data_2Q37 # _entry.id 2Q37 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2Q37 RCSB RCSB043091 WWPDB D_1000043091 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2Q37 _pdbx_database_status.recvd_initial_deposition_date 2007-05-30 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # _audit_author.name 'Kim, K.' _audit_author.pdbx_ordinal 1 # _citation.id primary _citation.title 'Structural and functional basis for (s)-allantoin formation in the ureide pathway.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 282 _citation.page_first 23457 _citation.page_last 23464 _citation.year 2007 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 17567580 _citation.pdbx_database_id_DOI 10.1074/jbc.M703211200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Kim, K.' 1 primary 'Park, J.' 2 primary 'Rhee, S.' 3 # _cell.entry_id 2Q37 _cell.length_a 73.582 _cell.length_b 73.582 _cell.length_c 69.647 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2Q37 _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'OHCU decarboxylase' 20837.164 1 ? ? 'residues 1-161' ? 2 non-polymer syn '1-[(4S)-2,5-DIOXOIMIDAZOLIDIN-4-YL]UREA' 158.115 1 ? ? ? ? 3 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Transthyretin-like protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GSSHHHHHSSGENLYFQGH(MSE)A(MSE)EIGEDEWKVCCGSSEFAKQ(MSE)STSGPLTSQEAIYTARDIWFN QVNVTDWLEAFSAHPQIGNTPSPSINSDFARRSVSEQSTAFATTSASALQELAEWNVLYKKKFGFIFIICASGRTHAE (MSE)LHALKERYENRPIVELEIAA(MSE)EQ(MSE)KITELR(MSE)AKLFSDK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHSSGENLYFQGHMAMEIGEDEWKVCCGSSEFAKQMSTSGPLTSQEAIYTARDIWFNQVNVTDWLEAFSAHPQ IGNTPSPSINSDFARRSVSEQSTAFATTSASALQELAEWNVLYKKKFGFIFIICASGRTHAEMLHALKERYENRPIVELE IAAMEQMKITELRMAKLFSDK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 SER n 1 11 SER n 1 12 GLY n 1 13 GLU n 1 14 ASN n 1 15 LEU n 1 16 TYR n 1 17 PHE n 1 18 GLN n 1 19 GLY n 1 20 HIS n 1 21 MSE n 1 22 ALA n 1 23 MSE n 1 24 GLU n 1 25 ILE n 1 26 GLY n 1 27 GLU n 1 28 ASP n 1 29 GLU n 1 30 TRP n 1 31 LYS n 1 32 VAL n 1 33 CYS n 1 34 CYS n 1 35 GLY n 1 36 SER n 1 37 SER n 1 38 GLU n 1 39 PHE n 1 40 ALA n 1 41 LYS n 1 42 GLN n 1 43 MSE n 1 44 SER n 1 45 THR n 1 46 SER n 1 47 GLY n 1 48 PRO n 1 49 LEU n 1 50 THR n 1 51 SER n 1 52 GLN n 1 53 GLU n 1 54 ALA n 1 55 ILE n 1 56 TYR n 1 57 THR n 1 58 ALA n 1 59 ARG n 1 60 ASP n 1 61 ILE n 1 62 TRP n 1 63 PHE n 1 64 ASN n 1 65 GLN n 1 66 VAL n 1 67 ASN n 1 68 VAL n 1 69 THR n 1 70 ASP n 1 71 TRP n 1 72 LEU n 1 73 GLU n 1 74 ALA n 1 75 PHE n 1 76 SER n 1 77 ALA n 1 78 HIS n 1 79 PRO n 1 80 GLN n 1 81 ILE n 1 82 GLY n 1 83 ASN n 1 84 THR n 1 85 PRO n 1 86 SER n 1 87 PRO n 1 88 SER n 1 89 ILE n 1 90 ASN n 1 91 SER n 1 92 ASP n 1 93 PHE n 1 94 ALA n 1 95 ARG n 1 96 ARG n 1 97 SER n 1 98 VAL n 1 99 SER n 1 100 GLU n 1 101 GLN n 1 102 SER n 1 103 THR n 1 104 ALA n 1 105 PHE n 1 106 ALA n 1 107 THR n 1 108 THR n 1 109 SER n 1 110 ALA n 1 111 SER n 1 112 ALA n 1 113 LEU n 1 114 GLN n 1 115 GLU n 1 116 LEU n 1 117 ALA n 1 118 GLU n 1 119 TRP n 1 120 ASN n 1 121 VAL n 1 122 LEU n 1 123 TYR n 1 124 LYS n 1 125 LYS n 1 126 LYS n 1 127 PHE n 1 128 GLY n 1 129 PHE n 1 130 ILE n 1 131 PHE n 1 132 ILE n 1 133 ILE n 1 134 CYS n 1 135 ALA n 1 136 SER n 1 137 GLY n 1 138 ARG n 1 139 THR n 1 140 HIS n 1 141 ALA n 1 142 GLU n 1 143 MSE n 1 144 LEU n 1 145 HIS n 1 146 ALA n 1 147 LEU n 1 148 LYS n 1 149 GLU n 1 150 ARG n 1 151 TYR n 1 152 GLU n 1 153 ASN n 1 154 ARG n 1 155 PRO n 1 156 ILE n 1 157 VAL n 1 158 GLU n 1 159 LEU n 1 160 GLU n 1 161 ILE n 1 162 ALA n 1 163 ALA n 1 164 MSE n 1 165 GLU n 1 166 GLN n 1 167 MSE n 1 168 LYS n 1 169 ILE n 1 170 THR n 1 171 GLU n 1 172 LEU n 1 173 ARG n 1 174 MSE n 1 175 ALA n 1 176 LYS n 1 177 LEU n 1 178 PHE n 1 179 SER n 1 180 ASP n 1 181 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'thale cress' _entity_src_gen.gene_src_genus Arabidopsis _entity_src_gen.pdbx_gene_src_gene TTL _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TTHL_ARATH _struct_ref.pdbx_db_accession Q9LVM5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MAMEIGEDEWKVCCGSSEFAKQMSTSGPLTSQEAIYTARDIWFNQVNVTDWLEAFSAHPQIGNTPSPSINSDFARRSVSE QSTAFATTSASALQELAEWNVLYKKKFGFIFIICASGRTHAEMLHALKERYENRPIVELEIAAMEQMKITELRMAKLFSD K ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2Q37 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 21 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 181 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9LVM5 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 161 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 161 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2Q37 MSE A 1 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -19 1 1 2Q37 GLY A 2 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -18 2 1 2Q37 SER A 3 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -17 3 1 2Q37 SER A 4 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -16 4 1 2Q37 HIS A 5 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -15 5 1 2Q37 HIS A 6 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -14 6 1 2Q37 HIS A 7 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -13 7 1 2Q37 HIS A 8 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -12 8 1 2Q37 HIS A 9 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -11 9 1 2Q37 SER A 10 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -10 10 1 2Q37 SER A 11 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -9 11 1 2Q37 GLY A 12 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -8 12 1 2Q37 GLU A 13 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -7 13 1 2Q37 ASN A 14 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -6 14 1 2Q37 LEU A 15 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -5 15 1 2Q37 TYR A 16 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -4 16 1 2Q37 PHE A 17 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -3 17 1 2Q37 GLN A 18 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -2 18 1 2Q37 GLY A 19 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' -1 19 1 2Q37 HIS A 20 ? UNP Q9LVM5 ? ? 'CLONING ARTIFACT' 0 20 1 2Q37 MSE A 21 ? UNP Q9LVM5 MET 1 'MODIFIED RESIDUE' 1 21 1 2Q37 MSE A 23 ? UNP Q9LVM5 MET 3 'MODIFIED RESIDUE' 3 22 1 2Q37 MSE A 43 ? UNP Q9LVM5 MET 23 'MODIFIED RESIDUE' 23 23 1 2Q37 MSE A 143 ? UNP Q9LVM5 MET 123 'MODIFIED RESIDUE' 123 24 1 2Q37 MSE A 164 ? UNP Q9LVM5 MET 144 'MODIFIED RESIDUE' 144 25 1 2Q37 MSE A 167 ? UNP Q9LVM5 MET 147 'MODIFIED RESIDUE' 147 26 1 2Q37 MSE A 174 ? UNP Q9LVM5 MET 154 'MODIFIED RESIDUE' 154 27 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 3AL non-polymer . '1-[(4S)-2,5-DIOXOIMIDAZOLIDIN-4-YL]UREA' '(S)-ALLANTOIN' 'C4 H6 N4 O3' 158.115 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2Q37 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.94 _exptl_crystal.density_percent_sol 58.15 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 295 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '0.1 M HEPES (pH 7.5), 20 mM MgCl2, 16% polyacrylic acid 5100, VAPOR DIFFUSION, HANGING DROP, temperature 295K' _exptl_crystal_grow.pdbx_pH_range . # loop_ _diffrn.id _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.crystal_id 1 100 ? 1 2 ? ? 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2007-01-19 _diffrn_detector.details ? # loop_ _diffrn_radiation.diffrn_id _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.monochromator _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_scattering_type 1 1 M 'Si 111 CHANNEL' MAD x-ray 2 1 M 'Si 111 CHANNEL' 'SINGLE WAVELENGTH' x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97948 1.0 2 0.97961 1.0 3 0.97181 1.0 4 0.97956 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PAL/PLS BEAMLINE 4A' _diffrn_source.pdbx_synchrotron_site PAL/PLS _diffrn_source.pdbx_synchrotron_beamline 4A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97948, 0.97961, 0.97181, 0.97956' # _reflns.entry_id 2Q37 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 50 _reflns.number_all 7845 _reflns.number_obs 7843 _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.095 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 9.4 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1,2 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_all 100 _reflns_shell.Rmerge_I_obs 0.479 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 9.4 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 7845 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2Q37 _refine.ls_d_res_high 2.5 _refine.ls_d_res_low 50 _refine.pdbx_ls_sigma_F 2.0 _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 7843 _refine.ls_number_reflns_obs 7528 _refine.ls_number_reflns_R_free 748 _refine.ls_percent_reflns_obs 96 _refine.ls_R_factor_all 0.215 _refine.ls_R_factor_obs 0.215 _refine.ls_R_factor_R_work 0.215 _refine.ls_R_factor_R_free 0.259 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.details ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_overall_ESU_R ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1127 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 11 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 1159 _refine_hist.d_res_high 2.5 _refine_hist.d_res_low 50 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_mcbond_it 1.461 ? ? ? 'X-RAY DIFFRACTION' ? c_scbond_it 2.470 ? ? ? 'X-RAY DIFFRACTION' ? c_mcangle_it 2.527 ? ? ? 'X-RAY DIFFRACTION' ? c_scangle_it 3.543 ? ? ? 'X-RAY DIFFRACTION' ? # _struct.entry_id 2Q37 _struct.title 'Crystal structure of OHCU decarboxylase in the presence of (S)-allantoin' _struct.pdbx_descriptor 'Transthyretin-like protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2Q37 _struct_keywords.pdbx_keywords 'PLANT PROTEIN, LYASE' _struct_keywords.text 'OHCU, 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline, PLANT PROTEIN, LYASE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'The biological assembly is a dimer generated from the monomer in the asymmetric unit by crystallographic symmetric operation.' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 28 ? VAL A 32 ? ASP A 8 VAL A 12 5 ? 5 HELX_P HELX_P2 2 SER A 36 ? THR A 45 ? SER A 16 THR A 25 1 ? 10 HELX_P HELX_P3 3 THR A 50 ? GLN A 65 ? THR A 30 GLN A 45 1 ? 16 HELX_P HELX_P4 4 ASN A 67 ? ALA A 77 ? ASN A 47 ALA A 57 1 ? 11 HELX_P HELX_P5 5 GLN A 101 ? ALA A 106 ? GLN A 81 ALA A 86 1 ? 6 HELX_P HELX_P6 6 SER A 109 ? GLY A 128 ? SER A 89 GLY A 108 1 ? 20 HELX_P HELX_P7 7 THR A 139 ? TYR A 151 ? THR A 119 TYR A 131 1 ? 13 HELX_P HELX_P8 8 ARG A 154 ? SER A 179 ? ARG A 134 SER A 159 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLN 42 C ? ? ? 1_555 A MSE 43 N ? ? A GLN 22 A MSE 23 1_555 ? ? ? ? ? ? ? 1.322 ? covale2 covale ? ? A MSE 43 C ? ? ? 1_555 A SER 44 N ? ? A MSE 23 A SER 24 1_555 ? ? ? ? ? ? ? 1.334 ? covale3 covale ? ? A GLU 142 C ? ? ? 1_555 A MSE 143 N ? ? A GLU 122 A MSE 123 1_555 ? ? ? ? ? ? ? 1.330 ? covale4 covale ? ? A MSE 143 C ? ? ? 1_555 A LEU 144 N ? ? A MSE 123 A LEU 124 1_555 ? ? ? ? ? ? ? 1.332 ? covale5 covale ? ? A ALA 163 C ? ? ? 1_555 A MSE 164 N ? ? A ALA 143 A MSE 144 1_555 ? ? ? ? ? ? ? 1.325 ? covale6 covale ? ? A MSE 164 C ? ? ? 1_555 A GLU 165 N ? ? A MSE 144 A GLU 145 1_555 ? ? ? ? ? ? ? 1.330 ? covale7 covale ? ? A GLN 166 C ? ? ? 1_555 A MSE 167 N ? ? A GLN 146 A MSE 147 1_555 ? ? ? ? ? ? ? 1.323 ? covale8 covale ? ? A MSE 167 C ? ? ? 1_555 A LYS 168 N ? ? A MSE 147 A LYS 148 1_555 ? ? ? ? ? ? ? 1.328 ? covale9 covale ? ? A ARG 173 C ? ? ? 1_555 A MSE 174 N ? ? A ARG 153 A MSE 154 1_555 ? ? ? ? ? ? ? 1.327 ? covale10 covale ? ? A MSE 174 C ? ? ? 1_555 A ALA 175 N ? ? A MSE 154 A ALA 155 1_555 ? ? ? ? ? ? ? 1.325 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 10 _struct_site.details 'BINDING SITE FOR RESIDUE 3AL A 200' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 HIS A 78 ? HIS A 58 . ? 1_555 ? 2 AC1 10 PRO A 79 ? PRO A 59 . ? 1_555 ? 3 AC1 10 ILE A 81 ? ILE A 61 . ? 1_555 ? 4 AC1 10 GLU A 100 ? GLU A 80 . ? 1_555 ? 5 AC1 10 PHE A 131 ? PHE A 111 . ? 1_555 ? 6 AC1 10 ILE A 132 ? ILE A 112 . ? 1_555 ? 7 AC1 10 ILE A 133 ? ILE A 113 . ? 1_555 ? 8 AC1 10 ALA A 135 ? ALA A 115 . ? 1_555 ? 9 AC1 10 ILE A 169 ? ILE A 149 . ? 1_555 ? 10 AC1 10 HOH C . ? HOH A 214 . ? 1_555 ? # _database_PDB_matrix.entry_id 2Q37 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2Q37 _atom_sites.fract_transf_matrix[1][1] 0.013590 _atom_sites.fract_transf_matrix[1][2] 0.007846 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015693 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014358 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 SER 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 GLY 12 -8 ? ? ? A . n A 1 13 GLU 13 -7 ? ? ? A . n A 1 14 ASN 14 -6 ? ? ? A . n A 1 15 LEU 15 -5 ? ? ? A . n A 1 16 TYR 16 -4 ? ? ? A . n A 1 17 PHE 17 -3 ? ? ? A . n A 1 18 GLN 18 -2 ? ? ? A . n A 1 19 GLY 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MSE 21 1 ? ? ? A . n A 1 22 ALA 22 2 ? ? ? A . n A 1 23 MSE 23 3 ? ? ? A . n A 1 24 GLU 24 4 ? ? ? A . n A 1 25 ILE 25 5 ? ? ? A . n A 1 26 GLY 26 6 6 GLY GLY A . n A 1 27 GLU 27 7 7 GLU GLU A . n A 1 28 ASP 28 8 8 ASP ASP A . n A 1 29 GLU 29 9 9 GLU GLU A . n A 1 30 TRP 30 10 10 TRP TRP A . n A 1 31 LYS 31 11 11 LYS LYS A . n A 1 32 VAL 32 12 12 VAL VAL A . n A 1 33 CYS 33 13 13 CYS CYS A . n A 1 34 CYS 34 14 14 CYS CYS A . n A 1 35 GLY 35 15 15 GLY GLY A . n A 1 36 SER 36 16 16 SER SER A . n A 1 37 SER 37 17 17 SER SER A . n A 1 38 GLU 38 18 18 GLU GLU A . n A 1 39 PHE 39 19 19 PHE PHE A . n A 1 40 ALA 40 20 20 ALA ALA A . n A 1 41 LYS 41 21 21 LYS LYS A . n A 1 42 GLN 42 22 22 GLN GLN A . n A 1 43 MSE 43 23 23 MSE MSE A . n A 1 44 SER 44 24 24 SER SER A . n A 1 45 THR 45 25 25 THR THR A . n A 1 46 SER 46 26 26 SER SER A . n A 1 47 GLY 47 27 27 GLY GLY A . n A 1 48 PRO 48 28 28 PRO PRO A . n A 1 49 LEU 49 29 29 LEU LEU A . n A 1 50 THR 50 30 30 THR THR A . n A 1 51 SER 51 31 31 SER SER A . n A 1 52 GLN 52 32 32 GLN GLN A . n A 1 53 GLU 53 33 33 GLU GLU A . n A 1 54 ALA 54 34 34 ALA ALA A . n A 1 55 ILE 55 35 35 ILE ILE A . n A 1 56 TYR 56 36 36 TYR TYR A . n A 1 57 THR 57 37 37 THR THR A . n A 1 58 ALA 58 38 38 ALA ALA A . n A 1 59 ARG 59 39 39 ARG ARG A . n A 1 60 ASP 60 40 40 ASP ASP A . n A 1 61 ILE 61 41 41 ILE ILE A . n A 1 62 TRP 62 42 42 TRP TRP A . n A 1 63 PHE 63 43 43 PHE PHE A . n A 1 64 ASN 64 44 44 ASN ASN A . n A 1 65 GLN 65 45 45 GLN GLN A . n A 1 66 VAL 66 46 46 VAL VAL A . n A 1 67 ASN 67 47 47 ASN ASN A . n A 1 68 VAL 68 48 48 VAL VAL A . n A 1 69 THR 69 49 49 THR THR A . n A 1 70 ASP 70 50 50 ASP ASP A . n A 1 71 TRP 71 51 51 TRP TRP A . n A 1 72 LEU 72 52 52 LEU LEU A . n A 1 73 GLU 73 53 53 GLU GLU A . n A 1 74 ALA 74 54 54 ALA ALA A . n A 1 75 PHE 75 55 55 PHE PHE A . n A 1 76 SER 76 56 56 SER SER A . n A 1 77 ALA 77 57 57 ALA ALA A . n A 1 78 HIS 78 58 58 HIS HIS A . n A 1 79 PRO 79 59 59 PRO PRO A . n A 1 80 GLN 80 60 60 GLN GLN A . n A 1 81 ILE 81 61 61 ILE ILE A . n A 1 82 GLY 82 62 62 GLY GLY A . n A 1 83 ASN 83 63 63 ASN ASN A . n A 1 84 THR 84 64 64 THR THR A . n A 1 85 PRO 85 65 65 PRO PRO A . n A 1 86 SER 86 66 ? ? ? A . n A 1 87 PRO 87 67 ? ? ? A . n A 1 88 SER 88 68 ? ? ? A . n A 1 89 ILE 89 69 ? ? ? A . n A 1 90 ASN 90 70 ? ? ? A . n A 1 91 SER 91 71 ? ? ? A . n A 1 92 ASP 92 72 ? ? ? A . n A 1 93 PHE 93 73 ? ? ? A . n A 1 94 ALA 94 74 ? ? ? A . n A 1 95 ARG 95 75 ? ? ? A . n A 1 96 ARG 96 76 ? ? ? A . n A 1 97 SER 97 77 ? ? ? A . n A 1 98 VAL 98 78 ? ? ? A . n A 1 99 SER 99 79 79 SER SER A . n A 1 100 GLU 100 80 80 GLU GLU A . n A 1 101 GLN 101 81 81 GLN GLN A . n A 1 102 SER 102 82 82 SER SER A . n A 1 103 THR 103 83 83 THR THR A . n A 1 104 ALA 104 84 84 ALA ALA A . n A 1 105 PHE 105 85 85 PHE PHE A . n A 1 106 ALA 106 86 86 ALA ALA A . n A 1 107 THR 107 87 87 THR THR A . n A 1 108 THR 108 88 88 THR THR A . n A 1 109 SER 109 89 89 SER SER A . n A 1 110 ALA 110 90 90 ALA ALA A . n A 1 111 SER 111 91 91 SER SER A . n A 1 112 ALA 112 92 92 ALA ALA A . n A 1 113 LEU 113 93 93 LEU LEU A . n A 1 114 GLN 114 94 94 GLN GLN A . n A 1 115 GLU 115 95 95 GLU GLU A . n A 1 116 LEU 116 96 96 LEU LEU A . n A 1 117 ALA 117 97 97 ALA ALA A . n A 1 118 GLU 118 98 98 GLU GLU A . n A 1 119 TRP 119 99 99 TRP TRP A . n A 1 120 ASN 120 100 100 ASN ASN A . n A 1 121 VAL 121 101 101 VAL VAL A . n A 1 122 LEU 122 102 102 LEU LEU A . n A 1 123 TYR 123 103 103 TYR TYR A . n A 1 124 LYS 124 104 104 LYS LYS A . n A 1 125 LYS 125 105 105 LYS LYS A . n A 1 126 LYS 126 106 106 LYS LYS A . n A 1 127 PHE 127 107 107 PHE PHE A . n A 1 128 GLY 128 108 108 GLY GLY A . n A 1 129 PHE 129 109 109 PHE PHE A . n A 1 130 ILE 130 110 110 ILE ILE A . n A 1 131 PHE 131 111 111 PHE PHE A . n A 1 132 ILE 132 112 112 ILE ILE A . n A 1 133 ILE 133 113 113 ILE ILE A . n A 1 134 CYS 134 114 114 CYS CYS A . n A 1 135 ALA 135 115 115 ALA ALA A . n A 1 136 SER 136 116 116 SER SER A . n A 1 137 GLY 137 117 117 GLY GLY A . n A 1 138 ARG 138 118 118 ARG ARG A . n A 1 139 THR 139 119 119 THR THR A . n A 1 140 HIS 140 120 120 HIS HIS A . n A 1 141 ALA 141 121 121 ALA ALA A . n A 1 142 GLU 142 122 122 GLU GLU A . n A 1 143 MSE 143 123 123 MSE MSE A . n A 1 144 LEU 144 124 124 LEU LEU A . n A 1 145 HIS 145 125 125 HIS HIS A . n A 1 146 ALA 146 126 126 ALA ALA A . n A 1 147 LEU 147 127 127 LEU LEU A . n A 1 148 LYS 148 128 128 LYS LYS A . n A 1 149 GLU 149 129 129 GLU GLU A . n A 1 150 ARG 150 130 130 ARG ARG A . n A 1 151 TYR 151 131 131 TYR TYR A . n A 1 152 GLU 152 132 132 GLU GLU A . n A 1 153 ASN 153 133 133 ASN ASN A . n A 1 154 ARG 154 134 134 ARG ARG A . n A 1 155 PRO 155 135 135 PRO PRO A . n A 1 156 ILE 156 136 136 ILE ILE A . n A 1 157 VAL 157 137 137 VAL VAL A . n A 1 158 GLU 158 138 138 GLU GLU A . n A 1 159 LEU 159 139 139 LEU LEU A . n A 1 160 GLU 160 140 140 GLU GLU A . n A 1 161 ILE 161 141 141 ILE ILE A . n A 1 162 ALA 162 142 142 ALA ALA A . n A 1 163 ALA 163 143 143 ALA ALA A . n A 1 164 MSE 164 144 144 MSE MSE A . n A 1 165 GLU 165 145 145 GLU GLU A . n A 1 166 GLN 166 146 146 GLN GLN A . n A 1 167 MSE 167 147 147 MSE MSE A . n A 1 168 LYS 168 148 148 LYS LYS A . n A 1 169 ILE 169 149 149 ILE ILE A . n A 1 170 THR 170 150 150 THR THR A . n A 1 171 GLU 171 151 151 GLU GLU A . n A 1 172 LEU 172 152 152 LEU LEU A . n A 1 173 ARG 173 153 153 ARG ARG A . n A 1 174 MSE 174 154 154 MSE MSE A . n A 1 175 ALA 175 155 155 ALA ALA A . n A 1 176 LYS 176 156 156 LYS LYS A . n A 1 177 LEU 177 157 157 LEU LEU A . n A 1 178 PHE 178 158 158 PHE PHE A . n A 1 179 SER 179 159 159 SER SER A . n A 1 180 ASP 180 160 160 ASP ASP A . n A 1 181 LYS 181 161 ? ? ? A . n # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 43 A MSE 23 ? MET SELENOMETHIONINE 2 A MSE 143 A MSE 123 ? MET SELENOMETHIONINE 3 A MSE 164 A MSE 144 ? MET SELENOMETHIONINE 4 A MSE 167 A MSE 147 ? MET SELENOMETHIONINE 5 A MSE 174 A MSE 154 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 x-y,-y,-z+2/3 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 46.4313333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-06-12 2 'Structure model' 1 1 2008-05-01 3 'Structure model' 1 2 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 SOLVE phasing . ? 2 CNS refinement . ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 7 ? ? 161.65 104.84 2 1 ASP A 8 ? ? -58.77 25.54 3 1 CYS A 14 ? ? 158.59 105.44 4 1 THR A 25 ? ? -105.63 57.02 5 1 PRO A 28 ? ? -29.92 132.36 6 1 THR A 30 ? ? -56.85 176.17 7 1 SER A 116 ? ? 179.85 -68.27 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -19 ? A MSE 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A SER -10 ? A SER 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A GLY -8 ? A GLY 12 13 1 Y 1 A GLU -7 ? A GLU 13 14 1 Y 1 A ASN -6 ? A ASN 14 15 1 Y 1 A LEU -5 ? A LEU 15 16 1 Y 1 A TYR -4 ? A TYR 16 17 1 Y 1 A PHE -3 ? A PHE 17 18 1 Y 1 A GLN -2 ? A GLN 18 19 1 Y 1 A GLY -1 ? A GLY 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A MSE 1 ? A MSE 21 22 1 Y 1 A ALA 2 ? A ALA 22 23 1 Y 1 A MSE 3 ? A MSE 23 24 1 Y 1 A GLU 4 ? A GLU 24 25 1 Y 1 A ILE 5 ? A ILE 25 26 1 Y 1 A SER 66 ? A SER 86 27 1 Y 1 A PRO 67 ? A PRO 87 28 1 Y 1 A SER 68 ? A SER 88 29 1 Y 1 A ILE 69 ? A ILE 89 30 1 Y 1 A ASN 70 ? A ASN 90 31 1 Y 1 A SER 71 ? A SER 91 32 1 Y 1 A ASP 72 ? A ASP 92 33 1 Y 1 A PHE 73 ? A PHE 93 34 1 Y 1 A ALA 74 ? A ALA 94 35 1 Y 1 A ARG 75 ? A ARG 95 36 1 Y 1 A ARG 76 ? A ARG 96 37 1 Y 1 A SER 77 ? A SER 97 38 1 Y 1 A VAL 78 ? A VAL 98 39 1 Y 1 A LYS 161 ? A LYS 181 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-[(4S)-2,5-DIOXOIMIDAZOLIDIN-4-YL]UREA' 3AL 3 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 3AL 1 200 200 3AL 3AL A . C 3 HOH 1 201 1 HOH WAT A . C 3 HOH 2 202 2 HOH WAT A . C 3 HOH 3 203 3 HOH WAT A . C 3 HOH 4 204 4 HOH WAT A . C 3 HOH 5 205 5 HOH WAT A . C 3 HOH 6 206 6 HOH WAT A . C 3 HOH 7 207 7 HOH WAT A . C 3 HOH 8 208 8 HOH WAT A . C 3 HOH 9 209 9 HOH WAT A . C 3 HOH 10 210 10 HOH WAT A . C 3 HOH 11 211 11 HOH WAT A . C 3 HOH 12 212 12 HOH WAT A . C 3 HOH 13 213 13 HOH WAT A . C 3 HOH 14 214 14 HOH WAT A . C 3 HOH 15 215 15 HOH WAT A . C 3 HOH 16 216 16 HOH WAT A . C 3 HOH 17 217 17 HOH WAT A . C 3 HOH 18 218 18 HOH WAT A . C 3 HOH 19 219 19 HOH WAT A . C 3 HOH 20 220 20 HOH WAT A . C 3 HOH 21 221 21 HOH WAT A . #