data_2QVG # _entry.id 2QVG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.338 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2QVG RCSB RCSB044105 WWPDB D_1000044105 # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id NYSGXRC-11016o _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2QVG _pdbx_database_status.recvd_initial_deposition_date 2007-08-08 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tyagi, R.' 1 ? 'Eswaramoorthy, S.' 2 ? 'Burley, S.K.' 3 0000-0002-2487-9713 'Swaminathan, S.' 4 ? 'New York SGX Research Center for Structural Genomics (NYSGXRC)' 5 ? # _citation.id primary _citation.title 'The crystal structure of a two-component response regulator from Legionella pneumophila.' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tyagi, R.' 1 ? primary 'Eswaramoorthy, S.' 2 ? primary 'Burley, S.K.' 3 0000-0002-2487-9713 primary 'Swaminathan, S.' 4 ? # _cell.entry_id 2QVG _cell.length_a 49.797 _cell.length_b 49.797 _cell.length_c 111.050 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2QVG _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Two component response regulator' 16692.590 1 2.7.3.- ? ? ? 2 water nat water 18.015 171 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)SLAADKVDILYLEDDEVDIQSVERVFHKISSLIKIEIAKSGNQALD(MSE)LYGRNKENKIHPKLILLDINIPK (MSE)NGIEFLKELRDDSSFTDIEVFVLTAAYTSKDKLAFESLNIRGHLIKPLDYGEAIKLFWILQS(MSE)EGHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MSLAADKVDILYLEDDEVDIQSVERVFHKISSLIKIEIAKSGNQALDMLYGRNKENKIHPKLILLDINIPKMNGIEFLKE LRDDSSFTDIEVFVLTAAYTSKDKLAFESLNIRGHLIKPLDYGEAIKLFWILQSMEGHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGXRC-11016o # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 SER n 1 3 LEU n 1 4 ALA n 1 5 ALA n 1 6 ASP n 1 7 LYS n 1 8 VAL n 1 9 ASP n 1 10 ILE n 1 11 LEU n 1 12 TYR n 1 13 LEU n 1 14 GLU n 1 15 ASP n 1 16 ASP n 1 17 GLU n 1 18 VAL n 1 19 ASP n 1 20 ILE n 1 21 GLN n 1 22 SER n 1 23 VAL n 1 24 GLU n 1 25 ARG n 1 26 VAL n 1 27 PHE n 1 28 HIS n 1 29 LYS n 1 30 ILE n 1 31 SER n 1 32 SER n 1 33 LEU n 1 34 ILE n 1 35 LYS n 1 36 ILE n 1 37 GLU n 1 38 ILE n 1 39 ALA n 1 40 LYS n 1 41 SER n 1 42 GLY n 1 43 ASN n 1 44 GLN n 1 45 ALA n 1 46 LEU n 1 47 ASP n 1 48 MSE n 1 49 LEU n 1 50 TYR n 1 51 GLY n 1 52 ARG n 1 53 ASN n 1 54 LYS n 1 55 GLU n 1 56 ASN n 1 57 LYS n 1 58 ILE n 1 59 HIS n 1 60 PRO n 1 61 LYS n 1 62 LEU n 1 63 ILE n 1 64 LEU n 1 65 LEU n 1 66 ASP n 1 67 ILE n 1 68 ASN n 1 69 ILE n 1 70 PRO n 1 71 LYS n 1 72 MSE n 1 73 ASN n 1 74 GLY n 1 75 ILE n 1 76 GLU n 1 77 PHE n 1 78 LEU n 1 79 LYS n 1 80 GLU n 1 81 LEU n 1 82 ARG n 1 83 ASP n 1 84 ASP n 1 85 SER n 1 86 SER n 1 87 PHE n 1 88 THR n 1 89 ASP n 1 90 ILE n 1 91 GLU n 1 92 VAL n 1 93 PHE n 1 94 VAL n 1 95 LEU n 1 96 THR n 1 97 ALA n 1 98 ALA n 1 99 TYR n 1 100 THR n 1 101 SER n 1 102 LYS n 1 103 ASP n 1 104 LYS n 1 105 LEU n 1 106 ALA n 1 107 PHE n 1 108 GLU n 1 109 SER n 1 110 LEU n 1 111 ASN n 1 112 ILE n 1 113 ARG n 1 114 GLY n 1 115 HIS n 1 116 LEU n 1 117 ILE n 1 118 LYS n 1 119 PRO n 1 120 LEU n 1 121 ASP n 1 122 TYR n 1 123 GLY n 1 124 GLU n 1 125 ALA n 1 126 ILE n 1 127 LYS n 1 128 LEU n 1 129 PHE n 1 130 TRP n 1 131 ILE n 1 132 LEU n 1 133 GLN n 1 134 SER n 1 135 MSE n 1 136 GLU n 1 137 GLY n 1 138 HIS n 1 139 HIS n 1 140 HIS n 1 141 HIS n 1 142 HIS n 1 143 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Legionella _entity_src_gen.pdbx_gene_src_gene lpg2457 _entity_src_gen.gene_src_species 'Legionella pneumophila' _entity_src_gen.gene_src_strain 'Philadelphia 1, DSM 7513' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Legionella pneumophila subsp. pneumophila str. Philadelphia 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272624 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc 33152 _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pSGX3-BC _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5ZSR0_LEGPH _struct_ref.pdbx_db_accession Q5ZSR0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AADKVDILYLEDDEVDIQSVERVFHKISSLIKIEIAKSGNQALDMLYGRNKENKIHPKLILLDINIPKMNGIEFLKELRD DSSFTDIEVFVLTAAYTSKDKLAFESLNIRGHLIKPLDYGEAIKLFWILQSM ; _struct_ref.pdbx_align_begin 5 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2QVG _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 135 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5ZSR0 _struct_ref_seq.db_align_beg 5 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 136 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 4 _struct_ref_seq.pdbx_auth_seq_align_end 135 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2QVG MSE A 1 ? UNP Q5ZSR0 ? ? 'expression tag' 1 1 1 2QVG SER A 2 ? UNP Q5ZSR0 ? ? 'expression tag' 2 2 1 2QVG LEU A 3 ? UNP Q5ZSR0 ? ? 'expression tag' 3 3 1 2QVG GLU A 136 ? UNP Q5ZSR0 ? ? 'expression tag' 136 4 1 2QVG GLY A 137 ? UNP Q5ZSR0 ? ? 'expression tag' 137 5 1 2QVG HIS A 138 ? UNP Q5ZSR0 ? ? 'expression tag' 138 6 1 2QVG HIS A 139 ? UNP Q5ZSR0 ? ? 'expression tag' 139 7 1 2QVG HIS A 140 ? UNP Q5ZSR0 ? ? 'expression tag' 140 8 1 2QVG HIS A 141 ? UNP Q5ZSR0 ? ? 'expression tag' 141 9 1 2QVG HIS A 142 ? UNP Q5ZSR0 ? ? 'expression tag' 142 10 1 2QVG HIS A 143 ? UNP Q5ZSR0 ? ? 'expression tag' 143 11 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2QVG _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.38 _exptl_crystal.density_percent_sol 48.34 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 294 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pdbx_details '0.2M Lithium sulfate, 0.1M Bis-Tris pH 5.5, 25% PEG 3350, VAPOR DIFFUSION, SITTING DROP, temperature 294K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2007-08-03 _diffrn_detector.details Mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(III)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97910 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97910 # _reflns.entry_id 2QVG _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.00 _reflns.d_resolution_high 1.50 _reflns.number_obs 44110 _reflns.number_all 44110 _reflns.percent_possible_obs 89.1 _reflns.pdbx_Rmerge_I_obs 0.047 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 21.7 _reflns.B_iso_Wilson_estimate 16.4 _reflns.pdbx_redundancy 9.5 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 1.50 _reflns_shell.d_res_low 1.55 _reflns_shell.percent_possible_all 45.6 _reflns_shell.Rmerge_I_obs 0.156 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 7.0 _reflns_shell.pdbx_redundancy 2.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all 2265 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2QVG _refine.ls_number_reflns_obs 23812 _refine.ls_number_reflns_all 23812 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF 1225649.46 _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 40.20 _refine.ls_d_res_high 1.50 _refine.ls_percent_reflns_obs 90.4 _refine.ls_R_factor_obs 0.218 _refine.ls_R_factor_all 0.218 _refine.ls_R_factor_R_work 0.218 _refine.ls_R_factor_R_free 0.255 _refine.ls_R_factor_R_free_error 0.010 _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 2.9 _refine.ls_number_reflns_R_free 692 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 18.8 _refine.aniso_B[1][1] 2.60 _refine.aniso_B[2][2] 2.60 _refine.aniso_B[3][3] -5.20 _refine.aniso_B[1][2] 2.33 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_ksol 0.399418 _refine.solvent_model_param_bsol 45.9937 _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ;The Bijvoet differences were used for phasing. Residues listed as missing in Remark 465 are due to lack of electron density. Residues with missing atoms listed in Remark 470 are due to lack of electron density for side chains and modeled as alanines. ; _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 2QVG _refine_analyze.Luzzati_coordinate_error_obs 0.19 _refine_analyze.Luzzati_sigma_a_obs 0.09 _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_coordinate_error_free 0.22 _refine_analyze.Luzzati_sigma_a_free 0.09 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1044 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 171 _refine_hist.number_atoms_total 1215 _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 40.20 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function c_bond_d 0.006 ? ? ? 'X-RAY DIFFRACTION' ? c_angle_deg 1.3 ? ? ? 'X-RAY DIFFRACTION' ? c_dihedral_angle_d 22.7 ? ? ? 'X-RAY DIFFRACTION' ? c_improper_angle_d 0.76 ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 6 _refine_ls_shell.d_res_high 1.50 _refine_ls_shell.d_res_low 1.59 _refine_ls_shell.number_reflns_R_work 2397 _refine_ls_shell.R_factor_R_work 0.224 _refine_ls_shell.percent_reflns_obs 57.3 _refine_ls_shell.R_factor_R_free 0.247 _refine_ls_shell.R_factor_R_free_error 0.030 _refine_ls_shell.percent_reflns_R_free 2.7 _refine_ls_shell.number_reflns_R_free 67 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # loop_ _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file _pdbx_xplor_file.pdbx_refine_id 1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 2 ion.param ? 'X-RAY DIFFRACTION' 3 water_rep.param ? 'X-RAY DIFFRACTION' # _struct.entry_id 2QVG _struct.title 'The crystal structure of a two-component response regulator from Legionella pneumophila' _struct.pdbx_descriptor 'Two component response regulator (E.C.2.7.3.-)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2QVG _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;11016o, NYSGXRC, two component response regulator, PSI-2, Structural Genomics, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, Transferase ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 16 ? SER A 31 ? ASP A 16 SER A 31 1 ? 16 HELX_P HELX_P2 2 SER A 41 ? GLY A 51 ? SER A 41 GLY A 51 1 ? 11 HELX_P HELX_P3 3 ASN A 73 ? ARG A 82 ? ASN A 73 ARG A 82 1 ? 10 HELX_P HELX_P4 4 ASP A 83 ? THR A 88 ? ASP A 83 THR A 88 5 ? 6 HELX_P HELX_P5 5 THR A 100 ? GLU A 108 ? THR A 100 GLU A 108 1 ? 9 HELX_P HELX_P6 6 ASP A 121 ? MSE A 135 ? ASP A 121 MSE A 135 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 47 C ? ? ? 1_555 A MSE 48 N ? ? A ASP 47 A MSE 48 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale2 covale both ? A MSE 48 C ? ? ? 1_555 A LEU 49 N ? ? A MSE 48 A LEU 49 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale3 covale both ? A LYS 71 C ? ? ? 1_555 A MSE 72 N ? ? A LYS 71 A MSE 72 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale4 covale both ? A MSE 72 C ? ? ? 1_555 A ASN 73 N ? ? A MSE 72 A ASN 73 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale5 covale both ? A SER 134 C ? ? ? 1_555 A MSE 135 N ? ? A SER 134 A MSE 135 1_555 ? ? ? ? ? ? ? 1.341 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id LYS _struct_mon_prot_cis.label_seq_id 118 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id LYS _struct_mon_prot_cis.auth_seq_id 118 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 119 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 119 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.56 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 36 ? ALA A 39 ? ILE A 36 ALA A 39 A 2 ILE A 10 ? LEU A 13 ? ILE A 10 LEU A 13 A 3 LEU A 62 ? ASP A 66 ? LEU A 62 ASP A 66 A 4 GLU A 91 ? THR A 96 ? GLU A 91 THR A 96 A 5 GLY A 114 ? ILE A 117 ? GLY A 114 ILE A 117 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLU A 37 ? O GLU A 37 N TYR A 12 ? N TYR A 12 A 2 3 N LEU A 13 ? N LEU A 13 O LEU A 64 ? O LEU A 64 A 3 4 N LEU A 65 ? N LEU A 65 O LEU A 95 ? O LEU A 95 A 4 5 N VAL A 94 ? N VAL A 94 O LEU A 116 ? O LEU A 116 # _database_PDB_matrix.entry_id 2QVG _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2QVG _atom_sites.fract_transf_matrix[1][1] 0.020082 _atom_sites.fract_transf_matrix[1][2] 0.011594 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023188 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009005 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 SER 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 ALA 4 4 ? ? ? A . n A 1 5 ALA 5 5 ? ? ? A . n A 1 6 ASP 6 6 ? ? ? A . n A 1 7 LYS 7 7 7 LYS ALA A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 ASP 16 16 16 ASP ASP A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 ASP 19 19 19 ASP ASP A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 SER 32 32 32 SER SER A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 MSE 48 48 48 MSE MSE A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 ASN 53 53 53 ASN ASN A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 ILE 58 58 58 ILE ILE A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 LEU 64 64 64 LEU LEU A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 PRO 70 70 70 PRO PRO A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 MSE 72 72 72 MSE MSE A . n A 1 73 ASN 73 73 73 ASN ASN A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 ILE 75 75 75 ILE ILE A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 PHE 77 77 77 PHE PHE A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 LYS 79 79 79 LYS LYS A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ASP 83 83 83 ASP ASP A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 SER 86 86 86 SER SER A . n A 1 87 PHE 87 87 87 PHE PHE A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 VAL 92 92 92 VAL VAL A . n A 1 93 PHE 93 93 93 PHE PHE A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 SER 101 101 101 SER SER A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 SER 109 109 109 SER SER A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 ARG 113 113 113 ARG ARG A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 HIS 115 115 115 HIS HIS A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ILE 117 117 117 ILE ILE A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 LYS 127 127 127 LYS LYS A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 PHE 129 129 129 PHE PHE A . n A 1 130 TRP 130 130 130 TRP TRP A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 LEU 132 132 132 LEU LEU A . n A 1 133 GLN 133 133 133 GLN GLN A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 MSE 135 135 135 MSE MSE A . n A 1 136 GLU 136 136 ? ? ? A . n A 1 137 GLY 137 137 ? ? ? A . n A 1 138 HIS 138 138 ? ? ? A . n A 1 139 HIS 139 139 ? ? ? A . n A 1 140 HIS 140 140 ? ? ? A . n A 1 141 HIS 141 141 ? ? ? A . n A 1 142 HIS 142 142 ? ? ? A . n A 1 143 HIS 143 143 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'PSI, Protein Structure Initiative' _pdbx_SG_project.full_name_of_center 'New York SGX Research Center for Structural Genomics' _pdbx_SG_project.initial_of_center NYSGXRC # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 144 1 HOH TIP A . B 2 HOH 2 145 2 HOH TIP A . B 2 HOH 3 146 3 HOH TIP A . B 2 HOH 4 147 4 HOH TIP A . B 2 HOH 5 148 5 HOH TIP A . B 2 HOH 6 149 6 HOH TIP A . B 2 HOH 7 150 7 HOH TIP A . B 2 HOH 8 151 8 HOH TIP A . B 2 HOH 9 152 9 HOH TIP A . B 2 HOH 10 153 10 HOH TIP A . B 2 HOH 11 154 11 HOH TIP A . B 2 HOH 12 155 12 HOH TIP A . B 2 HOH 13 156 13 HOH TIP A . B 2 HOH 14 157 14 HOH TIP A . B 2 HOH 15 158 15 HOH TIP A . B 2 HOH 16 159 16 HOH TIP A . B 2 HOH 17 160 17 HOH TIP A . B 2 HOH 18 161 18 HOH TIP A . B 2 HOH 19 162 19 HOH TIP A . B 2 HOH 20 163 20 HOH TIP A . B 2 HOH 21 164 21 HOH TIP A . B 2 HOH 22 165 22 HOH TIP A . B 2 HOH 23 166 23 HOH TIP A . B 2 HOH 24 167 24 HOH TIP A . B 2 HOH 25 168 25 HOH TIP A . B 2 HOH 26 169 26 HOH TIP A . B 2 HOH 27 170 27 HOH TIP A . B 2 HOH 28 171 28 HOH TIP A . B 2 HOH 29 172 29 HOH TIP A . B 2 HOH 30 173 30 HOH TIP A . B 2 HOH 31 174 31 HOH TIP A . B 2 HOH 32 175 32 HOH TIP A . B 2 HOH 33 176 33 HOH TIP A . B 2 HOH 34 177 34 HOH TIP A . B 2 HOH 35 178 35 HOH TIP A . B 2 HOH 36 179 36 HOH TIP A . B 2 HOH 37 180 37 HOH TIP A . B 2 HOH 38 181 38 HOH TIP A . B 2 HOH 39 182 39 HOH TIP A . B 2 HOH 40 183 40 HOH TIP A . B 2 HOH 41 184 41 HOH TIP A . B 2 HOH 42 185 42 HOH TIP A . B 2 HOH 43 186 43 HOH TIP A . B 2 HOH 44 187 44 HOH TIP A . B 2 HOH 45 188 45 HOH TIP A . B 2 HOH 46 189 46 HOH TIP A . B 2 HOH 47 190 47 HOH TIP A . B 2 HOH 48 191 48 HOH TIP A . B 2 HOH 49 192 49 HOH TIP A . B 2 HOH 50 193 50 HOH TIP A . B 2 HOH 51 194 51 HOH TIP A . B 2 HOH 52 195 52 HOH TIP A . B 2 HOH 53 196 53 HOH TIP A . B 2 HOH 54 197 54 HOH TIP A . B 2 HOH 55 198 55 HOH TIP A . B 2 HOH 56 199 56 HOH TIP A . B 2 HOH 57 200 57 HOH TIP A . B 2 HOH 58 201 58 HOH TIP A . B 2 HOH 59 202 59 HOH TIP A . B 2 HOH 60 203 60 HOH TIP A . B 2 HOH 61 204 61 HOH TIP A . B 2 HOH 62 205 63 HOH TIP A . B 2 HOH 63 206 64 HOH TIP A . B 2 HOH 64 207 65 HOH TIP A . B 2 HOH 65 208 66 HOH TIP A . B 2 HOH 66 209 67 HOH TIP A . B 2 HOH 67 210 68 HOH TIP A . B 2 HOH 68 211 69 HOH TIP A . B 2 HOH 69 212 70 HOH TIP A . B 2 HOH 70 213 71 HOH TIP A . B 2 HOH 71 214 72 HOH TIP A . B 2 HOH 72 215 73 HOH TIP A . B 2 HOH 73 216 74 HOH TIP A . B 2 HOH 74 217 75 HOH TIP A . B 2 HOH 75 218 76 HOH TIP A . B 2 HOH 76 219 77 HOH TIP A . B 2 HOH 77 220 78 HOH TIP A . B 2 HOH 78 221 80 HOH TIP A . B 2 HOH 79 222 81 HOH TIP A . B 2 HOH 80 223 82 HOH TIP A . B 2 HOH 81 224 83 HOH TIP A . B 2 HOH 82 225 84 HOH TIP A . B 2 HOH 83 226 85 HOH TIP A . B 2 HOH 84 227 86 HOH TIP A . B 2 HOH 85 228 87 HOH TIP A . B 2 HOH 86 229 88 HOH TIP A . B 2 HOH 87 230 89 HOH TIP A . B 2 HOH 88 231 90 HOH TIP A . B 2 HOH 89 232 91 HOH TIP A . B 2 HOH 90 233 92 HOH TIP A . B 2 HOH 91 234 93 HOH TIP A . B 2 HOH 92 235 94 HOH TIP A . B 2 HOH 93 236 95 HOH TIP A . B 2 HOH 94 237 96 HOH TIP A . B 2 HOH 95 238 97 HOH TIP A . B 2 HOH 96 239 98 HOH TIP A . B 2 HOH 97 240 99 HOH TIP A . B 2 HOH 98 241 100 HOH TIP A . B 2 HOH 99 242 101 HOH TIP A . B 2 HOH 100 243 102 HOH TIP A . B 2 HOH 101 244 103 HOH TIP A . B 2 HOH 102 245 104 HOH TIP A . B 2 HOH 103 246 105 HOH TIP A . B 2 HOH 104 247 106 HOH TIP A . B 2 HOH 105 248 107 HOH TIP A . B 2 HOH 106 249 108 HOH TIP A . B 2 HOH 107 250 109 HOH TIP A . B 2 HOH 108 251 111 HOH TIP A . B 2 HOH 109 252 112 HOH TIP A . B 2 HOH 110 253 113 HOH TIP A . B 2 HOH 111 254 114 HOH TIP A . B 2 HOH 112 255 115 HOH TIP A . B 2 HOH 113 256 116 HOH TIP A . B 2 HOH 114 257 117 HOH TIP A . B 2 HOH 115 258 119 HOH TIP A . B 2 HOH 116 259 120 HOH TIP A . B 2 HOH 117 260 121 HOH TIP A . B 2 HOH 118 261 122 HOH TIP A . B 2 HOH 119 262 123 HOH TIP A . B 2 HOH 120 263 124 HOH TIP A . B 2 HOH 121 264 125 HOH TIP A . B 2 HOH 122 265 126 HOH TIP A . B 2 HOH 123 266 127 HOH TIP A . B 2 HOH 124 267 128 HOH TIP A . B 2 HOH 125 268 129 HOH TIP A . B 2 HOH 126 269 130 HOH TIP A . B 2 HOH 127 270 131 HOH TIP A . B 2 HOH 128 271 132 HOH TIP A . B 2 HOH 129 272 133 HOH TIP A . B 2 HOH 130 273 134 HOH TIP A . B 2 HOH 131 274 135 HOH TIP A . B 2 HOH 132 275 136 HOH TIP A . B 2 HOH 133 276 137 HOH TIP A . B 2 HOH 134 277 139 HOH TIP A . B 2 HOH 135 278 140 HOH TIP A . B 2 HOH 136 279 141 HOH TIP A . B 2 HOH 137 280 142 HOH TIP A . B 2 HOH 138 281 143 HOH TIP A . B 2 HOH 139 282 144 HOH TIP A . B 2 HOH 140 283 145 HOH TIP A . B 2 HOH 141 284 146 HOH TIP A . B 2 HOH 142 285 147 HOH TIP A . B 2 HOH 143 286 148 HOH TIP A . B 2 HOH 144 287 149 HOH TIP A . B 2 HOH 145 288 150 HOH TIP A . B 2 HOH 146 289 151 HOH TIP A . B 2 HOH 147 290 152 HOH TIP A . B 2 HOH 148 291 153 HOH TIP A . B 2 HOH 149 292 154 HOH TIP A . B 2 HOH 150 293 155 HOH TIP A . B 2 HOH 151 294 156 HOH TIP A . B 2 HOH 152 295 157 HOH TIP A . B 2 HOH 153 296 158 HOH TIP A . B 2 HOH 154 297 159 HOH TIP A . B 2 HOH 155 298 160 HOH TIP A . B 2 HOH 156 299 161 HOH TIP A . B 2 HOH 157 300 162 HOH TIP A . B 2 HOH 158 301 163 HOH TIP A . B 2 HOH 159 302 164 HOH TIP A . B 2 HOH 160 303 165 HOH TIP A . B 2 HOH 161 304 166 HOH TIP A . B 2 HOH 162 305 167 HOH TIP A . B 2 HOH 163 306 168 HOH TIP A . B 2 HOH 164 307 169 HOH TIP A . B 2 HOH 165 308 170 HOH TIP A . B 2 HOH 166 309 171 HOH TIP A . B 2 HOH 167 310 172 HOH TIP A . B 2 HOH 168 311 174 HOH TIP A . B 2 HOH 169 312 176 HOH TIP A . B 2 HOH 170 313 177 HOH TIP A . B 2 HOH 171 314 178 HOH TIP A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 48 A MSE 48 ? MET SELENOMETHIONINE 2 A MSE 72 A MSE 72 ? MET SELENOMETHIONINE 3 A MSE 135 A MSE 135 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 310 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id B _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-08-28 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-02-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' audit_author 2 3 'Structure model' citation_author 3 3 'Structure model' struct_conn 4 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_audit_author.identifier_ORCID' 2 3 'Structure model' '_citation_author.identifier_ORCID' 3 3 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal CNS refinement 1.1 ? 1 CBASS 'data collection' . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 SHELX phasing . ? 5 SHARP phasing . ? 6 ARP/wARP 'model building' . ? 7 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 7 ? CG ? A LYS 7 CG 2 1 Y 1 A LYS 7 ? CD ? A LYS 7 CD 3 1 Y 1 A LYS 7 ? CE ? A LYS 7 CE 4 1 Y 1 A LYS 7 ? NZ ? A LYS 7 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A SER 2 ? A SER 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A ALA 4 ? A ALA 4 5 1 Y 1 A ALA 5 ? A ALA 5 6 1 Y 1 A ASP 6 ? A ASP 6 7 1 Y 1 A GLU 136 ? A GLU 136 8 1 Y 1 A GLY 137 ? A GLY 137 9 1 Y 1 A HIS 138 ? A HIS 138 10 1 Y 1 A HIS 139 ? A HIS 139 11 1 Y 1 A HIS 140 ? A HIS 140 12 1 Y 1 A HIS 141 ? A HIS 141 13 1 Y 1 A HIS 142 ? A HIS 142 14 1 Y 1 A HIS 143 ? A HIS 143 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #