ndb_struct_na_base_pair.i_label_seq_id _ndb_struct_na_base_pair.i_symmetry _ndb_struct_na_base_pair.j_label_asym_id _ndb_struct_na_base_pair.j_label_comp_id _ndb_struct_na_base_pair.j_label_seq_id _ndb_struct_na_base_pair.j_symmetry _ndb_struct_na_base_pair.shear _ndb_struct_na_base_pair.stretch _ndb_struct_na_base_pair.stagger _ndb_struct_na_base_pair.buckle _ndb_struct_na_base_pair.propeller _ndb_struct_na_base_pair.opening _ndb_struct_na_base_pair.pair_number _ndb_struct_na_base_pair.pair_name _ndb_struct_na_base_pair.i_auth_asym_id _ndb_struct_na_base_pair.i_auth_seq_id _ndb_struct_na_base_pair.i_PDB_ins_code _ndb_struct_na_base_pair.j_auth_asym_id _ndb_struct_na_base_pair.j_auth_seq_id _ndb_struct_na_base_pair.j_PDB_ins_code _ndb_struct_na_base_pair.hbond_type_28 _ndb_struct_na_base_pair.hbond_type_12 1 A G 1 1_555 A C 49 1_555 -0.157 -0.150 -0.077 -4.080 -11.539 -2.342 1 B_G130:C178_B B 130 ? B 178 ? 19 1 1 A C 2 1_555 A G 48 1_555 0.374 -0.363 0.295 2.245 -15.530 1.466 2 B_C131:G177_B B 131 ? B 177 ? 19 1 1 A U 3 1_555 A G 47 1_555 1.871 -0.276 0.024 -2.018 -12.684 7.421 3 B_U132:G176_B B 132 ? B 176 ? 28 1 1 A G 4 1_555 A C 46 1_555 -0.235 -0.290 0.008 -5.190 -12.474 0.303 4 B_G133:C175_B B 133 ? B 175 ? 19 1 1 A C 5 1_555 A G 45 1_555 0.337 -0.351 0.348 -5.121 -10.962 0.623 5 B_C134:G174_B B 134 ? B 174 ? 19 1 1 A U 6 1_555 A A 44 1_555 0.152 -0.102 0.183 0.369 -13.654 -2.802 6 B_U135:A173_B B 135 ? B 173 ? 20 1 1 A G 7 1_555 A C 43 1_555 -0.387 -0.138 -0.105 0.935 -15.426 0.942 7 B_G136:C172_B B 136 ? B 172 ? 19 1 1 A U 8 1_555 A G 42 1_555 2.372 -0.590 0.277 3.826 -15.411 1.671 8 B_U137:G171_B B 137 ? B 171 ? 28 1 1 A U 9 1_555 A G 41 1_555 2.449 -0.743 -0.029 -3.314 -18.974 2.055 9 B_U138:G170_B B 138 ? B 170 ? 28 ? 1 A U 10 1_555 A A 40 1_555 0.214 0.019 0.020 -0.876 -3.801 1.754 10 B_U139:A169_B B 139 ? B 169 ? 20 1 1 A G 15 1_555 A C 38 1_555 -0.602 -0.142 0.232 -6.413 -6.488 -2.250 11 B_G144:C167_B B 144 ? B 167 ? 19 1 1 A G 16 1_555 A C 37 1_555 -0.296 -0.087 -0.215 -14.260 -11.024 2.763 12 B_G145:C166_B B 145 ? B 166 ? 19 1 1 A U 17 1_555 A G 36 1_555 2.405 -0.645 0.061 -7.193 -8.168 -4.512 13 B_U146:G165_B B 146 ? B 165 ? 28 ? 1 A C 18 1_555 A A 35 1_555 6.271 -4.171 0.755 -1.086 -5.695 -22.029 14 B_C147:A164_B B 147 ? B 164 ? ? 6 1 A A 19 1_555 A C 34 1_555 -3.206 -0.277 -1.122 -2.478 -19.245 -92.641 15 B_A148:C163_B B 148 ? B 163 ? 25 4 1 A G 20 1_555 A G 33 1_555 -6.953 -2.179 0.216 0.687 -4.491 -19.971 16 B_G149:G162_B B 149 ? B 162 ? ? ? 1 A G 21 1_555 A A 32 1_555 -0.010 1.244 -0.519 10.673 -4.002 -18.740 17 B_G150:A161_B B 150 ? B 161 ? 8 1 1 A U 22 1_555 A A 31 1_555 -0.191 -0.110 -0.274 12.909 -4.921 -6.384 18 B_U151:A160_B B 151 ? B 160 ? 20 1 1 A C 23 1_555 A G 30 1_555 0.334 -0.197 -0.478 12.007 -11.722 0.658 19 B_C152:G159_B B 152 ? B 159 ? 19 1 1 A C 24 1_555 A G 29 1_555 0.552 -0.297 -0.232 5.869 0.318 1.006 20 B_C153:G158_B B 153 ? B 158 ? 19 1 1 A G 25 1_555 A A 28 1_555 6.897 -5.109 0.626 8.417 -2.696 -13.811 21 B_G154:A157_B B 154 ? B 157 ? ? 10 # loop_ _ndb_struct_na_base_pair_step.model_number _ndb_struct_na_base_pair_step.i_label_asym_id_1 _ndb_struct_na_base_pair_step.i_label_comp_id_1 _ndb_struct_na_base_pair_step.i_label_seq_id_1 _ndb_struct_na_base_pair_step.i_symmetry_1 _ndb_struct_na_base_pair_step.j_label_asym_id_1 _ndb_struct_na_base_pair_step.j_label_comp_id_1 _ndb_struct_na_base_pair_step.j_label_seq_id_1 _ndb_struct_na_base_pair_step.j_symmetry_1 _ndb_struct_na_base_pair_step.i_label_asym_id_2 _ndb_struct_na_base_pair_step.i_label_comp_id_2 _ndb_struct_na_base_pair_step.i_label_seq_id_2 _ndb_struct_na_base_pair_step.i_symmetry_2 _ndb_struct_na_base_pair_step.j_label_asym_id_2 _ndb_struct_na_base_pair_step.j_label_comp_id_2 _ndb_struct_na_base_pair_step.j_label_seq_id_2 _ndb_struct_na_base_pair_step.j_symmetry_2 _ndb_struct_na_base_pair_step.shift _ndb_struct_na_base_pair_step.slide _ndb_struct_na_base_pair_step.rise _ndb_struct_na_base_pair_step.tilt _ndb_struct_na_base_pair_step.roll _ndb_struct_na_base_pair_step.twist _ndb_struct_na_base_pair_step.x_displacement _ndb_struct_na_base_pair_step.y_displacement _ndb_struct_na_base_pair_step.helical_rise _ndb_struct_na_base_pair_step.inclination _ndb_struct_na_base_pair_step.tip _ndb_struct_na_base_pair_step.helical_twist _ndb_struct_na_base_pair_step.step_number _ndb_struct_na_base_pair_step.step_name _ndb_struct_na_base_pair_step.i_auth_asym_id_1 _ndb_struct_na_base_pair_step.i_auth_seq_id_1 _ndb_struct_na_base_pair_step.i_PDB_ins_code_1 _ndb_struct_na_base_pair_step.j_auth_asym_id_1 _ndb_struct_na_base_pair_step.j_auth_seq_id_1 _ndb_struct_na_base_pair_step.j_PDB_ins_code_1 _ndb_struct_na_base_pair_step.i_auth_asym_id_2 _ndb_struct_na_base_pair_step.i_auth_seq_id_2 _ndb_struct_na_base_pair_step.i_PDB_ins_code_2 _ndb_struct_na_base_pair_step.j_auth_asym_id_2 _ndb_struct_na_base_pair_step.j_auth_seq_id_2 _ndb_struct_na_base_pair_step.j_PDB_ins_code_2 1 A G 1 1_555 A C 49 1_555 A C 2 1_555 A G 48 1_555 -0.155 -1.344 3.018 -5.823 5.194 38.005 -2.596 -0.407 2.810 7.874 8.828 38.769 1 BB_G130C131:G177C178_BB B 130 ? B 178 ? B 131 ? B 177 ? 1 A C 2 1_555 A G 48 1_555 A U 3 1_555 A G 47 1_555 0.615 -1.387 3.249 4.923 7.637 40.221 -2.770 -0.360 2.999 10.937 -7.050 41.193 2 BB_C131U132:G176G177_BB B 131 ? B 177 ? B 132 ? B 176 ? 1 A U 3 1_555 A G 47 1_555 A G 4 1_555 A C 46 1_555 -0.836 -1.890 3.095 0.542 13.961 23.643 -6.720 1.870 1.711 30.861 -1.199 27.412 3 BB_U132G133:C175G176_BB B 132 ? B 176 ? B 133 ? B 175 ? 1 A G 4 1_555 A C 46 1_555 A C 5 1_555 A G 45 1_555 0.155 -1.472 3.210 -2.089 9.130 32.266 -3.928 -0.583 2.691 16.013 3.664 33.563 4 BB_G133C134:G174C175_BB B 133 ? B 175 ? B 134 ? B 174 ? 1 A C 5 1_555 A G 45 1_555 A U 6 1_555 A A 44 1_555 0.254 -1.548 2.992 1.872 8.832 34.345 -3.654 -0.180 2.538 14.646 -3.105 35.477 5 BB_C134U135:A173G174_BB B 134 ? B 174 ? B 135 ? B 173 ? 1 A U 6 1_555 A A 44 1_555 A G 7 1_555 A C 43 1_555 -0.662 -1.763 3.156 0.653 10.703 21.853 -7.018 1.744 2.057 26.292 -1.604 24.313 6 BB_U135G136:C172A173_BB B 135 ? B 173 ? B 136 ? B 172 ? 1 A G 7 1_555 A C 43 1_555 A U 8 1_555 A G 42 1_555 0.505 -1.315 3.233 -2.057 7.091 44.563 -2.320 -0.833 2.976 9.275 2.690 45.139 7 BB_G136U137:G171C172_BB B 136 ? B 172 ? B 137 ? B 171 ? 1 A U 8 1_555 A G 42 1_555 A U 9 1_555 A G 41 1_555 0.000 -1.663 3.346 8.244 4.517 37.016 -3.112 1.037 3.060 6.977 -12.735 38.150 8 BB_U137U138:G170G171_BB B 137 ? B 171 ? B 138 ? B 170 ? 1 A U 9 1_555 A G 41 1_555 A U 10 1_555 A A 40 1_555 -0.156 -1.562 3.015 4.033 11.184 22.131 -6.268 1.323 1.952 26.793 -9.662 25.087 9 BB_U138U139:A169G170_BB B 138 ? B 170 ? B 139 ? B 169 ? 1 A G 15 1_555 A C 38 1_555 A G 16 1_555 A C 37 1_555 -0.099 -1.729 3.367 2.850 10.230 37.918 -3.740 0.473 2.811 15.378 -4.284 39.325 10 BB_G144G145:C166C167_BB B 144 ? B 167 ? B 145 ? B 166 ? 1 A G 16 1_555 A C 37 1_555 A U 17 1_555 A G 36 1_555 -0.458 -0.909 3.090 -0.895 2.206 41.633 -1.496 0.554 3.049 3.100 1.258 41.698 11 BB_G145U146:G165C166_BB B 145 ? B 166 ? B 146 ? B 165 ? 1 A U 17 1_555 A G 36 1_555 A C 18 1_555 A A 35 1_555 -0.198 -1.708 3.287 4.663 7.934 48.922 -2.592 0.565 2.964 9.483 -5.574 49.728 12 BB_U146C147:A164G165_BB B 146 ? B 165 ? B 147 ? B 164 ? 1 A C 18 1_555 A A 35 1_555 A A 19 1_555 A C 34 1_555 -5.034 -0.262 2.694 -0.190 10.267 6.495 -11.620 23.601 1.300 57.760 1.066 12.145 13 BB_C147A148:C163A164_BB B 147 ? B 164 ? B 148 ? B 163 ? 1 A A 19 1_555 A C 34 1_555 A G 20 1_555 A G 33 1_555 5.218 -1.018 3.170 -2.432 4.509 27.290 -3.074 -11.389 2.506 9.452 5.098 27.758 14 BB_A148G149:G162C163_BB B 148 ? B 163 ? B 149 ? B 162 ? 1 A G 20 1_555 A G 33 1_555 A G 21 1_555 A A 32 1_555 -0.194 -1.711 3.268 0.583 6.478 51.771 -2.363 0.258 3.046 7.386 -0.664 52.150 15 BB_G149G150:A161G162_BB B 149 ? B 162 ? B 150 ? B 161 ? 1 A G 21 1_555 A A 32 1_555 A U 22 1_555 A A 31 1_555 0.581 -2.128 3.270 -5.277 3.735 26.275 -5.440 -2.500 2.779 8.061 11.390 27.045 16 BB_G150U151:A160A161_BB B 150 ? B 161 ? B 151 ? B 160 ? 1 A U 22 1_555 A A 31 1_555 A C 23 1_555 A G 30 1_555 0.303 -1.915 3.400 -1.252 3.802 37.510 -3.459 -0.632 3.186 5.892 1.941 37.715 17 BB_U151C152:G159A160_BB B 151 ? B 160 ? B 152 ? B 159 ? 1 A C 23 1_555 A G 30 1_555 A C 24 1_555 A G 29 1_555 -0.464 -1.761 3.464 -3.861 7.696 30.375 -4.676 0.132 2.975 14.330 7.189 31.544 18 BB_C152C153:G158G159_BB B 152 ? B 159 ? B 153 ? B 158 ? 1 A C 24 1_555 A G 29 1_555 A G 25 1_555 A A 28 1_555 -2.462 -1.060 3.267 -0.730 9.722 45.689 -2.130 3.049 3.030 12.355 0.927 46.663 19 BB_C153G154:A157G158_BB B 153 ? B 158 ? B 154 ? B 157 ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'COBALT HEXAMMINE(III)' _pdbx_entity_nonpoly.comp_id NCO #