data_2QSB # _entry.id 2QSB # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2QSB pdb_00002qsb 10.2210/pdb2qsb/pdb RCSB RCSB043992 ? ? WWPDB D_1000043992 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-09-11 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2017-10-25 4 'Structure model' 1 3 2024-12-25 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Refinement description' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' software 2 4 'Structure model' chem_comp_atom 3 4 'Structure model' chem_comp_bond 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_entry_details 6 4 'Structure model' pdbx_modification_feature 7 4 'Structure model' struct_conn 8 4 'Structure model' struct_ref_seq_dif 9 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_struct_ref_seq_dif.details' 4 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 2QSB _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2007-07-30 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id APC86530.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cuff, M.E.' 1 'Duggan, E.' 2 'Gu, M.' 3 'Joachimiak, A.' 4 'Midwest Center for Structural Genomics (MCSG)' 5 # _citation.id primary _citation.title 'Structure of a protein from uncharacterized family UPF0147 from Thermoplasma acidophilum.' _citation.journal_abbrev 'TO BE PUBLISHED' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cuff, M.E.' 1 ? primary 'Duggan, E.' 2 ? primary 'Gu, M.' 3 ? primary 'Joachimiak, A.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'UPF0147 protein Ta0600' 10163.872 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 128 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;SNA(MSE)VRVDQNLFNEV(MSE)YLLDELSQDITVPKNVRKVAQDSKAKLSQENESLDLRCATVLS(MSE)LDE(MSE) ANDPNVPAHGRTDLYTIISKLEALS ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMVRVDQNLFNEVMYLLDELSQDITVPKNVRKVAQDSKAKLSQENESLDLRCATVLSMLDEMANDPNVPAHGRTDLYT IISKLEALS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier APC86530.1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MSE n 1 5 VAL n 1 6 ARG n 1 7 VAL n 1 8 ASP n 1 9 GLN n 1 10 ASN n 1 11 LEU n 1 12 PHE n 1 13 ASN n 1 14 GLU n 1 15 VAL n 1 16 MSE n 1 17 TYR n 1 18 LEU n 1 19 LEU n 1 20 ASP n 1 21 GLU n 1 22 LEU n 1 23 SER n 1 24 GLN n 1 25 ASP n 1 26 ILE n 1 27 THR n 1 28 VAL n 1 29 PRO n 1 30 LYS n 1 31 ASN n 1 32 VAL n 1 33 ARG n 1 34 LYS n 1 35 VAL n 1 36 ALA n 1 37 GLN n 1 38 ASP n 1 39 SER n 1 40 LYS n 1 41 ALA n 1 42 LYS n 1 43 LEU n 1 44 SER n 1 45 GLN n 1 46 GLU n 1 47 ASN n 1 48 GLU n 1 49 SER n 1 50 LEU n 1 51 ASP n 1 52 LEU n 1 53 ARG n 1 54 CYS n 1 55 ALA n 1 56 THR n 1 57 VAL n 1 58 LEU n 1 59 SER n 1 60 MSE n 1 61 LEU n 1 62 ASP n 1 63 GLU n 1 64 MSE n 1 65 ALA n 1 66 ASN n 1 67 ASP n 1 68 PRO n 1 69 ASN n 1 70 VAL n 1 71 PRO n 1 72 ALA n 1 73 HIS n 1 74 GLY n 1 75 ARG n 1 76 THR n 1 77 ASP n 1 78 LEU n 1 79 TYR n 1 80 THR n 1 81 ILE n 1 82 ILE n 1 83 SER n 1 84 LYS n 1 85 LEU n 1 86 GLU n 1 87 ALA n 1 88 LEU n 1 89 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Thermoplasma _entity_src_gen.pdbx_gene_src_gene 'CAC11739, Ta0600' _entity_src_gen.gene_src_species 'Thermoplasma acidophilum' _entity_src_gen.gene_src_strain 'DSM 1728, IFO 15155, JCM 9062, AMRC-C165' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermoplasma acidophilum DSM 1728' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 273075 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 25905 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG7 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MSE 4 1 ? ? ? A . n A 1 5 VAL 5 2 2 VAL VAL A . n A 1 6 ARG 6 3 3 ARG ARG A . n A 1 7 VAL 7 4 4 VAL VAL A . n A 1 8 ASP 8 5 5 ASP ASP A . n A 1 9 GLN 9 6 6 GLN GLN A . n A 1 10 ASN 10 7 7 ASN ASN A . n A 1 11 LEU 11 8 8 LEU LEU A . n A 1 12 PHE 12 9 9 PHE PHE A . n A 1 13 ASN 13 10 10 ASN ASN A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 VAL 15 12 12 VAL VAL A . n A 1 16 MSE 16 13 13 MSE MSE A . n A 1 17 TYR 17 14 14 TYR TYR A . n A 1 18 LEU 18 15 15 LEU LEU A . n A 1 19 LEU 19 16 16 LEU LEU A . n A 1 20 ASP 20 17 17 ASP ASP A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 LEU 22 19 19 LEU LEU A . n A 1 23 SER 23 20 20 SER SER A . n A 1 24 GLN 24 21 21 GLN GLN A . n A 1 25 ASP 25 22 22 ASP ASP A . n A 1 26 ILE 26 23 23 ILE ILE A . n A 1 27 THR 27 24 24 THR THR A . n A 1 28 VAL 28 25 25 VAL VAL A . n A 1 29 PRO 29 26 26 PRO PRO A . n A 1 30 LYS 30 27 27 LYS LYS A . n A 1 31 ASN 31 28 28 ASN ASN A . n A 1 32 VAL 32 29 29 VAL VAL A . n A 1 33 ARG 33 30 30 ARG ARG A . n A 1 34 LYS 34 31 31 LYS LYS A . n A 1 35 VAL 35 32 32 VAL VAL A . n A 1 36 ALA 36 33 33 ALA ALA A . n A 1 37 GLN 37 34 34 GLN GLN A . n A 1 38 ASP 38 35 35 ASP ASP A . n A 1 39 SER 39 36 36 SER SER A . n A 1 40 LYS 40 37 37 LYS LYS A . n A 1 41 ALA 41 38 38 ALA ALA A . n A 1 42 LYS 42 39 39 LYS LYS A . n A 1 43 LEU 43 40 40 LEU LEU A . n A 1 44 SER 44 41 41 SER SER A . n A 1 45 GLN 45 42 42 GLN GLN A . n A 1 46 GLU 46 43 43 GLU GLU A . n A 1 47 ASN 47 44 44 ASN ASN A . n A 1 48 GLU 48 45 45 GLU GLU A . n A 1 49 SER 49 46 46 SER SER A . n A 1 50 LEU 50 47 47 LEU LEU A . n A 1 51 ASP 51 48 48 ASP ASP A . n A 1 52 LEU 52 49 49 LEU LEU A . n A 1 53 ARG 53 50 50 ARG ARG A . n A 1 54 CYS 54 51 51 CYS CYS A . n A 1 55 ALA 55 52 52 ALA ALA A . n A 1 56 THR 56 53 53 THR THR A . n A 1 57 VAL 57 54 54 VAL VAL A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 SER 59 56 56 SER SER A . n A 1 60 MSE 60 57 57 MSE MSE A . n A 1 61 LEU 61 58 58 LEU LEU A . n A 1 62 ASP 62 59 59 ASP ASP A . n A 1 63 GLU 63 60 60 GLU GLU A . n A 1 64 MSE 64 61 61 MSE MSE A . n A 1 65 ALA 65 62 62 ALA ALA A . n A 1 66 ASN 66 63 63 ASN ASN A . n A 1 67 ASP 67 64 64 ASP ASP A . n A 1 68 PRO 68 65 65 PRO PRO A . n A 1 69 ASN 69 66 66 ASN ASN A . n A 1 70 VAL 70 67 67 VAL VAL A . n A 1 71 PRO 71 68 68 PRO PRO A . n A 1 72 ALA 72 69 69 ALA ALA A . n A 1 73 HIS 73 70 70 HIS HIS A . n A 1 74 GLY 74 71 71 GLY GLY A . n A 1 75 ARG 75 72 72 ARG ARG A . n A 1 76 THR 76 73 73 THR THR A . n A 1 77 ASP 77 74 74 ASP ASP A . n A 1 78 LEU 78 75 75 LEU LEU A . n A 1 79 TYR 79 76 76 TYR TYR A . n A 1 80 THR 80 77 77 THR THR A . n A 1 81 ILE 81 78 78 ILE ILE A . n A 1 82 ILE 82 79 79 ILE ILE A . n A 1 83 SER 83 80 80 SER SER A . n A 1 84 LYS 84 81 81 LYS LYS A . n A 1 85 LEU 85 82 82 LEU LEU A . n A 1 86 GLU 86 83 83 GLU GLU A . n A 1 87 ALA 87 84 84 ALA ALA A . n A 1 88 LEU 88 85 85 LEU LEU A . n A 1 89 SER 89 86 86 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 87 1 SO4 SO4 A . C 3 HOH 1 88 1 HOH HOH A . C 3 HOH 2 89 2 HOH HOH A . C 3 HOH 3 90 3 HOH HOH A . C 3 HOH 4 91 4 HOH HOH A . C 3 HOH 5 92 5 HOH HOH A . C 3 HOH 6 93 6 HOH HOH A . C 3 HOH 7 94 7 HOH HOH A . C 3 HOH 8 95 8 HOH HOH A . C 3 HOH 9 96 9 HOH HOH A . C 3 HOH 10 97 10 HOH HOH A . C 3 HOH 11 98 11 HOH HOH A . C 3 HOH 12 99 12 HOH HOH A . C 3 HOH 13 100 13 HOH HOH A . C 3 HOH 14 101 14 HOH HOH A . C 3 HOH 15 102 15 HOH HOH A . C 3 HOH 16 103 16 HOH HOH A . C 3 HOH 17 104 17 HOH HOH A . C 3 HOH 18 105 18 HOH HOH A . C 3 HOH 19 106 19 HOH HOH A . C 3 HOH 20 107 20 HOH HOH A . C 3 HOH 21 108 21 HOH HOH A . C 3 HOH 22 109 22 HOH HOH A . C 3 HOH 23 110 23 HOH HOH A . C 3 HOH 24 111 24 HOH HOH A . C 3 HOH 25 112 25 HOH HOH A . C 3 HOH 26 113 26 HOH HOH A . C 3 HOH 27 114 27 HOH HOH A . C 3 HOH 28 115 28 HOH HOH A . C 3 HOH 29 116 29 HOH HOH A . C 3 HOH 30 117 30 HOH HOH A . C 3 HOH 31 118 31 HOH HOH A . C 3 HOH 32 119 32 HOH HOH A . C 3 HOH 33 120 33 HOH HOH A . C 3 HOH 34 121 34 HOH HOH A . C 3 HOH 35 122 35 HOH HOH A . C 3 HOH 36 123 36 HOH HOH A . C 3 HOH 37 124 37 HOH HOH A . C 3 HOH 38 125 38 HOH HOH A . C 3 HOH 39 126 39 HOH HOH A . C 3 HOH 40 127 40 HOH HOH A . C 3 HOH 41 128 41 HOH HOH A . C 3 HOH 42 129 42 HOH HOH A . C 3 HOH 43 130 43 HOH HOH A . C 3 HOH 44 131 44 HOH HOH A . C 3 HOH 45 132 45 HOH HOH A . C 3 HOH 46 133 46 HOH HOH A . C 3 HOH 47 134 47 HOH HOH A . C 3 HOH 48 135 48 HOH HOH A . C 3 HOH 49 136 49 HOH HOH A . C 3 HOH 50 137 50 HOH HOH A . C 3 HOH 51 138 51 HOH HOH A . C 3 HOH 52 139 52 HOH HOH A . C 3 HOH 53 140 53 HOH HOH A . C 3 HOH 54 141 54 HOH HOH A . C 3 HOH 55 142 55 HOH HOH A . C 3 HOH 56 143 56 HOH HOH A . C 3 HOH 57 144 57 HOH HOH A . C 3 HOH 58 145 58 HOH HOH A . C 3 HOH 59 146 59 HOH HOH A . C 3 HOH 60 147 60 HOH HOH A . C 3 HOH 61 148 61 HOH HOH A . C 3 HOH 62 149 62 HOH HOH A . C 3 HOH 63 150 63 HOH HOH A . C 3 HOH 64 151 64 HOH HOH A . C 3 HOH 65 152 65 HOH HOH A . C 3 HOH 66 153 66 HOH HOH A . C 3 HOH 67 154 67 HOH HOH A . C 3 HOH 68 155 68 HOH HOH A . C 3 HOH 69 156 69 HOH HOH A . C 3 HOH 70 157 70 HOH HOH A . C 3 HOH 71 158 71 HOH HOH A . C 3 HOH 72 159 72 HOH HOH A . C 3 HOH 73 160 73 HOH HOH A . C 3 HOH 74 161 74 HOH HOH A . C 3 HOH 75 162 75 HOH HOH A . C 3 HOH 76 163 76 HOH HOH A . C 3 HOH 77 164 77 HOH HOH A . C 3 HOH 78 165 78 HOH HOH A . C 3 HOH 79 166 79 HOH HOH A . C 3 HOH 80 167 80 HOH HOH A . C 3 HOH 81 168 81 HOH HOH A . C 3 HOH 82 169 82 HOH HOH A . C 3 HOH 83 170 83 HOH HOH A . C 3 HOH 84 171 84 HOH HOH A . C 3 HOH 85 172 85 HOH HOH A . C 3 HOH 86 173 86 HOH HOH A . C 3 HOH 87 174 87 HOH HOH A . C 3 HOH 88 175 88 HOH HOH A . C 3 HOH 89 176 89 HOH HOH A . C 3 HOH 90 177 90 HOH HOH A . C 3 HOH 91 178 91 HOH HOH A . C 3 HOH 92 179 92 HOH HOH A . C 3 HOH 93 180 93 HOH HOH A . C 3 HOH 94 181 94 HOH HOH A . C 3 HOH 95 182 95 HOH HOH A . C 3 HOH 96 183 96 HOH HOH A . C 3 HOH 97 184 97 HOH HOH A . C 3 HOH 98 185 98 HOH HOH A . C 3 HOH 99 186 99 HOH HOH A . C 3 HOH 100 187 100 HOH HOH A . C 3 HOH 101 188 101 HOH HOH A . C 3 HOH 102 189 102 HOH HOH A . C 3 HOH 103 190 103 HOH HOH A . C 3 HOH 104 191 104 HOH HOH A . C 3 HOH 105 192 105 HOH HOH A . C 3 HOH 106 193 106 HOH HOH A . C 3 HOH 107 194 107 HOH HOH A . C 3 HOH 108 195 108 HOH HOH A . C 3 HOH 109 196 109 HOH HOH A . C 3 HOH 110 197 110 HOH HOH A . C 3 HOH 111 198 111 HOH HOH A . C 3 HOH 112 199 112 HOH HOH A . C 3 HOH 113 200 113 HOH HOH A . C 3 HOH 114 201 114 HOH HOH A . C 3 HOH 115 202 115 HOH HOH A . C 3 HOH 116 203 116 HOH HOH A . C 3 HOH 117 204 117 HOH HOH A . C 3 HOH 118 205 118 HOH HOH A . C 3 HOH 119 206 119 HOH HOH A . C 3 HOH 120 207 120 HOH HOH A . C 3 HOH 121 208 121 HOH HOH A . C 3 HOH 122 209 122 HOH HOH A . C 3 HOH 123 210 123 HOH HOH A . C 3 HOH 124 211 124 HOH HOH A . C 3 HOH 125 212 125 HOH HOH A . C 3 HOH 126 213 126 HOH HOH A . C 3 HOH 127 214 127 HOH HOH A . C 3 HOH 128 215 128 HOH HOH A . # loop_ _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id _software.pdbx_ordinal DENZO . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data reduction' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 1 SCALEPACK . ? package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu 'data scaling' http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ? ? 2 MLPHARE . ? other 'Z.Otwinowski or E.Dodson' 'ccp4@dl.ac.uk, ccp4@yorvic.york.ac.uk' phasing http://www.ccp4.ac.uk/main.html Fortran_77 ? 3 DM 5.0 ? program 'K. Cowtan' ccp4@dl.ac.uk phasing http://www.ccp4.ac.uk/main.html Fortran_77 ? 4 REFMAC . ? program 'Murshudov, G.N.' ccp4@dl.ac.uk refinement http://www.ccp4.ac.uk/main.html Fortran_77 ? 5 PDB_EXTRACT 3.000 'July 2, 2007' package PDB sw-help@rcsb.rutgers.edu 'data extraction' http://pdb.rutgers.edu/software/ C++ ? 6 SBC-Collect . ? ? ? ? 'data collection' ? ? ? 7 HKL-3000 . ? ? ? ? 'data reduction' ? ? ? 8 HKL-3000 . ? ? ? ? 'data scaling' ? ? ? 9 HKL-3000 . ? ? ? ? phasing ? ? ? 10 SHELXD . ? ? ? ? phasing ? ? ? 11 SHELXE . ? ? ? ? 'model building' ? ? ? 12 SOLVE . ? ? ? ? phasing ? ? ? 13 RESOLVE . ? ? ? ? phasing ? ? ? 14 ARP/wARP . ? ? ? ? 'model building' ? ? ? 15 CCP4 . ? ? ? ? phasing ? ? ? 16 O . ? ? ? ? 'model building' ? ? ? 17 Coot . ? ? ? ? 'model building' ? ? ? 18 # _cell.length_a 50.584 _cell.length_b 50.584 _cell.length_c 59.283 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 2QSB _cell.pdbx_unique_axis ? _cell.Z_PDB 6 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 65' _symmetry.entry_id 2QSB _symmetry.Int_Tables_number 170 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 2QSB _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.15 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 42.90 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '2M Ammonium sulfate, 0.1M Tri-HCl pH 7.0, 0.2M Lithium sulfate, VAPOR DIFFUSION, SITTING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2006-12-03 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.monochromator 'SAGITALLY FOCUSED Si(111)' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97931 1.0 2 0.97949 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 19-ID' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97931, 0.97949' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 19-ID # _reflns.entry_id 2QSB _reflns.d_resolution_high 1.250 _reflns.d_resolution_low 50.000 _reflns.number_obs 23474 _reflns.pdbx_Rmerge_I_obs 0.099 _reflns.pdbx_netI_over_sigmaI 9.400 _reflns.pdbx_chi_squared 3.714 _reflns.pdbx_redundancy 11.100 _reflns.percent_possible_obs 98.200 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.number_all 23474 _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate 11.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.25 _reflns_shell.d_res_low 1.35 _reflns_shell.number_measured_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_unique_obs ? _reflns_shell.Rmerge_I_obs 0.370 _reflns_shell.meanI_over_sigI_obs 3.5 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared 0.908 _reflns_shell.pdbx_redundancy 8.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 1515 _reflns_shell.percent_possible_all 97.30 _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2QSB _refine.ls_d_res_high 1.300 _refine.ls_d_res_low 24.550 _refine.pdbx_ls_sigma_F 0.00 _refine.ls_percent_reflns_obs 99.620 _refine.ls_number_reflns_obs 21124 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_obs 0.149 _refine.ls_R_factor_R_work 0.147 _refine.ls_R_factor_R_free 0.178 _refine.ls_percent_reflns_R_free 5.100 _refine.ls_number_reflns_R_free 1079 _refine.B_iso_mean 16.124 _refine.aniso_B[1][1] 0.270 _refine.aniso_B[2][2] 0.270 _refine.aniso_B[3][3] -0.410 _refine.aniso_B[1][2] 0.140 _refine.aniso_B[1][3] 0.000 _refine.aniso_B[2][3] 0.000 _refine.correlation_coeff_Fo_to_Fc 0.973 _refine.correlation_coeff_Fo_to_Fc_free 0.965 _refine.pdbx_overall_ESU_R 0.059 _refine.pdbx_overall_ESU_R_Free 0.053 _refine.overall_SU_ML 0.027 _refine.overall_SU_B 1.346 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD WITH PHASES' _refine.pdbx_ls_sigma_I ? _refine.ls_number_reflns_all 21124 _refine.ls_R_factor_all 0.149 _refine.ls_redundancy_reflns_obs ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_starting_model ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_isotropic_thermal_model ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 875 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 128 _refine_hist.number_atoms_total 1008 _refine_hist.d_res_high 1.300 _refine_hist.d_res_low 24.550 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 902 0.012 0.022 ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1244 1.502 1.986 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 125 4.001 5.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 47 39.483 25.745 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 178 16.334 15.000 ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 8 18.862 15.000 ? 'X-RAY DIFFRACTION' ? r_chiral_restr 138 0.097 0.200 ? 'X-RAY DIFFRACTION' ? r_gen_planes_refined 729 0.006 0.020 ? 'X-RAY DIFFRACTION' ? r_nbd_refined 488 0.299 0.200 ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 661 0.299 0.200 ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 127 0.162 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 48 0.255 0.200 ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 31 0.301 0.200 ? 'X-RAY DIFFRACTION' ? r_mcbond_it 582 1.359 1.500 ? 'X-RAY DIFFRACTION' ? r_mcangle_it 941 2.050 2.000 ? 'X-RAY DIFFRACTION' ? r_scbond_it 345 3.008 3.000 ? 'X-RAY DIFFRACTION' ? r_scangle_it 303 4.147 4.500 ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 927 1.521 3.000 ? 'X-RAY DIFFRACTION' ? r_sphericity_free 128 5.752 3.000 ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded 880 4.128 3.000 ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.d_res_high 1.300 _refine_ls_shell.d_res_low 1.334 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 97.300 _refine_ls_shell.number_reflns_R_work 1438 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.178 _refine_ls_shell.R_factor_R_free 0.226 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 77 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 1515 _refine_ls_shell.number_reflns_obs 1515 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2QSB _struct.title 'Crystal structure of a protein from uncharacterized family UPF0147 from Thermoplasma acidophilum' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2QSB _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.text ;structural genomics, four-helix bundle, Thermoplasma acidophilum, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y600_THEAC _struct_ref.pdbx_db_accession Q9HKJ8 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MVRVDQNLFNEVMYLLDELSQDITVPKNVRKVAQDSKAKLSQENESLDLRCATVLSMLDEMANDPNVPAHGRTDLYTIIS KLEALS ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2QSB _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 89 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9HKJ8 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 86 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 86 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2QSB SER A 1 ? UNP Q9HKJ8 ? ? 'expression tag' -2 1 1 2QSB ASN A 2 ? UNP Q9HKJ8 ? ? 'expression tag' -1 2 1 2QSB ALA A 3 ? UNP Q9HKJ8 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 5 ? GLN A 24 ? VAL A 2 GLN A 21 1 ? 20 HELX_P HELX_P2 2 PRO A 29 ? SER A 44 ? PRO A 26 SER A 41 1 ? 16 HELX_P HELX_P3 3 SER A 49 ? ASN A 66 ? SER A 46 ASN A 63 1 ? 18 HELX_P HELX_P4 4 PRO A 71 ? SER A 89 ? PRO A 68 SER A 86 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A VAL 15 C ? ? ? 1_555 A MSE 16 N ? ? A VAL 12 A MSE 13 1_555 ? ? ? ? ? ? ? 1.337 ? ? covale2 covale both ? A MSE 16 C ? ? ? 1_555 A TYR 17 N ? ? A MSE 13 A TYR 14 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale3 covale both ? A SER 59 C ? ? ? 1_555 A MSE 60 N A ? A SER 56 A MSE 57 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale4 covale both ? A SER 59 C ? ? ? 1_555 A MSE 60 N B ? A SER 56 A MSE 57 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale5 covale both ? A MSE 60 C A ? ? 1_555 A LEU 61 N ? ? A MSE 57 A LEU 58 1_555 ? ? ? ? ? ? ? 1.338 ? ? covale6 covale both ? A MSE 60 C B ? ? 1_555 A LEU 61 N ? ? A MSE 57 A LEU 58 1_555 ? ? ? ? ? ? ? 1.333 ? ? covale7 covale both ? A GLU 63 C ? ? ? 1_555 A MSE 64 N B ? A GLU 60 A MSE 61 1_555 ? ? ? ? ? ? ? 1.334 ? ? covale8 covale both ? A GLU 63 C ? ? ? 1_555 A MSE 64 N A ? A GLU 60 A MSE 61 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale9 covale both ? A MSE 64 C B ? ? 1_555 A ALA 65 N ? ? A MSE 61 A ALA 62 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale10 covale both ? A MSE 64 C A ? ? 1_555 A ALA 65 N ? ? A MSE 61 A ALA 62 1_555 ? ? ? ? ? ? ? 1.334 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 16 ? . . . . MSE A 13 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 60 A . . . . MSE A 57 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 60 B . . . . MSE A 57 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 64 A . . . . MSE A 61 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 64 B . . . . MSE A 61 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 87 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 9 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 87' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 9 VAL A 28 ? VAL A 25 . ? 5_565 ? 2 AC1 9 PRO A 29 ? PRO A 26 . ? 5_565 ? 3 AC1 9 LYS A 30 ? LYS A 27 . ? 5_565 ? 4 AC1 9 ARG A 33 ? ARG A 30 . ? 5_565 ? 5 AC1 9 LYS A 34 ? LYS A 31 . ? 1_555 ? 6 AC1 9 HOH C . ? HOH A 106 . ? 1_555 ? 7 AC1 9 HOH C . ? HOH A 112 . ? 1_555 ? 8 AC1 9 HOH C . ? HOH A 212 . ? 1_555 ? 9 AC1 9 HOH C . ? HOH A 215 . ? 1_555 ? # _pdbx_entry_details.entry_id 2QSB _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 16 A MSE 13 ? MET SELENOMETHIONINE 2 A MSE 60 A MSE 57 ? MET SELENOMETHIONINE 3 A MSE 64 A MSE 61 ? MET SELENOMETHIONINE # loop_ _pdbx_phasing_MAD_set.id _pdbx_phasing_MAD_set.d_res_high _pdbx_phasing_MAD_set.d_res_low _pdbx_phasing_MAD_set.reflns_acentric _pdbx_phasing_MAD_set.loc_acentric _pdbx_phasing_MAD_set.power_acentric _pdbx_phasing_MAD_set.R_cullis_acentric _pdbx_phasing_MAD_set.reflns_centric _pdbx_phasing_MAD_set.loc_centric _pdbx_phasing_MAD_set.power_centric _pdbx_phasing_MAD_set.R_cullis_centric 1 1.30 43.81 20467 0.300 0.000 1.600 657 0.200 0.000 1.000 2 1.30 43.81 20367 2.900 1.280 0.750 627 4.800 0.940 0.700 # loop_ _pdbx_phasing_MAD_set_shell.id _pdbx_phasing_MAD_set_shell.d_res_high _pdbx_phasing_MAD_set_shell.d_res_low _pdbx_phasing_MAD_set_shell.reflns_acentric _pdbx_phasing_MAD_set_shell.loc_acentric _pdbx_phasing_MAD_set_shell.power_acentric _pdbx_phasing_MAD_set_shell.R_cullis_acentric _pdbx_phasing_MAD_set_shell.reflns_centric _pdbx_phasing_MAD_set_shell.loc_centric _pdbx_phasing_MAD_set_shell.power_centric _pdbx_phasing_MAD_set_shell.R_cullis_centric 1 8.61 43.81 50 1.100 0.000 1.650 8 0.400 0.000 1.000 1 4.77 8.61 335 0.900 0.000 1.860 36 0.400 0.000 1.000 1 3.30 4.77 819 0.700 0.000 1.100 51 0.500 0.000 1.000 1 2.53 3.30 1529 0.500 0.000 1.230 71 0.300 0.000 1.000 1 2.04 2.53 2485 0.400 0.000 1.440 98 0.200 0.000 1.000 1 1.72 2.04 3643 0.300 0.000 1.850 118 0.200 0.000 1.000 1 1.48 1.72 5017 0.200 0.000 1.930 136 0.100 0.000 1.000 1 1.30 1.48 6589 0.200 0.000 2.020 139 0.100 0.000 1.000 2 8.61 43.81 50 5.200 3.060 0.550 8 4.400 2.400 0.400 2 4.77 8.61 335 3.700 3.640 0.420 36 4.600 2.520 0.360 2 3.30 4.77 819 3.800 2.820 0.520 51 6.400 1.500 0.580 2 2.53 3.30 1529 3.200 2.450 0.560 71 4.900 1.560 0.540 2 2.04 2.53 2485 3.000 1.830 0.630 96 4.400 1.090 0.660 2 1.72 2.04 3642 2.700 1.380 0.730 117 4.700 0.640 0.800 2 1.48 1.72 5014 2.700 0.920 0.870 136 4.600 0.480 0.970 2 1.30 1.48 6493 2.900 0.540 0.970 112 4.600 0.300 0.990 # loop_ _pdbx_phasing_MAD_set_site.id _pdbx_phasing_MAD_set_site.atom_type_symbol _pdbx_phasing_MAD_set_site.fract_x _pdbx_phasing_MAD_set_site.fract_y _pdbx_phasing_MAD_set_site.fract_z _pdbx_phasing_MAD_set_site.b_iso _pdbx_phasing_MAD_set_site.occupancy 1 Se -0.861 -0.213 -0.150 13.81665 0.000 2 Se -0.691 -0.375 0.009 10.97325 0.000 3 Se -0.923 -0.398 -0.056 34.74163 0.000 4 Se -0.861 -0.213 -0.150 13.12774 -0.181 5 Se -0.691 -0.374 0.009 10.66146 -0.103 6 Se -0.922 -0.398 -0.056 36.44563 -0.094 # loop_ _pdbx_phasing_MAD_shell.d_res_high _pdbx_phasing_MAD_shell.d_res_low _pdbx_phasing_MAD_shell.reflns _pdbx_phasing_MAD_shell.fom _pdbx_phasing_MAD_shell.reflns_centric _pdbx_phasing_MAD_shell.fom_centric _pdbx_phasing_MAD_shell.reflns_acentric _pdbx_phasing_MAD_shell.fom_acentric 8.61 43.81 58 0.830 8 0.832 50 0.830 4.77 8.61 371 0.890 36 0.785 335 0.901 3.30 4.77 870 0.840 51 0.691 819 0.850 2.53 3.30 1600 0.841 71 0.719 1529 0.847 2.04 2.53 2583 0.793 98 0.514 2485 0.804 1.72 2.04 3761 0.725 118 0.403 3643 0.735 1.48 1.72 5153 0.581 136 0.231 5017 0.590 1.30 1.48 6728 0.369 139 0.080 6589 0.375 # _pdbx_phasing_dm.entry_id 2QSB _pdbx_phasing_dm.method 'Solvent flattening and Histogram matching' _pdbx_phasing_dm.reflns 23416 # loop_ _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.delta_phi_final _pdbx_phasing_dm_shell.delta_phi_initial _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 4.530 100.000 35.500 ? ? ? 0.936 ? ? 501 3.590 4.530 32.000 ? ? ? 0.949 ? ? 507 3.130 3.590 32.400 ? ? ? 0.947 ? ? 508 2.840 3.130 34.500 ? ? ? 0.943 ? ? 524 2.620 2.840 33.200 ? ? ? 0.939 ? ? 566 2.450 2.620 33.100 ? ? ? 0.940 ? ? 595 2.300 2.450 35.000 ? ? ? 0.942 ? ? 636 2.180 2.300 37.000 ? ? ? 0.941 ? ? 688 2.070 2.180 37.400 ? ? ? 0.941 ? ? 726 1.980 2.070 40.000 ? ? ? 0.936 ? ? 749 1.900 1.980 38.900 ? ? ? 0.925 ? ? 779 1.830 1.900 39.500 ? ? ? 0.922 ? ? 823 1.770 1.830 41.600 ? ? ? 0.912 ? ? 833 1.710 1.770 43.500 ? ? ? 0.907 ? ? 892 1.660 1.710 43.900 ? ? ? 0.894 ? ? 898 1.610 1.660 47.800 ? ? ? 0.895 ? ? 926 1.570 1.610 47.200 ? ? ? 0.896 ? ? 956 1.530 1.570 53.900 ? ? ? 0.875 ? ? 975 1.490 1.530 54.700 ? ? ? 0.863 ? ? 1005 1.460 1.490 55.000 ? ? ? 0.866 ? ? 1044 1.420 1.460 58.300 ? ? ? 0.847 ? ? 1051 1.390 1.420 62.300 ? ? ? 0.825 ? ? 1049 1.360 1.390 60.000 ? ? ? 0.848 ? ? 1121 1.340 1.360 68.600 ? ? ? 0.836 ? ? 1127 1.310 1.340 69.500 ? ? ? 0.830 ? ? 1107 1.290 1.310 78.500 ? ? ? 0.834 ? ? 1105 1.250 1.290 91.600 ? ? ? 0.587 ? ? 1725 # _phasing.method MAD # _phasing_MAD.entry_id 2QSB _phasing_MAD.pdbx_d_res_high 1.30 _phasing_MAD.pdbx_d_res_low 43.81 _phasing_MAD.pdbx_reflns 21124 _phasing_MAD.pdbx_fom 0.602 _phasing_MAD.pdbx_reflns_centric 657 _phasing_MAD.pdbx_fom_centric 0.398 _phasing_MAD.pdbx_reflns_acentric 20467 _phasing_MAD.pdbx_fom_acentric 0.608 # _pdbx_database_remark.id 300 _pdbx_database_remark.text ; BIOMOLECULE: 1 SEE REMARK 350 FOR THE PROGRAM GENERATED ASSEMBLY INFORMATION FOR THE STRUCTURE IN THIS ENTRY. AUTHORS STATE THAT THE BIOLOGICAL UNIT OF THIS POLYPEPTIDE IS UNKNOWN. ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A MSE 1 ? A MSE 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MSE N N N N 230 MSE CA C N S 231 MSE C C N N 232 MSE O O N N 233 MSE OXT O N N 234 MSE CB C N N 235 MSE CG C N N 236 MSE SE SE N N 237 MSE CE C N N 238 MSE H H N N 239 MSE H2 H N N 240 MSE HA H N N 241 MSE HXT H N N 242 MSE HB2 H N N 243 MSE HB3 H N N 244 MSE HG2 H N N 245 MSE HG3 H N N 246 MSE HE1 H N N 247 MSE HE2 H N N 248 MSE HE3 H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TYR N N N N 326 TYR CA C N S 327 TYR C C N N 328 TYR O O N N 329 TYR CB C N N 330 TYR CG C Y N 331 TYR CD1 C Y N 332 TYR CD2 C Y N 333 TYR CE1 C Y N 334 TYR CE2 C Y N 335 TYR CZ C Y N 336 TYR OH O N N 337 TYR OXT O N N 338 TYR H H N N 339 TYR H2 H N N 340 TYR HA H N N 341 TYR HB2 H N N 342 TYR HB3 H N N 343 TYR HD1 H N N 344 TYR HD2 H N N 345 TYR HE1 H N N 346 TYR HE2 H N N 347 TYR HH H N N 348 TYR HXT H N N 349 VAL N N N N 350 VAL CA C N S 351 VAL C C N N 352 VAL O O N N 353 VAL CB C N N 354 VAL CG1 C N N 355 VAL CG2 C N N 356 VAL OXT O N N 357 VAL H H N N 358 VAL H2 H N N 359 VAL HA H N N 360 VAL HB H N N 361 VAL HG11 H N N 362 VAL HG12 H N N 363 VAL HG13 H N N 364 VAL HG21 H N N 365 VAL HG22 H N N 366 VAL HG23 H N N 367 VAL HXT H N N 368 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MSE N CA sing N N 218 MSE N H sing N N 219 MSE N H2 sing N N 220 MSE CA C sing N N 221 MSE CA CB sing N N 222 MSE CA HA sing N N 223 MSE C O doub N N 224 MSE C OXT sing N N 225 MSE OXT HXT sing N N 226 MSE CB CG sing N N 227 MSE CB HB2 sing N N 228 MSE CB HB3 sing N N 229 MSE CG SE sing N N 230 MSE CG HG2 sing N N 231 MSE CG HG3 sing N N 232 MSE SE CE sing N N 233 MSE CE HE1 sing N N 234 MSE CE HE2 sing N N 235 MSE CE HE3 sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TYR N CA sing N N 310 TYR N H sing N N 311 TYR N H2 sing N N 312 TYR CA C sing N N 313 TYR CA CB sing N N 314 TYR CA HA sing N N 315 TYR C O doub N N 316 TYR C OXT sing N N 317 TYR CB CG sing N N 318 TYR CB HB2 sing N N 319 TYR CB HB3 sing N N 320 TYR CG CD1 doub Y N 321 TYR CG CD2 sing Y N 322 TYR CD1 CE1 sing Y N 323 TYR CD1 HD1 sing N N 324 TYR CD2 CE2 doub Y N 325 TYR CD2 HD2 sing N N 326 TYR CE1 CZ doub Y N 327 TYR CE1 HE1 sing N N 328 TYR CE2 CZ sing Y N 329 TYR CE2 HE2 sing N N 330 TYR CZ OH sing N N 331 TYR OH HH sing N N 332 TYR OXT HXT sing N N 333 VAL N CA sing N N 334 VAL N H sing N N 335 VAL N H2 sing N N 336 VAL CA C sing N N 337 VAL CA CB sing N N 338 VAL CA HA sing N N 339 VAL C O doub N N 340 VAL C OXT sing N N 341 VAL CB CG1 sing N N 342 VAL CB CG2 sing N N 343 VAL CB HB sing N N 344 VAL CG1 HG11 sing N N 345 VAL CG1 HG12 sing N N 346 VAL CG1 HG13 sing N N 347 VAL CG2 HG21 sing N N 348 VAL CG2 HG22 sing N N 349 VAL CG2 HG23 sing N N 350 VAL OXT HXT sing N N 351 # _atom_sites.entry_id 2QSB _atom_sites.fract_transf_matrix[1][1] 0.019769 _atom_sites.fract_transf_matrix[1][2] 0.011414 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.022827 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016868 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_