data_2PY9 # _entry.id 2PY9 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2PY9 pdb_00002py9 10.2210/pdb2py9/pdb NDB PR0273 ? ? RCSB RCSB042916 ? ? WWPDB D_1000042916 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-06-12 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2024-10-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Refinement description' 7 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' database_2 4 4 'Structure model' pdbx_entry_details 5 4 'Structure model' pdbx_modification_feature 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ncs_dom_lim 8 4 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 4 'Structure model' '_struct_ncs_dom_lim.beg_auth_comp_id' 5 4 'Structure model' '_struct_ncs_dom_lim.end_auth_comp_id' 6 4 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2PY9 _pdbx_database_status.recvd_initial_deposition_date 2007-05-15 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2AXY 'same protein complexed with 7-mer telomeric dna' unspecified PDB 2PQU 'same protein complexed with 12-mer telomeric dna' unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'James, T.L.' 1 'Du, Z.' 2 'Lee, J.K.' 3 # _citation.id primary _citation.title ;X-ray crystallographic and NMR studies of protein-protein and protein-nucleic acid interactions involving the KH domains from human poly(C)-binding protein-2. ; _citation.journal_abbrev Rna _citation.journal_volume 13 _citation.page_first 1043 _citation.page_last 1051 _citation.year 2007 _citation.journal_id_ASTM RNARFU _citation.country UK _citation.journal_id_ISSN 1355-8382 _citation.journal_id_CSD 2122 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17526645 _citation.pdbx_database_id_DOI 10.1261/rna.410107 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Du, Z.' 1 ? primary 'Lee, J.K.' 2 ? primary 'Fenn, S.' 3 ? primary 'Tjhen, R.' 4 ? primary 'Stroud, R.M.' 5 ? primary 'James, T.L.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn '12-mer C-rich strand of human telomeric RNA' 3715.288 2 ? ? ? ? 2 polymer man 'Poly(rC)-binding protein 2' 8166.099 4 ? ? ? ? 3 water nat water 18.015 51 ? ? ? ? # _entity_name_com.entity_id 2 _entity_name_com.name 'Alpha-CP2, hnRNP-E2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 polyribonucleotide no no AACCCUAACCCU AACCCUAACCCU E,F ? 2 'polypeptide(L)' no yes ;KNVTLTIRLL(MSE)HGKEVGSIIGKKGESVKK(MSE)REESGARINISEGNCPERIITLAGPTNAIFKAFA(MSE)IID KLEED ; KNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEED A,B,C,D ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 A n 1 2 A n 1 3 C n 1 4 C n 1 5 C n 1 6 U n 1 7 A n 1 8 A n 1 9 C n 1 10 C n 1 11 C n 1 12 U n 2 1 LYS n 2 2 ASN n 2 3 VAL n 2 4 THR n 2 5 LEU n 2 6 THR n 2 7 ILE n 2 8 ARG n 2 9 LEU n 2 10 LEU n 2 11 MSE n 2 12 HIS n 2 13 GLY n 2 14 LYS n 2 15 GLU n 2 16 VAL n 2 17 GLY n 2 18 SER n 2 19 ILE n 2 20 ILE n 2 21 GLY n 2 22 LYS n 2 23 LYS n 2 24 GLY n 2 25 GLU n 2 26 SER n 2 27 VAL n 2 28 LYS n 2 29 LYS n 2 30 MSE n 2 31 ARG n 2 32 GLU n 2 33 GLU n 2 34 SER n 2 35 GLY n 2 36 ALA n 2 37 ARG n 2 38 ILE n 2 39 ASN n 2 40 ILE n 2 41 SER n 2 42 GLU n 2 43 GLY n 2 44 ASN n 2 45 CYS n 2 46 PRO n 2 47 GLU n 2 48 ARG n 2 49 ILE n 2 50 ILE n 2 51 THR n 2 52 LEU n 2 53 ALA n 2 54 GLY n 2 55 PRO n 2 56 THR n 2 57 ASN n 2 58 ALA n 2 59 ILE n 2 60 PHE n 2 61 LYS n 2 62 ALA n 2 63 PHE n 2 64 ALA n 2 65 MSE n 2 66 ILE n 2 67 ILE n 2 68 ASP n 2 69 LYS n 2 70 LEU n 2 71 GLU n 2 72 GLU n 2 73 ASP n # _entity_src_gen.entity_id 2 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene PCBP2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'bl21(de3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pet24a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A 'RNA linking' y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 A 1 1 1 A A E . n A 1 2 A 2 2 2 A A E . n A 1 3 C 3 3 3 C C E . n A 1 4 C 4 4 4 C C E . n A 1 5 C 5 5 5 C C E . n A 1 6 U 6 6 6 U U E . n A 1 7 A 7 7 7 A A E . n A 1 8 A 8 8 8 A A E . n A 1 9 C 9 9 9 C C E . n A 1 10 C 10 10 10 C C E . n A 1 11 C 11 11 11 C C E . n A 1 12 U 12 12 12 U U E . n B 1 1 A 1 1 1 A A F . n B 1 2 A 2 2 2 A A F . n B 1 3 C 3 3 3 C C F . n B 1 4 C 4 4 4 C C F . n B 1 5 C 5 5 5 C C F . n B 1 6 U 6 6 6 U U F . n B 1 7 A 7 7 7 A A F . n B 1 8 A 8 8 8 A A F . n B 1 9 C 9 9 9 C C F . n B 1 10 C 10 10 10 C C F . n B 1 11 C 11 11 11 C C F . n B 1 12 U 12 12 12 U U F . n C 2 1 LYS 1 10 10 LYS LYS A . n C 2 2 ASN 2 11 11 ASN ASN A . n C 2 3 VAL 3 12 12 VAL VAL A . n C 2 4 THR 4 13 13 THR THR A . n C 2 5 LEU 5 14 14 LEU LEU A . n C 2 6 THR 6 15 15 THR THR A . n C 2 7 ILE 7 16 16 ILE ILE A . n C 2 8 ARG 8 17 17 ARG ARG A . n C 2 9 LEU 9 18 18 LEU LEU A . n C 2 10 LEU 10 19 19 LEU LEU A . n C 2 11 MSE 11 20 20 MSE MSE A . n C 2 12 HIS 12 21 21 HIS HIS A . n C 2 13 GLY 13 22 22 GLY GLY A . n C 2 14 LYS 14 23 23 LYS LYS A . n C 2 15 GLU 15 24 24 GLU GLU A . n C 2 16 VAL 16 25 25 VAL VAL A . n C 2 17 GLY 17 26 26 GLY GLY A . n C 2 18 SER 18 27 27 SER SER A . n C 2 19 ILE 19 28 28 ILE ILE A . n C 2 20 ILE 20 29 29 ILE ILE A . n C 2 21 GLY 21 30 30 GLY GLY A . n C 2 22 LYS 22 31 31 LYS LYS A . n C 2 23 LYS 23 32 32 LYS LYS A . n C 2 24 GLY 24 33 33 GLY GLY A . n C 2 25 GLU 25 34 34 GLU GLU A . n C 2 26 SER 26 35 35 SER SER A . n C 2 27 VAL 27 36 36 VAL VAL A . n C 2 28 LYS 28 37 37 LYS LYS A . n C 2 29 LYS 29 38 38 LYS LYS A . n C 2 30 MSE 30 39 39 MSE MSE A . n C 2 31 ARG 31 40 40 ARG ARG A . n C 2 32 GLU 32 41 41 GLU GLU A . n C 2 33 GLU 33 42 42 GLU GLU A . n C 2 34 SER 34 43 43 SER SER A . n C 2 35 GLY 35 44 44 GLY GLY A . n C 2 36 ALA 36 45 45 ALA ALA A . n C 2 37 ARG 37 46 46 ARG ARG A . n C 2 38 ILE 38 47 47 ILE ILE A . n C 2 39 ASN 39 48 48 ASN ASN A . n C 2 40 ILE 40 49 49 ILE ILE A . n C 2 41 SER 41 50 50 SER SER A . n C 2 42 GLU 42 51 51 GLU GLU A . n C 2 43 GLY 43 52 52 GLY GLY A . n C 2 44 ASN 44 53 53 ASN ASN A . n C 2 45 CYS 45 54 54 CYS CYS A . n C 2 46 PRO 46 55 55 PRO PRO A . n C 2 47 GLU 47 56 56 GLU GLU A . n C 2 48 ARG 48 57 57 ARG ARG A . n C 2 49 ILE 49 58 58 ILE ILE A . n C 2 50 ILE 50 59 59 ILE ILE A . n C 2 51 THR 51 60 60 THR THR A . n C 2 52 LEU 52 61 61 LEU LEU A . n C 2 53 ALA 53 62 62 ALA ALA A . n C 2 54 GLY 54 63 63 GLY GLY A . n C 2 55 PRO 55 64 64 PRO PRO A . n C 2 56 THR 56 65 65 THR THR A . n C 2 57 ASN 57 66 66 ASN ASN A . n C 2 58 ALA 58 67 67 ALA ALA A . n C 2 59 ILE 59 68 68 ILE ILE A . n C 2 60 PHE 60 69 69 PHE PHE A . n C 2 61 LYS 61 70 70 LYS LYS A . n C 2 62 ALA 62 71 71 ALA ALA A . n C 2 63 PHE 63 72 72 PHE PHE A . n C 2 64 ALA 64 73 73 ALA ALA A . n C 2 65 MSE 65 74 74 MSE MSE A . n C 2 66 ILE 66 75 75 ILE ILE A . n C 2 67 ILE 67 76 76 ILE ILE A . n C 2 68 ASP 68 77 77 ASP ASP A . n C 2 69 LYS 69 78 78 LYS LYS A . n C 2 70 LEU 70 79 79 LEU LEU A . n C 2 71 GLU 71 80 80 GLU GLU A . n C 2 72 GLU 72 81 81 GLU GLU A . n C 2 73 ASP 73 82 ? ? ? A . n D 2 1 LYS 1 10 ? ? ? B . n D 2 2 ASN 2 11 ? ? ? B . n D 2 3 VAL 3 12 ? ? ? B . n D 2 4 THR 4 13 13 THR THR B . n D 2 5 LEU 5 14 14 LEU LEU B . n D 2 6 THR 6 15 15 THR THR B . n D 2 7 ILE 7 16 16 ILE ILE B . n D 2 8 ARG 8 17 17 ARG ARG B . n D 2 9 LEU 9 18 18 LEU LEU B . n D 2 10 LEU 10 19 19 LEU LEU B . n D 2 11 MSE 11 20 20 MSE MSE B . n D 2 12 HIS 12 21 21 HIS HIS B . n D 2 13 GLY 13 22 22 GLY GLY B . n D 2 14 LYS 14 23 23 LYS LYS B . n D 2 15 GLU 15 24 24 GLU GLU B . n D 2 16 VAL 16 25 25 VAL VAL B . n D 2 17 GLY 17 26 26 GLY GLY B . n D 2 18 SER 18 27 27 SER SER B . n D 2 19 ILE 19 28 28 ILE ILE B . n D 2 20 ILE 20 29 29 ILE ILE B . n D 2 21 GLY 21 30 30 GLY GLY B . n D 2 22 LYS 22 31 31 LYS LYS B . n D 2 23 LYS 23 32 32 LYS LYS B . n D 2 24 GLY 24 33 33 GLY GLY B . n D 2 25 GLU 25 34 34 GLU GLU B . n D 2 26 SER 26 35 35 SER SER B . n D 2 27 VAL 27 36 36 VAL VAL B . n D 2 28 LYS 28 37 37 LYS LYS B . n D 2 29 LYS 29 38 38 LYS LYS B . n D 2 30 MSE 30 39 39 MSE MSE B . n D 2 31 ARG 31 40 40 ARG ARG B . n D 2 32 GLU 32 41 41 GLU GLU B . n D 2 33 GLU 33 42 42 GLU GLU B . n D 2 34 SER 34 43 43 SER SER B . n D 2 35 GLY 35 44 44 GLY GLY B . n D 2 36 ALA 36 45 45 ALA ALA B . n D 2 37 ARG 37 46 46 ARG ARG B . n D 2 38 ILE 38 47 47 ILE ILE B . n D 2 39 ASN 39 48 48 ASN ASN B . n D 2 40 ILE 40 49 49 ILE ILE B . n D 2 41 SER 41 50 50 SER SER B . n D 2 42 GLU 42 51 51 GLU GLU B . n D 2 43 GLY 43 52 52 GLY GLY B . n D 2 44 ASN 44 53 53 ASN ASN B . n D 2 45 CYS 45 54 54 CYS CYS B . n D 2 46 PRO 46 55 55 PRO PRO B . n D 2 47 GLU 47 56 56 GLU GLU B . n D 2 48 ARG 48 57 57 ARG ARG B . n D 2 49 ILE 49 58 58 ILE ILE B . n D 2 50 ILE 50 59 59 ILE ILE B . n D 2 51 THR 51 60 60 THR THR B . n D 2 52 LEU 52 61 61 LEU LEU B . n D 2 53 ALA 53 62 62 ALA ALA B . n D 2 54 GLY 54 63 63 GLY GLY B . n D 2 55 PRO 55 64 64 PRO PRO B . n D 2 56 THR 56 65 65 THR THR B . n D 2 57 ASN 57 66 66 ASN ASN B . n D 2 58 ALA 58 67 67 ALA ALA B . n D 2 59 ILE 59 68 68 ILE ILE B . n D 2 60 PHE 60 69 69 PHE PHE B . n D 2 61 LYS 61 70 70 LYS LYS B . n D 2 62 ALA 62 71 71 ALA ALA B . n D 2 63 PHE 63 72 72 PHE PHE B . n D 2 64 ALA 64 73 73 ALA ALA B . n D 2 65 MSE 65 74 74 MSE MSE B . n D 2 66 ILE 66 75 75 ILE ILE B . n D 2 67 ILE 67 76 76 ILE ILE B . n D 2 68 ASP 68 77 77 ASP ASP B . n D 2 69 LYS 69 78 78 LYS LYS B . n D 2 70 LEU 70 79 79 LEU LEU B . n D 2 71 GLU 71 80 80 GLU GLU B . n D 2 72 GLU 72 81 81 GLU GLU B . n D 2 73 ASP 73 82 ? ? ? B . n E 2 1 LYS 1 10 ? ? ? C . n E 2 2 ASN 2 11 ? ? ? C . n E 2 3 VAL 3 12 ? ? ? C . n E 2 4 THR 4 13 13 THR THR C . n E 2 5 LEU 5 14 14 LEU LEU C . n E 2 6 THR 6 15 15 THR THR C . n E 2 7 ILE 7 16 16 ILE ILE C . n E 2 8 ARG 8 17 17 ARG ARG C . n E 2 9 LEU 9 18 18 LEU LEU C . n E 2 10 LEU 10 19 19 LEU LEU C . n E 2 11 MSE 11 20 20 MSE MSE C . n E 2 12 HIS 12 21 21 HIS HIS C . n E 2 13 GLY 13 22 22 GLY GLY C . n E 2 14 LYS 14 23 23 LYS LYS C . n E 2 15 GLU 15 24 24 GLU GLU C . n E 2 16 VAL 16 25 25 VAL VAL C . n E 2 17 GLY 17 26 26 GLY GLY C . n E 2 18 SER 18 27 27 SER SER C . n E 2 19 ILE 19 28 28 ILE ILE C . n E 2 20 ILE 20 29 29 ILE ILE C . n E 2 21 GLY 21 30 30 GLY GLY C . n E 2 22 LYS 22 31 31 LYS LYS C . n E 2 23 LYS 23 32 32 LYS LYS C . n E 2 24 GLY 24 33 33 GLY GLY C . n E 2 25 GLU 25 34 34 GLU GLU C . n E 2 26 SER 26 35 35 SER SER C . n E 2 27 VAL 27 36 36 VAL VAL C . n E 2 28 LYS 28 37 37 LYS LYS C . n E 2 29 LYS 29 38 38 LYS LYS C . n E 2 30 MSE 30 39 39 MSE MSE C . n E 2 31 ARG 31 40 40 ARG ARG C . n E 2 32 GLU 32 41 41 GLU GLU C . n E 2 33 GLU 33 42 42 GLU GLU C . n E 2 34 SER 34 43 43 SER SER C . n E 2 35 GLY 35 44 44 GLY GLY C . n E 2 36 ALA 36 45 45 ALA ALA C . n E 2 37 ARG 37 46 46 ARG ARG C . n E 2 38 ILE 38 47 47 ILE ILE C . n E 2 39 ASN 39 48 48 ASN ASN C . n E 2 40 ILE 40 49 49 ILE ILE C . n E 2 41 SER 41 50 50 SER SER C . n E 2 42 GLU 42 51 51 GLU GLU C . n E 2 43 GLY 43 52 52 GLY GLY C . n E 2 44 ASN 44 53 53 ASN ASN C . n E 2 45 CYS 45 54 54 CYS CYS C . n E 2 46 PRO 46 55 55 PRO PRO C . n E 2 47 GLU 47 56 56 GLU GLU C . n E 2 48 ARG 48 57 57 ARG ARG C . n E 2 49 ILE 49 58 58 ILE ILE C . n E 2 50 ILE 50 59 59 ILE ILE C . n E 2 51 THR 51 60 60 THR THR C . n E 2 52 LEU 52 61 61 LEU LEU C . n E 2 53 ALA 53 62 62 ALA ALA C . n E 2 54 GLY 54 63 63 GLY GLY C . n E 2 55 PRO 55 64 64 PRO PRO C . n E 2 56 THR 56 65 65 THR THR C . n E 2 57 ASN 57 66 66 ASN ASN C . n E 2 58 ALA 58 67 67 ALA ALA C . n E 2 59 ILE 59 68 68 ILE ILE C . n E 2 60 PHE 60 69 69 PHE PHE C . n E 2 61 LYS 61 70 70 LYS LYS C . n E 2 62 ALA 62 71 71 ALA ALA C . n E 2 63 PHE 63 72 72 PHE PHE C . n E 2 64 ALA 64 73 73 ALA ALA C . n E 2 65 MSE 65 74 74 MSE MSE C . n E 2 66 ILE 66 75 75 ILE ILE C . n E 2 67 ILE 67 76 76 ILE ILE C . n E 2 68 ASP 68 77 77 ASP ASP C . n E 2 69 LYS 69 78 78 LYS LYS C . n E 2 70 LEU 70 79 79 LEU LEU C . n E 2 71 GLU 71 80 80 GLU GLU C . n E 2 72 GLU 72 81 81 GLU GLU C . n E 2 73 ASP 73 82 ? ? ? C . n F 2 1 LYS 1 10 ? ? ? D . n F 2 2 ASN 2 11 ? ? ? D . n F 2 3 VAL 3 12 ? ? ? D . n F 2 4 THR 4 13 13 THR THR D . n F 2 5 LEU 5 14 14 LEU LEU D . n F 2 6 THR 6 15 15 THR THR D . n F 2 7 ILE 7 16 16 ILE ILE D . n F 2 8 ARG 8 17 17 ARG ARG D . n F 2 9 LEU 9 18 18 LEU LEU D . n F 2 10 LEU 10 19 19 LEU LEU D . n F 2 11 MSE 11 20 20 MSE MSE D . n F 2 12 HIS 12 21 21 HIS HIS D . n F 2 13 GLY 13 22 22 GLY GLY D . n F 2 14 LYS 14 23 23 LYS LYS D . n F 2 15 GLU 15 24 24 GLU GLU D . n F 2 16 VAL 16 25 25 VAL VAL D . n F 2 17 GLY 17 26 26 GLY GLY D . n F 2 18 SER 18 27 27 SER SER D . n F 2 19 ILE 19 28 28 ILE ILE D . n F 2 20 ILE 20 29 29 ILE ILE D . n F 2 21 GLY 21 30 30 GLY GLY D . n F 2 22 LYS 22 31 31 LYS LYS D . n F 2 23 LYS 23 32 32 LYS LYS D . n F 2 24 GLY 24 33 33 GLY GLY D . n F 2 25 GLU 25 34 34 GLU GLU D . n F 2 26 SER 26 35 35 SER SER D . n F 2 27 VAL 27 36 36 VAL VAL D . n F 2 28 LYS 28 37 37 LYS LYS D . n F 2 29 LYS 29 38 38 LYS LYS D . n F 2 30 MSE 30 39 39 MSE MSE D . n F 2 31 ARG 31 40 40 ARG ARG D . n F 2 32 GLU 32 41 41 GLU GLU D . n F 2 33 GLU 33 42 42 GLU GLU D . n F 2 34 SER 34 43 43 SER SER D . n F 2 35 GLY 35 44 44 GLY GLY D . n F 2 36 ALA 36 45 45 ALA ALA D . n F 2 37 ARG 37 46 46 ARG ARG D . n F 2 38 ILE 38 47 47 ILE ILE D . n F 2 39 ASN 39 48 48 ASN ASN D . n F 2 40 ILE 40 49 49 ILE ILE D . n F 2 41 SER 41 50 50 SER SER D . n F 2 42 GLU 42 51 51 GLU GLU D . n F 2 43 GLY 43 52 52 GLY GLY D . n F 2 44 ASN 44 53 53 ASN ASN D . n F 2 45 CYS 45 54 54 CYS CYS D . n F 2 46 PRO 46 55 55 PRO PRO D . n F 2 47 GLU 47 56 56 GLU GLU D . n F 2 48 ARG 48 57 57 ARG ARG D . n F 2 49 ILE 49 58 58 ILE ILE D . n F 2 50 ILE 50 59 59 ILE ILE D . n F 2 51 THR 51 60 60 THR THR D . n F 2 52 LEU 52 61 61 LEU LEU D . n F 2 53 ALA 53 62 62 ALA ALA D . n F 2 54 GLY 54 63 63 GLY GLY D . n F 2 55 PRO 55 64 64 PRO PRO D . n F 2 56 THR 56 65 65 THR THR D . n F 2 57 ASN 57 66 66 ASN ASN D . n F 2 58 ALA 58 67 67 ALA ALA D . n F 2 59 ILE 59 68 68 ILE ILE D . n F 2 60 PHE 60 69 69 PHE PHE D . n F 2 61 LYS 61 70 70 LYS LYS D . n F 2 62 ALA 62 71 71 ALA ALA D . n F 2 63 PHE 63 72 72 PHE PHE D . n F 2 64 ALA 64 73 73 ALA ALA D . n F 2 65 MSE 65 74 74 MSE MSE D . n F 2 66 ILE 66 75 75 ILE ILE D . n F 2 67 ILE 67 76 76 ILE ILE D . n F 2 68 ASP 68 77 77 ASP ASP D . n F 2 69 LYS 69 78 78 LYS LYS D . n F 2 70 LEU 70 79 79 LEU LEU D . n F 2 71 GLU 71 80 80 GLU GLU D . n F 2 72 GLU 72 81 81 GLU GLU D . n F 2 73 ASP 73 82 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code G 3 HOH 1 22 22 HOH HOH E . G 3 HOH 2 28 28 HOH HOH E . G 3 HOH 3 35 35 HOH HOH E . H 3 HOH 1 13 3 HOH HOH F . H 3 HOH 2 14 24 HOH HOH F . H 3 HOH 3 15 34 HOH HOH F . H 3 HOH 4 16 48 HOH HOH F . I 3 HOH 1 83 2 HOH HOH A . I 3 HOH 2 84 6 HOH HOH A . I 3 HOH 3 85 7 HOH HOH A . I 3 HOH 4 86 14 HOH HOH A . I 3 HOH 5 87 16 HOH HOH A . I 3 HOH 6 88 17 HOH HOH A . I 3 HOH 7 89 37 HOH HOH A . I 3 HOH 8 90 43 HOH HOH A . I 3 HOH 9 91 49 HOH HOH A . J 3 HOH 1 83 4 HOH HOH B . J 3 HOH 2 84 5 HOH HOH B . J 3 HOH 3 85 9 HOH HOH B . J 3 HOH 4 86 11 HOH HOH B . J 3 HOH 5 87 18 HOH HOH B . J 3 HOH 6 88 19 HOH HOH B . J 3 HOH 7 89 20 HOH HOH B . J 3 HOH 8 90 21 HOH HOH B . J 3 HOH 9 91 29 HOH HOH B . J 3 HOH 10 92 32 HOH HOH B . J 3 HOH 11 93 38 HOH HOH B . J 3 HOH 12 94 39 HOH HOH B . J 3 HOH 13 95 40 HOH HOH B . J 3 HOH 14 96 51 HOH HOH B . K 3 HOH 1 83 1 HOH HOH C . K 3 HOH 2 84 8 HOH HOH C . K 3 HOH 3 85 13 HOH HOH C . K 3 HOH 4 86 15 HOH HOH C . K 3 HOH 5 87 26 HOH HOH C . K 3 HOH 6 88 27 HOH HOH C . K 3 HOH 7 89 31 HOH HOH C . K 3 HOH 8 90 41 HOH HOH C . K 3 HOH 9 91 45 HOH HOH C . K 3 HOH 10 92 46 HOH HOH C . K 3 HOH 11 93 47 HOH HOH C . L 3 HOH 1 83 10 HOH HOH D . L 3 HOH 2 84 12 HOH HOH D . L 3 HOH 3 85 23 HOH HOH D . L 3 HOH 4 86 25 HOH HOH D . L 3 HOH 5 87 30 HOH HOH D . L 3 HOH 6 88 33 HOH HOH D . L 3 HOH 7 89 36 HOH HOH D . L 3 HOH 8 90 42 HOH HOH D . L 3 HOH 9 91 44 HOH HOH D . L 3 HOH 10 92 50 HOH HOH D . # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.2.0019 ? 1 Blu-Ice 'data collection' . ? 2 MOSFLM 'data reduction' . ? 3 SCALA 'data scaling' . ? 4 CNS phasing . ? 5 # _cell.entry_id 2PY9 _cell.length_a 92.006 _cell.length_b 58.697 _cell.length_c 71.496 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2PY9 _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? # _exptl.entry_id 2PY9 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.41 _exptl_crystal.density_percent_sol 48.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.1 _exptl_crystal_grow.pdbx_details '25% PEG 8000, 100mM sodium acetate, 100mM sodium cacodylate pH 6.1, VAPOR DIFFUSION, HANGING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range . # loop_ _exptl_crystal_grow_comp.crystal_id _exptl_crystal_grow_comp.id _exptl_crystal_grow_comp.sol_id _exptl_crystal_grow_comp.name _exptl_crystal_grow_comp.volume _exptl_crystal_grow_comp.conc _exptl_crystal_grow_comp.details 1 1 1 'PEG 8000' ? ? ? 1 2 1 'sodium acetate' ? ? ? 1 3 1 'sodium cacodylate' ? ? ? 1 4 2 'PEG 8000' ? ? ? 1 5 2 'sodium acetate' ? ? ? 1 6 2 'sodium cacodylate' ? ? ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2005-01-29 _diffrn_detector.details 'KOHZU: Double Crystal Si(111)' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.11588 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.3.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.3.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.11588 # _reflns.entry_id 2PY9 _reflns.observed_criterion_sigma_F 2.0 _reflns.observed_criterion_sigma_I 2.0 _reflns.d_resolution_high 2.56 _reflns.d_resolution_low 70.1 _reflns.number_all 12378 _reflns.number_obs 11660 _reflns.percent_possible_obs 94.2 _reflns.pdbx_Rmerge_I_obs .102 _reflns.pdbx_Rsym_value .096 _reflns.pdbx_netI_over_sigmaI 14.4 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 10.4 _reflns.R_free_details ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.56 _reflns_shell.d_res_low 2.626 _reflns_shell.percent_possible_all 90.73 _reflns_shell.Rmerge_I_obs .90 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 3.1 _reflns_shell.pdbx_redundancy 9.1 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2PY9 _refine.ls_number_reflns_obs 11656 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I 2.0 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.00 _refine.ls_d_res_high 2.56 _refine.ls_percent_reflns_obs 94.21 _refine.ls_R_factor_obs 0.22038 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.21798 _refine.ls_R_factor_R_free 0.26862 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.8 _refine.ls_number_reflns_R_free 591 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.941 _refine.correlation_coeff_Fo_to_Fc_free 0.916 _refine.B_iso_mean 38.229 _refine.aniso_B[1][1] -1.61 _refine.aniso_B[2][2] -0.13 _refine.aniso_B[3][3] 1.74 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.966 _refine.pdbx_overall_ESU_R_Free 0.342 _refine.overall_SU_ML 0.256 _refine.overall_SU_B 19.899 _refine.ls_redundancy_reflns_obs ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2132 _refine_hist.pdbx_number_atoms_nucleic_acid 490 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 51 _refine_hist.number_atoms_total 2673 _refine_hist.d_res_high 2.56 _refine_hist.d_res_low 40.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.032 0.022 ? 2692 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 3.306 2.228 ? 3704 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 8.475 5.000 ? 275 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 45.400 24.286 ? 77 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 24.300 15.000 ? 458 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 27.656 15.000 ? 16 'X-RAY DIFFRACTION' ? r_chiral_restr 0.155 0.200 ? 454 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.011 0.020 ? 1736 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.286 0.200 ? 1124 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.338 0.200 ? 1816 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.173 0.200 ? 111 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.321 0.200 ? 73 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.140 0.200 ? 7 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.553 1.500 ? 1422 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.139 2.000 ? 2213 'X-RAY DIFFRACTION' ? r_scbond_it 3.420 3.000 ? 1500 'X-RAY DIFFRACTION' ? r_scangle_it 5.004 4.500 ? 1491 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_restr_ncs.dom_id _refine_ls_restr_ncs.pdbx_auth_asym_id _refine_ls_restr_ncs.pdbx_number _refine_ls_restr_ncs.rms_dev_position _refine_ls_restr_ncs.weight_position _refine_ls_restr_ncs.pdbx_type _refine_ls_restr_ncs.ncs_model_details _refine_ls_restr_ncs.rms_dev_B_iso _refine_ls_restr_ncs.weight_B_iso _refine_ls_restr_ncs.pdbx_rms _refine_ls_restr_ncs.pdbx_weight _refine_ls_restr_ncs.pdbx_ens_id _refine_ls_restr_ncs.pdbx_refine_id _refine_ls_restr_ncs.pdbx_ordinal _refine_ls_restr_ncs.pdbx_asym_id 1 A 517 0.43 0.05 'tight positional' ? ? ? ? ? 1 'X-RAY DIFFRACTION' 1 ? 1 C 517 0.41 0.05 'tight positional' ? ? ? ? ? 2 'X-RAY DIFFRACTION' 2 ? 1 A 517 0.50 0.50 'tight thermal' ? ? ? ? ? 1 'X-RAY DIFFRACTION' 3 ? 1 C 517 0.64 0.50 'tight thermal' ? ? ? ? ? 2 'X-RAY DIFFRACTION' 4 ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.560 _refine_ls_shell.d_res_low 2.626 _refine_ls_shell.number_reflns_R_work 785 _refine_ls_shell.R_factor_R_work 0.365 _refine_ls_shell.percent_reflns_obs 90.73 _refine_ls_shell.R_factor_R_free 0.469 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 47 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _struct_ncs_dom.pdbx_ens_id _struct_ncs_dom.id _struct_ncs_dom.details 1 1 A 1 2 B 2 1 C 2 2 D # loop_ _struct_ncs_dom_lim.pdbx_ens_id _struct_ncs_dom_lim.dom_id _struct_ncs_dom_lim.pdbx_component_id _struct_ncs_dom_lim.beg_label_asym_id _struct_ncs_dom_lim.beg_label_comp_id _struct_ncs_dom_lim.beg_label_seq_id _struct_ncs_dom_lim.beg_label_alt_id _struct_ncs_dom_lim.end_label_asym_id _struct_ncs_dom_lim.end_label_comp_id _struct_ncs_dom_lim.end_label_seq_id _struct_ncs_dom_lim.end_label_alt_id _struct_ncs_dom_lim.beg_auth_asym_id _struct_ncs_dom_lim.beg_auth_comp_id _struct_ncs_dom_lim.beg_auth_seq_id _struct_ncs_dom_lim.end_auth_asym_id _struct_ncs_dom_lim.end_auth_comp_id _struct_ncs_dom_lim.end_auth_seq_id _struct_ncs_dom_lim.pdbx_refine_code _struct_ncs_dom_lim.selection_details 1 1 1 C THR 4 . C GLU 71 . A THR 13 A GLU 80 1 ? 1 2 1 D THR 4 . D GLU 71 . B THR 13 B GLU 80 1 ? 2 1 1 E THR 4 . E GLU 71 . C THR 13 C GLU 80 1 ? 2 2 1 F THR 4 . F GLU 71 . D THR 13 D GLU 80 1 ? # loop_ _struct_ncs_ens.id _struct_ncs_ens.details 1 ? 2 ? # _database_PDB_matrix.entry_id 2PY9 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2PY9 _struct.title 'Protein-RNA Interaction involving KH1 domain from Human Poly(C)-Binding Protein-2' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2PY9 _struct_keywords.pdbx_keywords 'RNA AND DNA binding protein/RNA' _struct_keywords.text 'PROTEIN-RNA COMPLEX, RNA AND DNA binding protein-RNA COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 2 ? G N N 3 ? H N N 3 ? I N N 3 ? J N N 3 ? K N N 3 ? L N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP PCBP2_HUMAN Q15366 2 NVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLEED 11 ? 2 PDB 2PY9 2PY9 1 ? ? ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2PY9 A 2 ? 73 ? Q15366 11 ? 82 ? 11 82 2 1 2PY9 B 2 ? 73 ? Q15366 11 ? 82 ? 11 82 3 1 2PY9 C 2 ? 73 ? Q15366 11 ? 82 ? 11 82 4 1 2PY9 D 2 ? 73 ? Q15366 11 ? 82 ? 11 82 5 2 2PY9 E 1 ? 12 ? 2PY9 1 ? 12 ? 1 12 6 2 2PY9 F 1 ? 12 ? 2PY9 1 ? 12 ? 1 12 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2PY9 LYS A 1 ? UNP Q15366 ? ? 'cloning artifact' 10 1 1 2PY9 MSE A 11 ? UNP Q15366 MET 20 'modified residue' 20 2 1 2PY9 MSE A 30 ? UNP Q15366 MET 39 'modified residue' 39 3 1 2PY9 MSE A 65 ? UNP Q15366 MET 74 'modified residue' 74 4 2 2PY9 LYS B 1 ? UNP Q15366 ? ? 'cloning artifact' 10 5 2 2PY9 MSE B 11 ? UNP Q15366 MET 20 'modified residue' 20 6 2 2PY9 MSE B 30 ? UNP Q15366 MET 39 'modified residue' 39 7 2 2PY9 MSE B 65 ? UNP Q15366 MET 74 'modified residue' 74 8 3 2PY9 LYS C 1 ? UNP Q15366 ? ? 'cloning artifact' 10 9 3 2PY9 MSE C 11 ? UNP Q15366 MET 20 'modified residue' 20 10 3 2PY9 MSE C 30 ? UNP Q15366 MET 39 'modified residue' 39 11 3 2PY9 MSE C 65 ? UNP Q15366 MET 74 'modified residue' 74 12 4 2PY9 LYS D 1 ? UNP Q15366 ? ? 'cloning artifact' 10 13 4 2PY9 MSE D 11 ? UNP Q15366 MET 20 'modified residue' 20 14 4 2PY9 MSE D 30 ? UNP Q15366 MET 39 'modified residue' 39 15 4 2PY9 MSE D 65 ? UNP Q15366 MET 74 'modified residue' 74 16 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_defined_assembly ? trimeric 3 2 author_defined_assembly ? trimeric 3 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,C,D,G,I,J 2 1 B,E,F,H,K,L # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_biol.id _struct_biol.details 1 ;biological assembly is 2 homo-dimers binding to 2 independent strands of RNA. One homo-dimer is present in the asymmetric unit. The others are generated via the two-fold axis. ; 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY C 13 ? GLY C 21 ? GLY A 22 GLY A 30 1 ? 9 HELX_P HELX_P2 2 GLY C 24 ? GLY C 35 ? GLY A 33 GLY A 44 1 ? 12 HELX_P HELX_P3 3 THR C 56 ? GLU C 71 ? THR A 65 GLU A 80 1 ? 16 HELX_P HELX_P4 4 GLY D 13 ? GLY D 21 ? GLY B 22 GLY B 30 1 ? 9 HELX_P HELX_P5 5 GLY D 24 ? GLY D 35 ? GLY B 33 GLY B 44 1 ? 12 HELX_P HELX_P6 6 PRO D 55 ? GLU D 72 ? PRO B 64 GLU B 81 1 ? 18 HELX_P HELX_P7 7 GLY E 13 ? GLY E 21 ? GLY C 22 GLY C 30 1 ? 9 HELX_P HELX_P8 8 GLY E 24 ? GLY E 35 ? GLY C 33 GLY C 44 1 ? 12 HELX_P HELX_P9 9 PRO E 55 ? GLU E 72 ? PRO C 64 GLU C 81 1 ? 18 HELX_P HELX_P10 10 HIS F 12 ? GLU F 15 ? HIS D 21 GLU D 24 5 ? 4 HELX_P HELX_P11 11 VAL F 16 ? GLY F 21 ? VAL D 25 GLY D 30 1 ? 6 HELX_P HELX_P12 12 GLY F 24 ? GLY F 35 ? GLY D 33 GLY D 44 1 ? 12 HELX_P HELX_P13 13 PRO F 55 ? GLU F 72 ? PRO D 64 GLU D 81 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? C LEU 10 C ? ? ? 1_555 C MSE 11 N ? ? A LEU 19 A MSE 20 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale2 covale both ? C MSE 11 C ? ? ? 1_555 C HIS 12 N ? ? A MSE 20 A HIS 21 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale3 covale both ? C LYS 29 C ? ? ? 1_555 C MSE 30 N ? ? A LYS 38 A MSE 39 1_555 ? ? ? ? ? ? ? 1.313 ? ? covale4 covale both ? C MSE 30 C ? ? ? 1_555 C ARG 31 N ? ? A MSE 39 A ARG 40 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale5 covale both ? C ALA 64 C ? ? ? 1_555 C MSE 65 N ? ? A ALA 73 A MSE 74 1_555 ? ? ? ? ? ? ? 1.345 ? ? covale6 covale both ? C MSE 65 C ? ? ? 1_555 C ILE 66 N ? ? A MSE 74 A ILE 75 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale7 covale both ? D LEU 10 C ? ? ? 1_555 D MSE 11 N ? ? B LEU 19 B MSE 20 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale8 covale both ? D MSE 11 C ? ? ? 1_555 D HIS 12 N ? ? B MSE 20 B HIS 21 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale9 covale both ? D LYS 29 C ? ? ? 1_555 D MSE 30 N ? ? B LYS 38 B MSE 39 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale10 covale both ? D MSE 30 C ? ? ? 1_555 D ARG 31 N ? ? B MSE 39 B ARG 40 1_555 ? ? ? ? ? ? ? 1.348 ? ? covale11 covale both ? D ALA 64 C ? ? ? 1_555 D MSE 65 N ? ? B ALA 73 B MSE 74 1_555 ? ? ? ? ? ? ? 1.321 ? ? covale12 covale both ? D MSE 65 C ? ? ? 1_555 D ILE 66 N ? ? B MSE 74 B ILE 75 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale13 covale both ? E LEU 10 C ? ? ? 1_555 E MSE 11 N ? ? C LEU 19 C MSE 20 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale14 covale both ? E MSE 11 C ? ? ? 1_555 E HIS 12 N ? ? C MSE 20 C HIS 21 1_555 ? ? ? ? ? ? ? 1.327 ? ? covale15 covale both ? E LYS 29 C ? ? ? 1_555 E MSE 30 N ? ? C LYS 38 C MSE 39 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale16 covale both ? E MSE 30 C ? ? ? 1_555 E ARG 31 N ? ? C MSE 39 C ARG 40 1_555 ? ? ? ? ? ? ? 1.335 ? ? covale17 covale both ? E ALA 64 C ? ? ? 1_555 E MSE 65 N ? ? C ALA 73 C MSE 74 1_555 ? ? ? ? ? ? ? 1.309 ? ? covale18 covale both ? E MSE 65 C ? ? ? 1_555 E ILE 66 N ? ? C MSE 74 C ILE 75 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale19 covale both ? F LEU 10 C ? ? ? 1_555 F MSE 11 N ? ? D LEU 19 D MSE 20 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale20 covale both ? F MSE 11 C ? ? ? 1_555 F HIS 12 N ? ? D MSE 20 D HIS 21 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale21 covale both ? F LYS 29 C ? ? ? 1_555 F MSE 30 N ? ? D LYS 38 D MSE 39 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale22 covale both ? F MSE 30 C ? ? ? 1_555 F ARG 31 N ? ? D MSE 39 D ARG 40 1_555 ? ? ? ? ? ? ? 1.320 ? ? covale23 covale both ? F ALA 64 C ? ? ? 1_555 F MSE 65 N ? ? D ALA 73 D MSE 74 1_555 ? ? ? ? ? ? ? 1.353 ? ? covale24 covale both ? F MSE 65 C ? ? ? 1_555 F ILE 66 N ? ? D MSE 74 D ILE 75 1_555 ? ? ? ? ? ? ? 1.311 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE C 11 ? . . . . MSE A 20 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE C 30 ? . . . . MSE A 39 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE C 65 ? . . . . MSE A 74 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE D 11 ? . . . . MSE B 20 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE D 30 ? . . . . MSE B 39 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 MSE D 65 ? . . . . MSE B 74 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 7 MSE E 11 ? . . . . MSE C 20 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 8 MSE E 30 ? . . . . MSE C 39 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 9 MSE E 65 ? . . . . MSE C 74 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 10 MSE F 11 ? . . . . MSE D 20 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 11 MSE F 30 ? . . . . MSE D 39 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 12 MSE F 65 ? . . . . MSE D 74 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 3 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG C 37 ? ILE C 40 ? ARG A 46 ILE A 49 A 2 GLU C 47 ? PRO C 55 ? GLU A 56 PRO A 64 A 3 THR C 4 ? HIS C 12 ? THR A 13 HIS A 21 A 4 LEU D 5 ? HIS D 12 ? LEU B 14 HIS B 21 A 5 GLU D 47 ? GLY D 54 ? GLU B 56 GLY B 63 A 6 ARG D 37 ? ILE D 40 ? ARG B 46 ILE B 49 B 1 LEU E 5 ? HIS E 12 ? LEU C 14 HIS C 21 B 2 GLU E 47 ? GLY E 54 ? GLU C 56 GLY C 63 B 3 ARG E 37 ? ILE E 40 ? ARG C 46 ILE C 49 C 1 LEU F 5 ? MSE F 11 ? LEU D 14 MSE D 20 C 2 ARG F 48 ? GLY F 54 ? ARG D 57 GLY D 63 C 3 ARG F 37 ? ILE F 40 ? ARG D 46 ILE D 49 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASN C 39 ? N ASN A 48 O THR C 51 ? O THR A 60 A 2 3 O ARG C 48 ? O ARG A 57 N MSE C 11 ? N MSE A 20 A 3 4 N ARG C 8 ? N ARG A 17 O LEU D 10 ? O LEU B 19 A 4 5 N LEU D 9 ? N LEU B 18 O ILE D 50 ? O ILE B 59 A 5 6 O ALA D 53 ? O ALA B 62 N ARG D 37 ? N ARG B 46 B 1 2 N MSE E 11 ? N MSE C 20 O ARG E 48 ? O ARG C 57 B 2 3 O ALA E 53 ? O ALA C 62 N ARG E 37 ? N ARG C 46 C 1 2 N MSE F 11 ? N MSE D 20 O ARG F 48 ? O ARG D 57 C 2 3 O ALA F 53 ? O ALA D 62 N ARG F 37 ? N ARG D 46 # _pdbx_entry_details.entry_id 2PY9 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 P E A 2 ? ? "O5'" E A 2 ? ? 1.679 1.593 0.086 0.010 N 2 1 "C2'" E C 4 ? ? "C1'" E C 4 ? ? 1.477 1.526 -0.049 0.008 N 3 1 "O5'" E A 8 ? ? "C5'" E A 8 ? ? 1.539 1.440 0.099 0.016 N 4 1 P E C 9 ? ? "O5'" E C 9 ? ? 1.655 1.593 0.062 0.010 N 5 1 "O3'" E C 9 ? ? "C3'" E C 9 ? ? 1.530 1.427 0.103 0.012 N 6 1 C2 F U 6 ? ? N3 F U 6 ? ? 1.424 1.373 0.051 0.007 N 7 1 N7 F A 7 ? ? C8 F A 7 ? ? 1.353 1.311 0.042 0.007 N 8 1 C6 F A 8 ? ? N1 F A 8 ? ? 1.405 1.351 0.054 0.007 N 9 1 N9 F A 8 ? ? C4 F A 8 ? ? 1.430 1.374 0.056 0.006 N 10 1 N1 F C 9 ? ? C2 F C 9 ? ? 1.470 1.397 0.073 0.010 N 11 1 CG A GLU 41 ? ? CD A GLU 41 ? ? 1.647 1.515 0.132 0.015 N 12 1 CZ A ARG 46 ? ? NH2 A ARG 46 ? ? 1.241 1.326 -0.085 0.013 N 13 1 CB A CYS 54 ? ? SG A CYS 54 ? ? 1.641 1.812 -0.171 0.016 N 14 1 CB B ARG 46 ? ? CG B ARG 46 ? ? 1.344 1.521 -0.177 0.027 N 15 1 CZ B ARG 46 ? ? NH2 B ARG 46 ? ? 1.245 1.326 -0.081 0.013 N 16 1 CB B CYS 54 ? ? SG B CYS 54 ? ? 1.678 1.812 -0.134 0.016 N 17 1 CG C GLU 34 ? ? CD C GLU 34 ? ? 1.610 1.515 0.095 0.015 N 18 1 CB C GLU 51 ? ? CG C GLU 51 ? ? 1.398 1.517 -0.119 0.019 N 19 1 CG C GLU 51 ? ? CD C GLU 51 ? ? 1.419 1.515 -0.096 0.015 N 20 1 CB C GLU 56 ? ? CG C GLU 56 ? ? 1.390 1.517 -0.127 0.019 N 21 1 CB D GLU 51 ? ? CG D GLU 51 ? ? 1.333 1.517 -0.184 0.019 N 22 1 CB D CYS 54 ? ? SG D CYS 54 ? ? 1.682 1.812 -0.130 0.016 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 "C5'" E A 1 ? ? "C4'" E A 1 ? ? "O4'" E A 1 ? ? 115.49 109.80 5.69 0.90 N 2 1 "C3'" E A 1 ? ? "C2'" E A 1 ? ? "C1'" E A 1 ? ? 92.92 101.30 -8.38 0.70 N 3 1 N9 E A 1 ? ? "C1'" E A 1 ? ? "C2'" E A 1 ? ? 124.43 114.00 10.43 1.30 N 4 1 "C3'" E A 1 ? ? "O3'" E A 1 ? ? P E A 2 ? ? 130.17 119.70 10.47 1.20 Y 5 1 "O5'" E A 2 ? ? P E A 2 ? ? OP2 E A 2 ? ? 117.94 110.70 7.24 1.20 N 6 1 P E A 2 ? ? "O5'" E A 2 ? ? "C5'" E A 2 ? ? 133.17 120.90 12.27 1.60 N 7 1 "C3'" E A 2 ? ? "C2'" E A 2 ? ? "C1'" E A 2 ? ? 91.77 101.30 -9.53 0.70 N 8 1 "O4'" E A 2 ? ? "C1'" E A 2 ? ? N9 E A 2 ? ? 118.50 108.50 10.00 0.70 N 9 1 N1 E A 2 ? ? C6 E A 2 ? ? N6 E A 2 ? ? 122.78 118.60 4.18 0.60 N 10 1 "C5'" E C 3 ? ? "C4'" E C 3 ? ? "O4'" E C 3 ? ? 115.78 109.80 5.98 0.90 N 11 1 "O4'" E C 3 ? ? "C1'" E C 3 ? ? N1 E C 3 ? ? 114.67 108.50 6.17 0.70 N 12 1 C4 E C 3 ? ? C5 E C 3 ? ? C6 E C 3 ? ? 113.93 117.40 -3.47 0.50 N 13 1 C5 E C 3 ? ? C6 E C 3 ? ? N1 E C 3 ? ? 124.82 121.00 3.82 0.50 N 14 1 N1 E C 3 ? ? C2 E C 3 ? ? O2 E C 3 ? ? 123.58 118.90 4.68 0.60 N 15 1 C6 E C 4 ? ? N1 E C 4 ? ? C2 E C 4 ? ? 123.13 120.30 2.83 0.40 N 16 1 N1 E C 4 ? ? C2 E C 4 ? ? O2 E C 4 ? ? 125.89 118.90 6.99 0.60 N 17 1 "C5'" E C 5 ? ? "C4'" E C 5 ? ? "C3'" E C 5 ? ? 105.95 115.20 -9.25 1.40 N 18 1 "C3'" E C 5 ? ? "C2'" E C 5 ? ? "C1'" E C 5 ? ? 110.03 101.50 8.53 0.80 N 19 1 "O4'" E C 5 ? ? "C1'" E C 5 ? ? N1 E C 5 ? ? 113.35 108.50 4.85 0.70 N 20 1 N1 E C 5 ? ? C2 E C 5 ? ? O2 E C 5 ? ? 125.12 118.90 6.22 0.60 N 21 1 N3 E C 5 ? ? C2 E C 5 ? ? O2 E C 5 ? ? 116.14 121.90 -5.76 0.70 N 22 1 "C3'" E C 5 ? ? "O3'" E C 5 ? ? P E U 6 ? ? 127.25 119.70 7.55 1.20 Y 23 1 "O5'" E U 6 ? ? P E U 6 ? ? OP2 E U 6 ? ? 100.16 105.70 -5.54 0.90 N 24 1 "O5'" E U 6 ? ? "C5'" E U 6 ? ? "C4'" E U 6 ? ? 103.92 109.40 -5.48 0.80 N 25 1 C4 E U 6 ? ? C5 E U 6 ? ? C6 E U 6 ? ? 114.85 119.70 -4.85 0.60 N 26 1 C5 E U 6 ? ? C6 E U 6 ? ? N1 E U 6 ? ? 126.23 122.70 3.53 0.50 N 27 1 "C5'" E A 7 ? ? "C4'" E A 7 ? ? "O4'" E A 7 ? ? 115.69 109.80 5.89 0.90 N 28 1 "C3'" E A 7 ? ? "C2'" E A 7 ? ? "C1'" E A 7 ? ? 106.54 101.50 5.04 0.80 N 29 1 "O4'" E A 7 ? ? "C1'" E A 7 ? ? "C2'" E A 7 ? ? 99.80 105.80 -6.00 1.00 N 30 1 C6 E A 7 ? ? N1 E A 7 ? ? C2 E A 7 ? ? 114.92 118.60 -3.68 0.60 N 31 1 "O5'" E A 8 ? ? P E A 8 ? ? OP1 E A 8 ? ? 99.20 105.70 -6.50 0.90 N 32 1 "O4'" E A 8 ? ? "C1'" E A 8 ? ? N9 E A 8 ? ? 114.33 108.50 5.83 0.70 N 33 1 N1 E A 8 ? ? C6 E A 8 ? ? N6 E A 8 ? ? 114.81 118.60 -3.79 0.60 N 34 1 "O5'" E C 9 ? ? P E C 9 ? ? OP2 E C 9 ? ? 123.10 110.70 12.40 1.20 N 35 1 "C5'" E C 9 ? ? "C4'" E C 9 ? ? "O4'" E C 9 ? ? 118.08 109.80 8.28 0.90 N 36 1 "C4'" E C 9 ? ? "C3'" E C 9 ? ? "C2'" E C 9 ? ? 95.34 102.60 -7.26 1.00 N 37 1 "O4'" E C 9 ? ? "C1'" E C 9 ? ? N1 E C 9 ? ? 112.86 108.50 4.36 0.70 N 38 1 N1 E C 9 ? ? C2 E C 9 ? ? N3 E C 9 ? ? 113.20 119.20 -6.00 0.70 N 39 1 C2 E C 9 ? ? N3 E C 9 ? ? C4 E C 9 ? ? 123.05 119.90 3.15 0.50 N 40 1 C5 E C 9 ? ? C6 E C 9 ? ? N1 E C 9 ? ? 124.01 121.00 3.01 0.50 N 41 1 N1 E C 9 ? ? C2 E C 9 ? ? O2 E C 9 ? ? 123.29 118.90 4.39 0.60 N 42 1 OP1 E C 10 ? ? P E C 10 ? ? OP2 E C 10 ? ? 130.81 119.60 11.21 1.50 N 43 1 "O5'" E C 10 ? ? P E C 10 ? ? OP2 E C 10 ? ? 88.34 105.70 -17.36 0.90 N 44 1 "C5'" E C 10 ? ? "C4'" E C 10 ? ? "O4'" E C 10 ? ? 99.89 109.10 -9.21 1.20 N 45 1 "C1'" E C 10 ? ? "O4'" E C 10 ? ? "C4'" E C 10 ? ? 115.78 109.90 5.88 0.80 N 46 1 "O4'" E C 10 ? ? "C1'" E C 10 ? ? "C2'" E C 10 ? ? 91.36 105.80 -14.44 1.00 N 47 1 "O4'" E C 10 ? ? "C1'" E C 10 ? ? N1 E C 10 ? ? 102.87 108.20 -5.33 0.80 N 48 1 C6 E C 10 ? ? N1 E C 10 ? ? "C1'" E C 10 ? ? 113.20 120.80 -7.60 1.20 N 49 1 C2 E C 10 ? ? N1 E C 10 ? ? "C1'" E C 10 ? ? 128.04 118.80 9.24 1.10 N 50 1 OP1 E C 11 ? ? P E C 11 ? ? OP2 E C 11 ? ? 129.84 119.60 10.24 1.50 N 51 1 "O5'" E C 11 ? ? "C5'" E C 11 ? ? "C4'" E C 11 ? ? 100.44 109.40 -8.96 0.80 N 52 1 "C4'" E C 11 ? ? "C3'" E C 11 ? ? "C2'" E C 11 ? ? 91.84 102.60 -10.76 1.00 N 53 1 "O4'" E C 11 ? ? "C1'" E C 11 ? ? "C2'" E C 11 ? ? 99.48 105.80 -6.32 1.00 N 54 1 N1 E C 11 ? ? "C1'" E C 11 ? ? "C2'" E C 11 ? ? 124.67 114.00 10.67 1.30 N 55 1 "O4'" E C 11 ? ? "C1'" E C 11 ? ? N1 E C 11 ? ? 115.20 108.50 6.70 0.70 N 56 1 C6 E C 11 ? ? N1 E C 11 ? ? C2 E C 11 ? ? 117.86 120.30 -2.44 0.40 N 57 1 C2 E C 11 ? ? N3 E C 11 ? ? C4 E C 11 ? ? 123.16 119.90 3.26 0.50 N 58 1 N1 E C 11 ? ? C2 E C 11 ? ? O2 E C 11 ? ? 124.22 118.90 5.32 0.60 N 59 1 "O5'" E U 12 ? ? P E U 12 ? ? OP2 E U 12 ? ? 99.90 105.70 -5.80 0.90 N 60 1 "C5'" E U 12 ? ? "C4'" E U 12 ? ? "O4'" E U 12 ? ? 117.69 109.80 7.89 0.90 N 61 1 "C3'" E U 12 ? ? "C2'" E U 12 ? ? "C1'" E U 12 ? ? 106.46 101.50 4.96 0.80 N 62 1 "O4'" E U 12 ? ? "C1'" E U 12 ? ? N1 E U 12 ? ? 116.33 108.50 7.83 0.70 N 63 1 "O4'" F A 1 ? ? "C1'" F A 1 ? ? N9 F A 1 ? ? 113.24 108.50 4.74 0.70 N 64 1 "O4'" F A 2 ? ? "C1'" F A 2 ? ? N9 F A 2 ? ? 115.62 108.50 7.12 0.70 N 65 1 "O5'" F C 3 ? ? "C5'" F C 3 ? ? "C4'" F C 3 ? ? 102.27 109.40 -7.13 0.80 N 66 1 "C5'" F C 3 ? ? "C4'" F C 3 ? ? "O4'" F C 3 ? ? 116.56 109.80 6.76 0.90 N 67 1 "O4'" F C 3 ? ? "C1'" F C 3 ? ? N1 F C 3 ? ? 114.05 108.50 5.55 0.70 N 68 1 N3 F C 3 ? ? C4 F C 3 ? ? C5 F C 3 ? ? 124.75 121.90 2.85 0.40 N 69 1 C4 F C 3 ? ? C5 F C 3 ? ? C6 F C 3 ? ? 113.87 117.40 -3.53 0.50 N 70 1 N1 F C 3 ? ? C2 F C 3 ? ? O2 F C 3 ? ? 113.49 118.90 -5.41 0.60 N 71 1 N3 F C 3 ? ? C2 F C 3 ? ? O2 F C 3 ? ? 126.79 121.90 4.89 0.70 N 72 1 C5 F C 3 ? ? C4 F C 3 ? ? N4 F C 3 ? ? 114.08 120.20 -6.12 0.70 N 73 1 "C4'" F C 4 ? ? "C3'" F C 4 ? ? "C2'" F C 4 ? ? 91.35 102.60 -11.25 1.00 N 74 1 "O4'" F C 4 ? ? "C1'" F C 4 ? ? "C2'" F C 4 ? ? 96.43 105.80 -9.37 1.00 N 75 1 "O4'" F C 4 ? ? "C1'" F C 4 ? ? N1 F C 4 ? ? 120.42 108.50 11.92 0.70 N 76 1 "O3'" F C 5 ? ? P F U 6 ? ? "O5'" F U 6 ? ? 115.88 104.00 11.88 1.90 Y 77 1 OP1 F U 6 ? ? P F U 6 ? ? OP2 F U 6 ? ? 129.16 119.60 9.56 1.50 N 78 1 "O5'" F U 6 ? ? "C5'" F U 6 ? ? "C4'" F U 6 ? ? 104.27 109.40 -5.13 0.80 N 79 1 "C3'" F U 6 ? ? "C2'" F U 6 ? ? "C1'" F U 6 ? ? 107.05 101.50 5.55 0.80 N 80 1 "O4'" F U 6 ? ? "C1'" F U 6 ? ? N1 F U 6 ? ? 115.79 108.50 7.29 0.70 N 81 1 "C1'" F U 6 ? ? "C2'" F U 6 ? ? "O2'" F U 6 ? ? 92.25 110.60 -18.35 3.00 N 82 1 C4 F U 6 ? ? C5 F U 6 ? ? C6 F U 6 ? ? 116.04 119.70 -3.66 0.60 N 83 1 C5 F U 6 ? ? C6 F U 6 ? ? N1 F U 6 ? ? 128.02 122.70 5.32 0.50 N 84 1 N3 F U 6 ? ? C2 F U 6 ? ? O2 F U 6 ? ? 127.77 122.20 5.57 0.70 N 85 1 N3 F U 6 ? ? C4 F U 6 ? ? O4 F U 6 ? ? 124.08 119.40 4.68 0.70 N 86 1 C5 F U 6 ? ? C4 F U 6 ? ? O4 F U 6 ? ? 121.44 125.90 -4.46 0.60 N 87 1 "C5'" F A 7 ? ? "C4'" F A 7 ? ? "O4'" F A 7 ? ? 122.84 109.80 13.04 0.90 N 88 1 "O4'" F A 8 ? ? "C1'" F A 8 ? ? N9 F A 8 ? ? 112.74 108.50 4.24 0.70 N 89 1 N1 F A 8 ? ? C2 F A 8 ? ? N3 F A 8 ? ? 123.77 129.30 -5.53 0.50 N 90 1 C2 F A 8 ? ? N3 F A 8 ? ? C4 F A 8 ? ? 113.72 110.60 3.12 0.50 N 91 1 N1 F A 8 ? ? C6 F A 8 ? ? N6 F A 8 ? ? 122.99 118.60 4.39 0.60 N 92 1 "C3'" F A 8 ? ? "O3'" F A 8 ? ? P F C 9 ? ? 129.23 119.70 9.53 1.20 Y 93 1 "C3'" F C 9 ? ? "C2'" F C 9 ? ? "C1'" F C 9 ? ? 107.79 101.50 6.29 0.80 N 94 1 "O4'" F C 9 ? ? "C1'" F C 9 ? ? "C2'" F C 9 ? ? 98.94 105.80 -6.86 1.00 N 95 1 N3 F C 9 ? ? C4 F C 9 ? ? C5 F C 9 ? ? 125.76 121.90 3.86 0.40 N 96 1 N1 F C 9 ? ? C2 F C 9 ? ? O2 F C 9 ? ? 124.16 118.90 5.26 0.60 N 97 1 C5 F C 9 ? ? C4 F C 9 ? ? N4 F C 9 ? ? 114.12 120.20 -6.08 0.70 N 98 1 C6 F C 9 ? ? N1 F C 9 ? ? "C1'" F C 9 ? ? 111.60 120.80 -9.20 1.20 N 99 1 C2 F C 9 ? ? N1 F C 9 ? ? "C1'" F C 9 ? ? 125.86 118.80 7.06 1.10 N 100 1 "O5'" F C 10 ? ? P F C 10 ? ? OP2 F C 10 ? ? 99.71 105.70 -5.99 0.90 N 101 1 "O5'" F C 10 ? ? "C5'" F C 10 ? ? "C4'" F C 10 ? ? 103.31 109.40 -6.09 0.80 N 102 1 C6 F C 10 ? ? N1 F C 10 ? ? C2 F C 10 ? ? 117.79 120.30 -2.51 0.40 N 103 1 C5 F C 10 ? ? C6 F C 10 ? ? N1 F C 10 ? ? 126.60 121.00 5.60 0.50 N 104 1 OP1 F C 11 ? ? P F C 11 ? ? OP2 F C 11 ? ? 137.33 119.60 17.73 1.50 N 105 1 "C5'" F C 11 ? ? "C4'" F C 11 ? ? "O4'" F C 11 ? ? 116.47 109.80 6.67 0.90 N 106 1 "C3'" F C 11 ? ? "C2'" F C 11 ? ? "C1'" F C 11 ? ? 107.45 101.50 5.95 0.80 N 107 1 N1 F C 11 ? ? "C1'" F C 11 ? ? "C2'" F C 11 ? ? 101.96 112.00 -10.04 1.10 N 108 1 "O4'" F C 11 ? ? "C1'" F C 11 ? ? N1 F C 11 ? ? 118.86 108.50 10.36 0.70 N 109 1 C4 F C 11 ? ? C5 F C 11 ? ? C6 F C 11 ? ? 121.06 117.40 3.66 0.50 N 110 1 P F U 12 ? ? "O5'" F U 12 ? ? "C5'" F U 12 ? ? 131.69 120.90 10.79 1.60 N 111 1 "C5'" F U 12 ? ? "C4'" F U 12 ? ? "O4'" F U 12 ? ? 118.16 109.80 8.36 0.90 N 112 1 C4 F U 12 ? ? C5 F U 12 ? ? C6 F U 12 ? ? 115.21 119.70 -4.49 0.60 N 113 1 C5 F U 12 ? ? C6 F U 12 ? ? N1 F U 12 ? ? 127.92 122.70 5.22 0.50 N 114 1 NE A ARG 40 ? ? CZ A ARG 40 ? ? NH1 A ARG 40 ? ? 124.09 120.30 3.79 0.50 N 115 1 NE A ARG 46 ? ? CZ A ARG 46 ? ? NH2 A ARG 46 ? ? 125.03 120.30 4.73 0.50 N 116 1 CD A LYS 78 ? ? CE A LYS 78 ? ? NZ A LYS 78 ? ? 94.10 111.70 -17.60 2.30 N 117 1 OE1 B GLU 34 ? ? CD B GLU 34 ? ? OE2 B GLU 34 ? ? 115.50 123.30 -7.80 1.20 N 118 1 CB B ARG 46 ? ? CG B ARG 46 ? ? CD B ARG 46 ? ? 94.92 111.60 -16.68 2.60 N 119 1 NE B ARG 46 ? ? CZ B ARG 46 ? ? NH1 B ARG 46 ? ? 127.05 120.30 6.75 0.50 N 120 1 NE B ARG 46 ? ? CZ B ARG 46 ? ? NH2 B ARG 46 ? ? 116.38 120.30 -3.92 0.50 N 121 1 CG1 B ILE 68 ? ? CB B ILE 68 ? ? CG2 B ILE 68 ? ? 97.06 111.40 -14.34 2.20 N 122 1 NE C ARG 40 ? ? CZ C ARG 40 ? ? NH1 C ARG 40 ? ? 123.43 120.30 3.13 0.50 N 123 1 NE C ARG 46 ? ? CZ C ARG 46 ? ? NH1 C ARG 46 ? ? 115.18 120.30 -5.12 0.50 N 124 1 NE C ARG 46 ? ? CZ C ARG 46 ? ? NH2 C ARG 46 ? ? 125.33 120.30 5.03 0.50 N 125 1 CB C PHE 69 ? ? CG C PHE 69 ? ? CD2 C PHE 69 ? ? 114.73 120.80 -6.07 0.70 N 126 1 CB C PHE 69 ? ? CG C PHE 69 ? ? CD1 C PHE 69 ? ? 126.51 120.80 5.71 0.70 N 127 1 CB D LEU 18 ? ? CG D LEU 18 ? ? CD1 D LEU 18 ? ? 100.63 111.00 -10.37 1.70 N 128 1 CB D LEU 19 ? ? CG D LEU 19 ? ? CD1 D LEU 19 ? ? 99.04 111.00 -11.96 1.70 N 129 1 CD D LYS 37 ? ? CE D LYS 37 ? ? NZ D LYS 37 ? ? 96.76 111.70 -14.94 2.30 N 130 1 CA D GLU 56 ? ? CB D GLU 56 ? ? CG D GLU 56 ? ? 98.30 113.40 -15.10 2.20 N 131 1 CB D PHE 69 ? ? CG D PHE 69 ? ? CD2 D PHE 69 ? ? 125.34 120.80 4.54 0.70 N 132 1 CB D PHE 69 ? ? CG D PHE 69 ? ? CD1 D PHE 69 ? ? 115.12 120.80 -5.68 0.70 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 11 ? ? -20.17 134.25 2 1 ASN A 53 ? ? -80.48 39.18 3 1 THR A 65 ? ? -28.36 -46.44 4 1 LYS B 31 ? ? -50.38 108.93 5 1 LYS C 23 ? ? -39.87 -35.74 6 1 LYS D 32 ? ? 65.62 -0.83 # loop_ _pdbx_validate_peptide_omega.id _pdbx_validate_peptide_omega.PDB_model_num _pdbx_validate_peptide_omega.auth_comp_id_1 _pdbx_validate_peptide_omega.auth_asym_id_1 _pdbx_validate_peptide_omega.auth_seq_id_1 _pdbx_validate_peptide_omega.PDB_ins_code_1 _pdbx_validate_peptide_omega.label_alt_id_1 _pdbx_validate_peptide_omega.auth_comp_id_2 _pdbx_validate_peptide_omega.auth_asym_id_2 _pdbx_validate_peptide_omega.auth_seq_id_2 _pdbx_validate_peptide_omega.PDB_ins_code_2 _pdbx_validate_peptide_omega.label_alt_id_2 _pdbx_validate_peptide_omega.omega 1 1 GLY D 52 ? ? ASN D 53 ? ? -31.39 2 1 ASN D 53 ? ? CYS D 54 ? ? -40.91 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 C MSE 11 A MSE 20 ? MET SELENOMETHIONINE 2 C MSE 30 A MSE 39 ? MET SELENOMETHIONINE 3 C MSE 65 A MSE 74 ? MET SELENOMETHIONINE 4 D MSE 11 B MSE 20 ? MET SELENOMETHIONINE 5 D MSE 30 B MSE 39 ? MET SELENOMETHIONINE 6 D MSE 65 B MSE 74 ? MET SELENOMETHIONINE 7 E MSE 11 C MSE 20 ? MET SELENOMETHIONINE 8 E MSE 30 C MSE 39 ? MET SELENOMETHIONINE 9 E MSE 65 C MSE 74 ? MET SELENOMETHIONINE 10 F MSE 11 D MSE 20 ? MET SELENOMETHIONINE 11 F MSE 30 D MSE 39 ? MET SELENOMETHIONINE 12 F MSE 65 D MSE 74 ? MET SELENOMETHIONINE # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.pdbx_refine_id 1 ? refined -4.1489 -16.5473 9.2691 0.0269 -0.0097 0.1744 0.0219 0.0546 0.1263 3.2547 2.6140 2.5880 -1.0291 0.1942 1.6461 0.1900 0.4052 0.7385 -0.1125 -0.2173 -0.0744 0.0024 -0.0923 0.0273 'X-RAY DIFFRACTION' 2 ? refined 1.3077 -16.8950 27.2324 0.0262 0.0072 0.1380 -0.0344 -0.0090 -0.1231 4.0203 2.3005 2.9544 -0.9427 -0.8409 -0.9326 0.1552 -0.4144 0.7049 0.0716 0.0711 -0.1594 0.0236 0.2817 -0.2263 'X-RAY DIFFRACTION' 3 ? refined 16.0620 -10.4995 -15.6771 0.0521 0.1665 -0.0358 0.0087 -0.0163 -0.0138 5.9347 2.4919 0.8001 0.2890 0.3153 1.1991 -0.0207 -0.4211 -0.3001 0.0624 -0.1206 0.0519 0.0632 -0.2328 0.1413 'X-RAY DIFFRACTION' 4 ? refined -17.9453 -7.5794 52.0541 -0.0259 0.1112 0.0598 0.1049 0.0662 0.0404 1.8898 5.2771 4.4422 0.0571 0.3511 0.3335 -0.0978 0.2101 -0.5348 0.1256 -0.0049 0.1822 0.2143 0.0362 0.1028 'X-RAY DIFFRACTION' 5 ? refined 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 'X-RAY DIFFRACTION' 6 ? refined 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 0.0000 'X-RAY DIFFRACTION' # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.selection_details 1 1 A 13 C 4 A 80 C 71 ? 'X-RAY DIFFRACTION' ? 2 2 B 13 D 4 B 80 D 71 ? 'X-RAY DIFFRACTION' ? 3 3 C 13 E 4 C 80 E 71 ? 'X-RAY DIFFRACTION' ? 4 4 D 13 F 4 D 80 F 71 ? 'X-RAY DIFFRACTION' ? 5 5 E 1 A 1 E 12 A 12 ? 'X-RAY DIFFRACTION' ? 6 6 F 1 B 1 F 12 B 12 ? 'X-RAY DIFFRACTION' ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ASP 82 ? C ASP 73 2 1 Y 1 B LYS 10 ? D LYS 1 3 1 Y 1 B ASN 11 ? D ASN 2 4 1 Y 1 B VAL 12 ? D VAL 3 5 1 Y 1 B ASP 82 ? D ASP 73 6 1 Y 1 C LYS 10 ? E LYS 1 7 1 Y 1 C ASN 11 ? E ASN 2 8 1 Y 1 C VAL 12 ? E VAL 3 9 1 Y 1 C ASP 82 ? E ASP 73 10 1 Y 1 D LYS 10 ? F LYS 1 11 1 Y 1 D ASN 11 ? F ASN 2 12 1 Y 1 D VAL 12 ? F VAL 3 13 1 Y 1 D ASP 82 ? F ASP 73 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A OP3 O N N 1 A P P N N 2 A OP1 O N N 3 A OP2 O N N 4 A "O5'" O N N 5 A "C5'" C N N 6 A "C4'" C N R 7 A "O4'" O N N 8 A "C3'" C N S 9 A "O3'" O N N 10 A "C2'" C N R 11 A "O2'" O N N 12 A "C1'" C N R 13 A N9 N Y N 14 A C8 C Y N 15 A N7 N Y N 16 A C5 C Y N 17 A C6 C Y N 18 A N6 N N N 19 A N1 N Y N 20 A C2 C Y N 21 A N3 N Y N 22 A C4 C Y N 23 A HOP3 H N N 24 A HOP2 H N N 25 A "H5'" H N N 26 A "H5''" H N N 27 A "H4'" H N N 28 A "H3'" H N N 29 A "HO3'" H N N 30 A "H2'" H N N 31 A "HO2'" H N N 32 A "H1'" H N N 33 A H8 H N N 34 A H61 H N N 35 A H62 H N N 36 A H2 H N N 37 ALA N N N N 38 ALA CA C N S 39 ALA C C N N 40 ALA O O N N 41 ALA CB C N N 42 ALA OXT O N N 43 ALA H H N N 44 ALA H2 H N N 45 ALA HA H N N 46 ALA HB1 H N N 47 ALA HB2 H N N 48 ALA HB3 H N N 49 ALA HXT H N N 50 ARG N N N N 51 ARG CA C N S 52 ARG C C N N 53 ARG O O N N 54 ARG CB C N N 55 ARG CG C N N 56 ARG CD C N N 57 ARG NE N N N 58 ARG CZ C N N 59 ARG NH1 N N N 60 ARG NH2 N N N 61 ARG OXT O N N 62 ARG H H N N 63 ARG H2 H N N 64 ARG HA H N N 65 ARG HB2 H N N 66 ARG HB3 H N N 67 ARG HG2 H N N 68 ARG HG3 H N N 69 ARG HD2 H N N 70 ARG HD3 H N N 71 ARG HE H N N 72 ARG HH11 H N N 73 ARG HH12 H N N 74 ARG HH21 H N N 75 ARG HH22 H N N 76 ARG HXT H N N 77 ASN N N N N 78 ASN CA C N S 79 ASN C C N N 80 ASN O O N N 81 ASN CB C N N 82 ASN CG C N N 83 ASN OD1 O N N 84 ASN ND2 N N N 85 ASN OXT O N N 86 ASN H H N N 87 ASN H2 H N N 88 ASN HA H N N 89 ASN HB2 H N N 90 ASN HB3 H N N 91 ASN HD21 H N N 92 ASN HD22 H N N 93 ASN HXT H N N 94 ASP N N N N 95 ASP CA C N S 96 ASP C C N N 97 ASP O O N N 98 ASP CB C N N 99 ASP CG C N N 100 ASP OD1 O N N 101 ASP OD2 O N N 102 ASP OXT O N N 103 ASP H H N N 104 ASP H2 H N N 105 ASP HA H N N 106 ASP HB2 H N N 107 ASP HB3 H N N 108 ASP HD2 H N N 109 ASP HXT H N N 110 C OP3 O N N 111 C P P N N 112 C OP1 O N N 113 C OP2 O N N 114 C "O5'" O N N 115 C "C5'" C N N 116 C "C4'" C N R 117 C "O4'" O N N 118 C "C3'" C N S 119 C "O3'" O N N 120 C "C2'" C N R 121 C "O2'" O N N 122 C "C1'" C N R 123 C N1 N N N 124 C C2 C N N 125 C O2 O N N 126 C N3 N N N 127 C C4 C N N 128 C N4 N N N 129 C C5 C N N 130 C C6 C N N 131 C HOP3 H N N 132 C HOP2 H N N 133 C "H5'" H N N 134 C "H5''" H N N 135 C "H4'" H N N 136 C "H3'" H N N 137 C "HO3'" H N N 138 C "H2'" H N N 139 C "HO2'" H N N 140 C "H1'" H N N 141 C H41 H N N 142 C H42 H N N 143 C H5 H N N 144 C H6 H N N 145 CYS N N N N 146 CYS CA C N R 147 CYS C C N N 148 CYS O O N N 149 CYS CB C N N 150 CYS SG S N N 151 CYS OXT O N N 152 CYS H H N N 153 CYS H2 H N N 154 CYS HA H N N 155 CYS HB2 H N N 156 CYS HB3 H N N 157 CYS HG H N N 158 CYS HXT H N N 159 GLU N N N N 160 GLU CA C N S 161 GLU C C N N 162 GLU O O N N 163 GLU CB C N N 164 GLU CG C N N 165 GLU CD C N N 166 GLU OE1 O N N 167 GLU OE2 O N N 168 GLU OXT O N N 169 GLU H H N N 170 GLU H2 H N N 171 GLU HA H N N 172 GLU HB2 H N N 173 GLU HB3 H N N 174 GLU HG2 H N N 175 GLU HG3 H N N 176 GLU HE2 H N N 177 GLU HXT H N N 178 GLY N N N N 179 GLY CA C N N 180 GLY C C N N 181 GLY O O N N 182 GLY OXT O N N 183 GLY H H N N 184 GLY H2 H N N 185 GLY HA2 H N N 186 GLY HA3 H N N 187 GLY HXT H N N 188 HIS N N N N 189 HIS CA C N S 190 HIS C C N N 191 HIS O O N N 192 HIS CB C N N 193 HIS CG C Y N 194 HIS ND1 N Y N 195 HIS CD2 C Y N 196 HIS CE1 C Y N 197 HIS NE2 N Y N 198 HIS OXT O N N 199 HIS H H N N 200 HIS H2 H N N 201 HIS HA H N N 202 HIS HB2 H N N 203 HIS HB3 H N N 204 HIS HD1 H N N 205 HIS HD2 H N N 206 HIS HE1 H N N 207 HIS HE2 H N N 208 HIS HXT H N N 209 HOH O O N N 210 HOH H1 H N N 211 HOH H2 H N N 212 ILE N N N N 213 ILE CA C N S 214 ILE C C N N 215 ILE O O N N 216 ILE CB C N S 217 ILE CG1 C N N 218 ILE CG2 C N N 219 ILE CD1 C N N 220 ILE OXT O N N 221 ILE H H N N 222 ILE H2 H N N 223 ILE HA H N N 224 ILE HB H N N 225 ILE HG12 H N N 226 ILE HG13 H N N 227 ILE HG21 H N N 228 ILE HG22 H N N 229 ILE HG23 H N N 230 ILE HD11 H N N 231 ILE HD12 H N N 232 ILE HD13 H N N 233 ILE HXT H N N 234 LEU N N N N 235 LEU CA C N S 236 LEU C C N N 237 LEU O O N N 238 LEU CB C N N 239 LEU CG C N N 240 LEU CD1 C N N 241 LEU CD2 C N N 242 LEU OXT O N N 243 LEU H H N N 244 LEU H2 H N N 245 LEU HA H N N 246 LEU HB2 H N N 247 LEU HB3 H N N 248 LEU HG H N N 249 LEU HD11 H N N 250 LEU HD12 H N N 251 LEU HD13 H N N 252 LEU HD21 H N N 253 LEU HD22 H N N 254 LEU HD23 H N N 255 LEU HXT H N N 256 LYS N N N N 257 LYS CA C N S 258 LYS C C N N 259 LYS O O N N 260 LYS CB C N N 261 LYS CG C N N 262 LYS CD C N N 263 LYS CE C N N 264 LYS NZ N N N 265 LYS OXT O N N 266 LYS H H N N 267 LYS H2 H N N 268 LYS HA H N N 269 LYS HB2 H N N 270 LYS HB3 H N N 271 LYS HG2 H N N 272 LYS HG3 H N N 273 LYS HD2 H N N 274 LYS HD3 H N N 275 LYS HE2 H N N 276 LYS HE3 H N N 277 LYS HZ1 H N N 278 LYS HZ2 H N N 279 LYS HZ3 H N N 280 LYS HXT H N N 281 MET N N N N 282 MET CA C N S 283 MET C C N N 284 MET O O N N 285 MET CB C N N 286 MET CG C N N 287 MET SD S N N 288 MET CE C N N 289 MET OXT O N N 290 MET H H N N 291 MET H2 H N N 292 MET HA H N N 293 MET HB2 H N N 294 MET HB3 H N N 295 MET HG2 H N N 296 MET HG3 H N N 297 MET HE1 H N N 298 MET HE2 H N N 299 MET HE3 H N N 300 MET HXT H N N 301 MSE N N N N 302 MSE CA C N S 303 MSE C C N N 304 MSE O O N N 305 MSE OXT O N N 306 MSE CB C N N 307 MSE CG C N N 308 MSE SE SE N N 309 MSE CE C N N 310 MSE H H N N 311 MSE H2 H N N 312 MSE HA H N N 313 MSE HXT H N N 314 MSE HB2 H N N 315 MSE HB3 H N N 316 MSE HG2 H N N 317 MSE HG3 H N N 318 MSE HE1 H N N 319 MSE HE2 H N N 320 MSE HE3 H N N 321 PHE N N N N 322 PHE CA C N S 323 PHE C C N N 324 PHE O O N N 325 PHE CB C N N 326 PHE CG C Y N 327 PHE CD1 C Y N 328 PHE CD2 C Y N 329 PHE CE1 C Y N 330 PHE CE2 C Y N 331 PHE CZ C Y N 332 PHE OXT O N N 333 PHE H H N N 334 PHE H2 H N N 335 PHE HA H N N 336 PHE HB2 H N N 337 PHE HB3 H N N 338 PHE HD1 H N N 339 PHE HD2 H N N 340 PHE HE1 H N N 341 PHE HE2 H N N 342 PHE HZ H N N 343 PHE HXT H N N 344 PRO N N N N 345 PRO CA C N S 346 PRO C C N N 347 PRO O O N N 348 PRO CB C N N 349 PRO CG C N N 350 PRO CD C N N 351 PRO OXT O N N 352 PRO H H N N 353 PRO HA H N N 354 PRO HB2 H N N 355 PRO HB3 H N N 356 PRO HG2 H N N 357 PRO HG3 H N N 358 PRO HD2 H N N 359 PRO HD3 H N N 360 PRO HXT H N N 361 SER N N N N 362 SER CA C N S 363 SER C C N N 364 SER O O N N 365 SER CB C N N 366 SER OG O N N 367 SER OXT O N N 368 SER H H N N 369 SER H2 H N N 370 SER HA H N N 371 SER HB2 H N N 372 SER HB3 H N N 373 SER HG H N N 374 SER HXT H N N 375 THR N N N N 376 THR CA C N S 377 THR C C N N 378 THR O O N N 379 THR CB C N R 380 THR OG1 O N N 381 THR CG2 C N N 382 THR OXT O N N 383 THR H H N N 384 THR H2 H N N 385 THR HA H N N 386 THR HB H N N 387 THR HG1 H N N 388 THR HG21 H N N 389 THR HG22 H N N 390 THR HG23 H N N 391 THR HXT H N N 392 U OP3 O N N 393 U P P N N 394 U OP1 O N N 395 U OP2 O N N 396 U "O5'" O N N 397 U "C5'" C N N 398 U "C4'" C N R 399 U "O4'" O N N 400 U "C3'" C N S 401 U "O3'" O N N 402 U "C2'" C N R 403 U "O2'" O N N 404 U "C1'" C N R 405 U N1 N N N 406 U C2 C N N 407 U O2 O N N 408 U N3 N N N 409 U C4 C N N 410 U O4 O N N 411 U C5 C N N 412 U C6 C N N 413 U HOP3 H N N 414 U HOP2 H N N 415 U "H5'" H N N 416 U "H5''" H N N 417 U "H4'" H N N 418 U "H3'" H N N 419 U "HO3'" H N N 420 U "H2'" H N N 421 U "HO2'" H N N 422 U "H1'" H N N 423 U H3 H N N 424 U H5 H N N 425 U H6 H N N 426 VAL N N N N 427 VAL CA C N S 428 VAL C C N N 429 VAL O O N N 430 VAL CB C N N 431 VAL CG1 C N N 432 VAL CG2 C N N 433 VAL OXT O N N 434 VAL H H N N 435 VAL H2 H N N 436 VAL HA H N N 437 VAL HB H N N 438 VAL HG11 H N N 439 VAL HG12 H N N 440 VAL HG13 H N N 441 VAL HG21 H N N 442 VAL HG22 H N N 443 VAL HG23 H N N 444 VAL HXT H N N 445 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A OP3 P sing N N 1 A OP3 HOP3 sing N N 2 A P OP1 doub N N 3 A P OP2 sing N N 4 A P "O5'" sing N N 5 A OP2 HOP2 sing N N 6 A "O5'" "C5'" sing N N 7 A "C5'" "C4'" sing N N 8 A "C5'" "H5'" sing N N 9 A "C5'" "H5''" sing N N 10 A "C4'" "O4'" sing N N 11 A "C4'" "C3'" sing N N 12 A "C4'" "H4'" sing N N 13 A "O4'" "C1'" sing N N 14 A "C3'" "O3'" sing N N 15 A "C3'" "C2'" sing N N 16 A "C3'" "H3'" sing N N 17 A "O3'" "HO3'" sing N N 18 A "C2'" "O2'" sing N N 19 A "C2'" "C1'" sing N N 20 A "C2'" "H2'" sing N N 21 A "O2'" "HO2'" sing N N 22 A "C1'" N9 sing N N 23 A "C1'" "H1'" sing N N 24 A N9 C8 sing Y N 25 A N9 C4 sing Y N 26 A C8 N7 doub Y N 27 A C8 H8 sing N N 28 A N7 C5 sing Y N 29 A C5 C6 sing Y N 30 A C5 C4 doub Y N 31 A C6 N6 sing N N 32 A C6 N1 doub Y N 33 A N6 H61 sing N N 34 A N6 H62 sing N N 35 A N1 C2 sing Y N 36 A C2 N3 doub Y N 37 A C2 H2 sing N N 38 A N3 C4 sing Y N 39 ALA N CA sing N N 40 ALA N H sing N N 41 ALA N H2 sing N N 42 ALA CA C sing N N 43 ALA CA CB sing N N 44 ALA CA HA sing N N 45 ALA C O doub N N 46 ALA C OXT sing N N 47 ALA CB HB1 sing N N 48 ALA CB HB2 sing N N 49 ALA CB HB3 sing N N 50 ALA OXT HXT sing N N 51 ARG N CA sing N N 52 ARG N H sing N N 53 ARG N H2 sing N N 54 ARG CA C sing N N 55 ARG CA CB sing N N 56 ARG CA HA sing N N 57 ARG C O doub N N 58 ARG C OXT sing N N 59 ARG CB CG sing N N 60 ARG CB HB2 sing N N 61 ARG CB HB3 sing N N 62 ARG CG CD sing N N 63 ARG CG HG2 sing N N 64 ARG CG HG3 sing N N 65 ARG CD NE sing N N 66 ARG CD HD2 sing N N 67 ARG CD HD3 sing N N 68 ARG NE CZ sing N N 69 ARG NE HE sing N N 70 ARG CZ NH1 sing N N 71 ARG CZ NH2 doub N N 72 ARG NH1 HH11 sing N N 73 ARG NH1 HH12 sing N N 74 ARG NH2 HH21 sing N N 75 ARG NH2 HH22 sing N N 76 ARG OXT HXT sing N N 77 ASN N CA sing N N 78 ASN N H sing N N 79 ASN N H2 sing N N 80 ASN CA C sing N N 81 ASN CA CB sing N N 82 ASN CA HA sing N N 83 ASN C O doub N N 84 ASN C OXT sing N N 85 ASN CB CG sing N N 86 ASN CB HB2 sing N N 87 ASN CB HB3 sing N N 88 ASN CG OD1 doub N N 89 ASN CG ND2 sing N N 90 ASN ND2 HD21 sing N N 91 ASN ND2 HD22 sing N N 92 ASN OXT HXT sing N N 93 ASP N CA sing N N 94 ASP N H sing N N 95 ASP N H2 sing N N 96 ASP CA C sing N N 97 ASP CA CB sing N N 98 ASP CA HA sing N N 99 ASP C O doub N N 100 ASP C OXT sing N N 101 ASP CB CG sing N N 102 ASP CB HB2 sing N N 103 ASP CB HB3 sing N N 104 ASP CG OD1 doub N N 105 ASP CG OD2 sing N N 106 ASP OD2 HD2 sing N N 107 ASP OXT HXT sing N N 108 C OP3 P sing N N 109 C OP3 HOP3 sing N N 110 C P OP1 doub N N 111 C P OP2 sing N N 112 C P "O5'" sing N N 113 C OP2 HOP2 sing N N 114 C "O5'" "C5'" sing N N 115 C "C5'" "C4'" sing N N 116 C "C5'" "H5'" sing N N 117 C "C5'" "H5''" sing N N 118 C "C4'" "O4'" sing N N 119 C "C4'" "C3'" sing N N 120 C "C4'" "H4'" sing N N 121 C "O4'" "C1'" sing N N 122 C "C3'" "O3'" sing N N 123 C "C3'" "C2'" sing N N 124 C "C3'" "H3'" sing N N 125 C "O3'" "HO3'" sing N N 126 C "C2'" "O2'" sing N N 127 C "C2'" "C1'" sing N N 128 C "C2'" "H2'" sing N N 129 C "O2'" "HO2'" sing N N 130 C "C1'" N1 sing N N 131 C "C1'" "H1'" sing N N 132 C N1 C2 sing N N 133 C N1 C6 sing N N 134 C C2 O2 doub N N 135 C C2 N3 sing N N 136 C N3 C4 doub N N 137 C C4 N4 sing N N 138 C C4 C5 sing N N 139 C N4 H41 sing N N 140 C N4 H42 sing N N 141 C C5 C6 doub N N 142 C C5 H5 sing N N 143 C C6 H6 sing N N 144 CYS N CA sing N N 145 CYS N H sing N N 146 CYS N H2 sing N N 147 CYS CA C sing N N 148 CYS CA CB sing N N 149 CYS CA HA sing N N 150 CYS C O doub N N 151 CYS C OXT sing N N 152 CYS CB SG sing N N 153 CYS CB HB2 sing N N 154 CYS CB HB3 sing N N 155 CYS SG HG sing N N 156 CYS OXT HXT sing N N 157 GLU N CA sing N N 158 GLU N H sing N N 159 GLU N H2 sing N N 160 GLU CA C sing N N 161 GLU CA CB sing N N 162 GLU CA HA sing N N 163 GLU C O doub N N 164 GLU C OXT sing N N 165 GLU CB CG sing N N 166 GLU CB HB2 sing N N 167 GLU CB HB3 sing N N 168 GLU CG CD sing N N 169 GLU CG HG2 sing N N 170 GLU CG HG3 sing N N 171 GLU CD OE1 doub N N 172 GLU CD OE2 sing N N 173 GLU OE2 HE2 sing N N 174 GLU OXT HXT sing N N 175 GLY N CA sing N N 176 GLY N H sing N N 177 GLY N H2 sing N N 178 GLY CA C sing N N 179 GLY CA HA2 sing N N 180 GLY CA HA3 sing N N 181 GLY C O doub N N 182 GLY C OXT sing N N 183 GLY OXT HXT sing N N 184 HIS N CA sing N N 185 HIS N H sing N N 186 HIS N H2 sing N N 187 HIS CA C sing N N 188 HIS CA CB sing N N 189 HIS CA HA sing N N 190 HIS C O doub N N 191 HIS C OXT sing N N 192 HIS CB CG sing N N 193 HIS CB HB2 sing N N 194 HIS CB HB3 sing N N 195 HIS CG ND1 sing Y N 196 HIS CG CD2 doub Y N 197 HIS ND1 CE1 doub Y N 198 HIS ND1 HD1 sing N N 199 HIS CD2 NE2 sing Y N 200 HIS CD2 HD2 sing N N 201 HIS CE1 NE2 sing Y N 202 HIS CE1 HE1 sing N N 203 HIS NE2 HE2 sing N N 204 HIS OXT HXT sing N N 205 HOH O H1 sing N N 206 HOH O H2 sing N N 207 ILE N CA sing N N 208 ILE N H sing N N 209 ILE N H2 sing N N 210 ILE CA C sing N N 211 ILE CA CB sing N N 212 ILE CA HA sing N N 213 ILE C O doub N N 214 ILE C OXT sing N N 215 ILE CB CG1 sing N N 216 ILE CB CG2 sing N N 217 ILE CB HB sing N N 218 ILE CG1 CD1 sing N N 219 ILE CG1 HG12 sing N N 220 ILE CG1 HG13 sing N N 221 ILE CG2 HG21 sing N N 222 ILE CG2 HG22 sing N N 223 ILE CG2 HG23 sing N N 224 ILE CD1 HD11 sing N N 225 ILE CD1 HD12 sing N N 226 ILE CD1 HD13 sing N N 227 ILE OXT HXT sing N N 228 LEU N CA sing N N 229 LEU N H sing N N 230 LEU N H2 sing N N 231 LEU CA C sing N N 232 LEU CA CB sing N N 233 LEU CA HA sing N N 234 LEU C O doub N N 235 LEU C OXT sing N N 236 LEU CB CG sing N N 237 LEU CB HB2 sing N N 238 LEU CB HB3 sing N N 239 LEU CG CD1 sing N N 240 LEU CG CD2 sing N N 241 LEU CG HG sing N N 242 LEU CD1 HD11 sing N N 243 LEU CD1 HD12 sing N N 244 LEU CD1 HD13 sing N N 245 LEU CD2 HD21 sing N N 246 LEU CD2 HD22 sing N N 247 LEU CD2 HD23 sing N N 248 LEU OXT HXT sing N N 249 LYS N CA sing N N 250 LYS N H sing N N 251 LYS N H2 sing N N 252 LYS CA C sing N N 253 LYS CA CB sing N N 254 LYS CA HA sing N N 255 LYS C O doub N N 256 LYS C OXT sing N N 257 LYS CB CG sing N N 258 LYS CB HB2 sing N N 259 LYS CB HB3 sing N N 260 LYS CG CD sing N N 261 LYS CG HG2 sing N N 262 LYS CG HG3 sing N N 263 LYS CD CE sing N N 264 LYS CD HD2 sing N N 265 LYS CD HD3 sing N N 266 LYS CE NZ sing N N 267 LYS CE HE2 sing N N 268 LYS CE HE3 sing N N 269 LYS NZ HZ1 sing N N 270 LYS NZ HZ2 sing N N 271 LYS NZ HZ3 sing N N 272 LYS OXT HXT sing N N 273 MET N CA sing N N 274 MET N H sing N N 275 MET N H2 sing N N 276 MET CA C sing N N 277 MET CA CB sing N N 278 MET CA HA sing N N 279 MET C O doub N N 280 MET C OXT sing N N 281 MET CB CG sing N N 282 MET CB HB2 sing N N 283 MET CB HB3 sing N N 284 MET CG SD sing N N 285 MET CG HG2 sing N N 286 MET CG HG3 sing N N 287 MET SD CE sing N N 288 MET CE HE1 sing N N 289 MET CE HE2 sing N N 290 MET CE HE3 sing N N 291 MET OXT HXT sing N N 292 MSE N CA sing N N 293 MSE N H sing N N 294 MSE N H2 sing N N 295 MSE CA C sing N N 296 MSE CA CB sing N N 297 MSE CA HA sing N N 298 MSE C O doub N N 299 MSE C OXT sing N N 300 MSE OXT HXT sing N N 301 MSE CB CG sing N N 302 MSE CB HB2 sing N N 303 MSE CB HB3 sing N N 304 MSE CG SE sing N N 305 MSE CG HG2 sing N N 306 MSE CG HG3 sing N N 307 MSE SE CE sing N N 308 MSE CE HE1 sing N N 309 MSE CE HE2 sing N N 310 MSE CE HE3 sing N N 311 PHE N CA sing N N 312 PHE N H sing N N 313 PHE N H2 sing N N 314 PHE CA C sing N N 315 PHE CA CB sing N N 316 PHE CA HA sing N N 317 PHE C O doub N N 318 PHE C OXT sing N N 319 PHE CB CG sing N N 320 PHE CB HB2 sing N N 321 PHE CB HB3 sing N N 322 PHE CG CD1 doub Y N 323 PHE CG CD2 sing Y N 324 PHE CD1 CE1 sing Y N 325 PHE CD1 HD1 sing N N 326 PHE CD2 CE2 doub Y N 327 PHE CD2 HD2 sing N N 328 PHE CE1 CZ doub Y N 329 PHE CE1 HE1 sing N N 330 PHE CE2 CZ sing Y N 331 PHE CE2 HE2 sing N N 332 PHE CZ HZ sing N N 333 PHE OXT HXT sing N N 334 PRO N CA sing N N 335 PRO N CD sing N N 336 PRO N H sing N N 337 PRO CA C sing N N 338 PRO CA CB sing N N 339 PRO CA HA sing N N 340 PRO C O doub N N 341 PRO C OXT sing N N 342 PRO CB CG sing N N 343 PRO CB HB2 sing N N 344 PRO CB HB3 sing N N 345 PRO CG CD sing N N 346 PRO CG HG2 sing N N 347 PRO CG HG3 sing N N 348 PRO CD HD2 sing N N 349 PRO CD HD3 sing N N 350 PRO OXT HXT sing N N 351 SER N CA sing N N 352 SER N H sing N N 353 SER N H2 sing N N 354 SER CA C sing N N 355 SER CA CB sing N N 356 SER CA HA sing N N 357 SER C O doub N N 358 SER C OXT sing N N 359 SER CB OG sing N N 360 SER CB HB2 sing N N 361 SER CB HB3 sing N N 362 SER OG HG sing N N 363 SER OXT HXT sing N N 364 THR N CA sing N N 365 THR N H sing N N 366 THR N H2 sing N N 367 THR CA C sing N N 368 THR CA CB sing N N 369 THR CA HA sing N N 370 THR C O doub N N 371 THR C OXT sing N N 372 THR CB OG1 sing N N 373 THR CB CG2 sing N N 374 THR CB HB sing N N 375 THR OG1 HG1 sing N N 376 THR CG2 HG21 sing N N 377 THR CG2 HG22 sing N N 378 THR CG2 HG23 sing N N 379 THR OXT HXT sing N N 380 U OP3 P sing N N 381 U OP3 HOP3 sing N N 382 U P OP1 doub N N 383 U P OP2 sing N N 384 U P "O5'" sing N N 385 U OP2 HOP2 sing N N 386 U "O5'" "C5'" sing N N 387 U "C5'" "C4'" sing N N 388 U "C5'" "H5'" sing N N 389 U "C5'" "H5''" sing N N 390 U "C4'" "O4'" sing N N 391 U "C4'" "C3'" sing N N 392 U "C4'" "H4'" sing N N 393 U "O4'" "C1'" sing N N 394 U "C3'" "O3'" sing N N 395 U "C3'" "C2'" sing N N 396 U "C3'" "H3'" sing N N 397 U "O3'" "HO3'" sing N N 398 U "C2'" "O2'" sing N N 399 U "C2'" "C1'" sing N N 400 U "C2'" "H2'" sing N N 401 U "O2'" "HO2'" sing N N 402 U "C1'" N1 sing N N 403 U "C1'" "H1'" sing N N 404 U N1 C2 sing N N 405 U N1 C6 sing N N 406 U C2 O2 doub N N 407 U C2 N3 sing N N 408 U N3 C4 sing N N 409 U N3 H3 sing N N 410 U C4 O4 doub N N 411 U C4 C5 sing N N 412 U C5 C6 doub N N 413 U C5 H5 sing N N 414 U C6 H6 sing N N 415 VAL N CA sing N N 416 VAL N H sing N N 417 VAL N H2 sing N N 418 VAL CA C sing N N 419 VAL CA CB sing N N 420 VAL CA HA sing N N 421 VAL C O doub N N 422 VAL C OXT sing N N 423 VAL CB CG1 sing N N 424 VAL CB CG2 sing N N 425 VAL CB HB sing N N 426 VAL CG1 HG11 sing N N 427 VAL CG1 HG12 sing N N 428 VAL CG1 HG13 sing N N 429 VAL CG2 HG21 sing N N 430 VAL CG2 HG22 sing N N 431 VAL CG2 HG23 sing N N 432 VAL OXT HXT sing N N 433 # _atom_sites.entry_id 2PY9 _atom_sites.fract_transf_matrix[1][1] 0.010869 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017037 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013987 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S SE # loop_