data_2RMM # _entry.id 2RMM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RMM pdb_00002rmm 10.2210/pdb2rmm/pdb RCSB RCSB150038 ? ? WWPDB D_1000150038 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-12-04 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2021-11-10 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RMM _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-10-30 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jee, J.' 1 'Byeon, I.' 2 'Louis, J.M.' 3 'Gronenborn, A.M.' 4 # _citation.id primary _citation.title 'Solution structure of GB1 A34F mutant' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jee, J.' 1 ? primary 'Byeon, I.' 2 ? primary 'Louis, J.M.' 3 ? primary 'Gronenborn, A.M.' 4 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Immunoglobulin G-binding protein G' _entity.formula_weight 6304.905 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation A34F _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'IgG-binding protein G' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYFNDNGVDGEWTYDDATKTFTVTE _entity_poly.pdbx_seq_one_letter_code_can MQYKLILNGKTLKGETTTEAVDAATAEKVFKQYFNDNGVDGEWTYDDATKTFTVTE _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLN n 1 3 TYR n 1 4 LYS n 1 5 LEU n 1 6 ILE n 1 7 LEU n 1 8 ASN n 1 9 GLY n 1 10 LYS n 1 11 THR n 1 12 LEU n 1 13 LYS n 1 14 GLY n 1 15 GLU n 1 16 THR n 1 17 THR n 1 18 THR n 1 19 GLU n 1 20 ALA n 1 21 VAL n 1 22 ASP n 1 23 ALA n 1 24 ALA n 1 25 THR n 1 26 ALA n 1 27 GLU n 1 28 LYS n 1 29 VAL n 1 30 PHE n 1 31 LYS n 1 32 GLN n 1 33 TYR n 1 34 PHE n 1 35 ASN n 1 36 ASP n 1 37 ASN n 1 38 GLY n 1 39 VAL n 1 40 ASP n 1 41 GLY n 1 42 GLU n 1 43 TRP n 1 44 THR n 1 45 TYR n 1 46 ASP n 1 47 ASP n 1 48 ALA n 1 49 THR n 1 50 LYS n 1 51 THR n 1 52 PHE n 1 53 THR n 1 54 VAL n 1 55 THR n 1 56 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus Streptococcus _entity_src_gen.pdbx_gene_src_gene spg _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name ;Streptococcus sp. 'group G' ; _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1320 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector pET15b _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 THR 16 16 16 THR THR A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 THR 25 25 25 THR THR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 TYR 33 33 33 TYR TYR A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 ASN 35 35 35 ASN ASN A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 TYR 45 45 45 TYR TYR A . n A 1 46 ASP 46 46 46 ASP ASP A . n A 1 47 ASP 47 47 47 ASP ASP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 THR 49 49 49 THR THR A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 THR 51 51 51 THR THR A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 THR 55 55 55 THR THR A . n A 1 56 GLU 56 56 56 GLU GLU A . n B 1 1 MET 1 1 1 MET MET B . n B 1 2 GLN 2 2 2 GLN GLN B . n B 1 3 TYR 3 3 3 TYR TYR B . n B 1 4 LYS 4 4 4 LYS LYS B . n B 1 5 LEU 5 5 5 LEU LEU B . n B 1 6 ILE 6 6 6 ILE ILE B . n B 1 7 LEU 7 7 7 LEU LEU B . n B 1 8 ASN 8 8 8 ASN ASN B . n B 1 9 GLY 9 9 9 GLY GLY B . n B 1 10 LYS 10 10 10 LYS LYS B . n B 1 11 THR 11 11 11 THR THR B . n B 1 12 LEU 12 12 12 LEU LEU B . n B 1 13 LYS 13 13 13 LYS LYS B . n B 1 14 GLY 14 14 14 GLY GLY B . n B 1 15 GLU 15 15 15 GLU GLU B . n B 1 16 THR 16 16 16 THR THR B . n B 1 17 THR 17 17 17 THR THR B . n B 1 18 THR 18 18 18 THR THR B . n B 1 19 GLU 19 19 19 GLU GLU B . n B 1 20 ALA 20 20 20 ALA ALA B . n B 1 21 VAL 21 21 21 VAL VAL B . n B 1 22 ASP 22 22 22 ASP ASP B . n B 1 23 ALA 23 23 23 ALA ALA B . n B 1 24 ALA 24 24 24 ALA ALA B . n B 1 25 THR 25 25 25 THR THR B . n B 1 26 ALA 26 26 26 ALA ALA B . n B 1 27 GLU 27 27 27 GLU GLU B . n B 1 28 LYS 28 28 28 LYS LYS B . n B 1 29 VAL 29 29 29 VAL VAL B . n B 1 30 PHE 30 30 30 PHE PHE B . n B 1 31 LYS 31 31 31 LYS LYS B . n B 1 32 GLN 32 32 32 GLN GLN B . n B 1 33 TYR 33 33 33 TYR TYR B . n B 1 34 PHE 34 34 34 PHE PHE B . n B 1 35 ASN 35 35 35 ASN ASN B . n B 1 36 ASP 36 36 36 ASP ASP B . n B 1 37 ASN 37 37 37 ASN ASN B . n B 1 38 GLY 38 38 38 GLY GLY B . n B 1 39 VAL 39 39 39 VAL VAL B . n B 1 40 ASP 40 40 40 ASP ASP B . n B 1 41 GLY 41 41 41 GLY GLY B . n B 1 42 GLU 42 42 42 GLU GLU B . n B 1 43 TRP 43 43 43 TRP TRP B . n B 1 44 THR 44 44 44 THR THR B . n B 1 45 TYR 45 45 45 TYR TYR B . n B 1 46 ASP 46 46 46 ASP ASP B . n B 1 47 ASP 47 47 47 ASP ASP B . n B 1 48 ALA 48 48 48 ALA ALA B . n B 1 49 THR 49 49 49 THR THR B . n B 1 50 LYS 50 50 50 LYS LYS B . n B 1 51 THR 51 51 51 THR THR B . n B 1 52 PHE 52 52 52 PHE PHE B . n B 1 53 THR 53 53 53 THR THR B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 THR 55 55 55 THR THR B . n B 1 56 GLU 56 56 56 GLU GLU B . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RMM _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RMM _struct.title 'Solution structure of GB1 A34F mutant' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RMM _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text 'GB1 mutant, Cell wall, IgG-binding protein, Peptidoglycan-anchor, Secreted, IMMUNE SYSTEM' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SPG1_STRSG _struct_ref.pdbx_db_accession P06654 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE _struct_ref.pdbx_align_begin 229 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2RMM A 3 ? 56 ? P06654 229 ? 282 ? 3 56 2 1 2RMM B 3 ? 56 ? P06654 229 ? 282 ? 3 56 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RMM MET A 1 ? UNP P06654 ? ? 'expression tag' 1 1 1 2RMM GLN A 2 ? UNP P06654 ? ? 'expression tag' 2 2 1 2RMM PHE A 34 ? UNP P06654 ALA 260 'engineered mutation' 34 3 2 2RMM MET B 1 ? UNP P06654 ? ? 'expression tag' 1 4 2 2RMM GLN B 2 ? UNP P06654 ? ? 'expression tag' 2 5 2 2RMM PHE B 34 ? UNP P06654 ALA 260 'engineered mutation' 34 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 22 ? PHE A 34 ? ASP A 22 PHE A 34 1 ? 13 HELX_P HELX_P2 2 ASP A 47 ? THR A 49 ? ASP A 47 THR A 49 5 ? 3 HELX_P HELX_P3 3 ASP B 22 ? PHE B 34 ? ASP B 22 PHE B 34 1 ? 13 HELX_P HELX_P4 4 ASP B 47 ? THR B 49 ? ASP B 47 THR B 49 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 8 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel A 6 7 ? parallel A 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 42 ? ASP A 46 ? GLU A 42 ASP A 46 A 2 THR A 51 ? THR A 55 ? THR A 51 THR A 55 A 3 GLN A 2 ? ASN A 8 ? GLN A 2 ASN A 8 A 4 LYS A 13 ? GLU A 19 ? LYS A 13 GLU A 19 A 5 LYS B 13 ? GLU B 19 ? LYS B 13 GLU B 19 A 6 GLN B 2 ? ASN B 8 ? GLN B 2 ASN B 8 A 7 THR B 51 ? THR B 55 ? THR B 51 THR B 55 A 8 GLU B 42 ? ASP B 46 ? GLU B 42 ASP B 46 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ASP A 46 ? N ASP A 46 O THR A 51 ? O THR A 51 A 2 3 O VAL A 54 ? O VAL A 54 N ILE A 6 ? N ILE A 6 A 3 4 N TYR A 3 ? N TYR A 3 O THR A 18 ? O THR A 18 A 4 5 N THR A 17 ? N THR A 17 O LYS B 13 ? O LYS B 13 A 5 6 O GLY B 14 ? O GLY B 14 N LEU B 7 ? N LEU B 7 A 6 7 N LYS B 4 ? N LYS B 4 O PHE B 52 ? O PHE B 52 A 7 8 O THR B 51 ? O THR B 51 N ASP B 46 ? N ASP B 46 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 36 ? ? -145.15 13.53 2 1 ASP A 40 ? ? 35.42 42.83 3 1 ASP B 36 ? ? -155.24 -71.24 4 1 ASN B 37 ? ? 48.38 28.62 5 1 ASP B 40 ? ? 37.99 42.56 6 2 ASN A 35 ? ? -161.86 -78.71 7 2 ASP A 36 ? ? -141.86 10.80 8 2 ASP A 40 ? ? 37.12 44.21 9 2 LYS A 50 ? ? 39.74 42.12 10 2 ASP B 36 ? ? -157.01 28.20 11 2 ASP B 40 ? ? 36.48 37.48 12 3 ASP A 36 ? ? -158.05 25.67 13 3 ASP A 40 ? ? 37.56 40.76 14 3 ASP B 36 ? ? -158.31 -59.91 15 3 ASN B 37 ? ? 63.99 -72.83 16 3 VAL B 39 ? ? -141.01 -29.03 17 3 ASP B 40 ? ? 39.39 47.38 18 3 LYS B 50 ? ? 38.05 40.19 19 4 ASP A 36 ? ? -166.79 22.59 20 4 ASP A 40 ? ? 39.56 41.56 21 4 ASP B 36 ? ? -160.42 -51.71 22 4 ASN B 37 ? ? 59.85 -81.58 23 4 VAL B 39 ? ? -135.20 -54.12 24 4 ASP B 40 ? ? 39.52 41.13 25 5 ASN A 35 ? ? -164.18 -39.16 26 5 ASP A 36 ? ? -159.80 15.85 27 5 VAL A 39 ? ? -147.10 -49.16 28 5 ASP B 36 ? ? -158.27 -70.86 29 5 ASN B 37 ? ? 26.94 59.96 30 5 VAL B 39 ? ? -125.58 -60.09 31 5 ASP B 40 ? ? 36.93 44.04 32 6 ASN A 35 ? ? -158.76 -63.55 33 6 ASP A 36 ? ? -158.78 17.08 34 6 VAL A 39 ? ? -137.01 -46.29 35 6 LYS A 50 ? ? 38.16 43.61 36 6 THR B 11 ? ? -131.31 -41.98 37 6 ASP B 36 ? ? -162.80 30.33 38 6 VAL B 39 ? ? -157.55 40.89 39 6 ASP B 40 ? ? -66.04 44.58 40 7 VAL A 39 ? ? -150.02 40.62 41 7 ASP A 40 ? ? -64.98 44.08 42 7 ASP B 40 ? ? 39.22 40.26 43 8 ASP A 36 ? ? 44.51 12.37 44 8 ASP A 40 ? ? 39.12 38.05 45 8 ASP B 36 ? ? -161.56 -60.12 46 8 ASP B 40 ? ? 35.81 46.75 47 9 ASN A 35 ? ? -171.66 -155.76 48 9 ASP A 36 ? ? -53.09 -6.31 49 9 ASP A 40 ? ? -75.82 48.43 50 9 ASN B 35 ? ? -63.31 73.02 51 9 ASP B 36 ? ? 66.60 -59.68 52 9 ASN B 37 ? ? 38.88 37.60 53 9 VAL B 39 ? ? -141.91 -41.81 54 9 ASP B 40 ? ? 39.81 34.23 55 9 LYS B 50 ? ? 39.44 40.52 56 10 ASN A 35 ? ? -171.17 -157.11 57 10 VAL A 39 ? ? -123.17 -50.48 58 10 ASP A 40 ? ? 35.56 42.72 59 10 PHE B 34 ? ? -85.13 30.05 60 10 ASN B 35 ? ? -61.27 79.21 61 10 ASP B 36 ? ? 68.88 -66.84 62 10 ASN B 37 ? ? 45.37 28.49 63 10 ASP B 40 ? ? 32.63 44.60 64 10 LYS B 50 ? ? 39.61 40.88 65 11 ASN A 35 ? ? -173.43 -151.86 66 11 ASP A 40 ? ? 37.46 38.58 67 11 ASP B 36 ? ? -159.51 -60.10 68 11 ASN B 37 ? ? 66.22 -77.62 69 12 ASP A 40 ? ? 39.24 37.86 70 12 THR B 11 ? ? -143.06 -41.71 71 12 ASP B 36 ? ? -164.82 22.58 72 12 ASP B 40 ? ? 37.74 39.36 73 13 ASN A 35 ? ? -58.06 -70.51 74 13 ASP A 36 ? ? -160.31 23.21 75 13 ASP A 40 ? ? 37.32 41.11 76 13 PHE B 34 ? ? -88.52 33.07 77 13 ASN B 35 ? ? -68.68 69.15 78 13 ASP B 40 ? ? 33.49 44.51 79 13 LYS B 50 ? ? 37.57 41.46 80 14 ASP A 36 ? ? -162.63 14.86 81 14 ASP A 40 ? ? 36.84 43.01 82 14 ASP B 36 ? ? -163.31 15.73 83 14 ASP B 40 ? ? 35.74 41.14 84 15 ASN A 35 ? ? -173.19 -155.84 85 15 ASP A 36 ? ? -53.71 -9.09 86 15 ASP A 40 ? ? -76.42 46.42 87 15 ASP B 36 ? ? -167.03 26.43 88 15 ASP B 40 ? ? 37.22 40.11 89 16 ASN A 35 ? ? -63.12 49.15 90 16 VAL A 39 ? ? -152.37 -52.32 91 16 ASP A 40 ? ? 31.76 52.93 92 16 ASP B 36 ? ? -165.43 35.34 93 16 ASP B 40 ? ? -67.44 51.06 94 16 LYS B 50 ? ? 39.21 43.39 95 17 ASP A 36 ? ? -159.83 -68.41 96 17 ASN A 37 ? ? 44.48 -66.49 97 17 ASP B 36 ? ? -153.12 10.49 98 17 ASP B 40 ? ? 36.15 41.93 99 17 LYS B 50 ? ? 39.76 40.39 100 18 ASP A 36 ? ? -161.53 5.24 101 18 ASP A 40 ? ? 37.45 43.49 102 18 LYS A 50 ? ? 38.80 43.07 103 18 ASP B 36 ? ? -160.53 32.29 104 18 VAL B 39 ? ? -71.02 38.38 105 19 ASP A 36 ? ? -156.19 16.18 106 19 ASP A 40 ? ? 36.68 47.88 107 19 ASP B 36 ? ? -166.47 32.37 108 19 VAL B 39 ? ? -148.92 36.99 109 19 ASP B 40 ? ? -67.23 39.47 110 20 ASP A 36 ? ? -156.01 -61.13 111 20 ASP A 40 ? ? 33.60 44.63 112 20 THR B 11 ? ? -132.89 -42.84 113 20 ASP B 36 ? ? -159.60 -71.54 114 20 ASN B 37 ? ? 45.51 23.62 115 20 ASP B 40 ? ? 35.25 42.63 116 20 LYS B 50 ? ? 37.74 42.31 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RMM _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RMM _pdbx_nmr_representative.selection_criteria 'closest to the average' # _pdbx_nmr_sample_details.contents '2.0mM [U-99% 13C; U-99% 15N] entity, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample.component entity _pdbx_nmr_exptl_sample.concentration 2.0 _pdbx_nmr_exptl_sample.concentration_units mM _pdbx_nmr_exptl_sample.isotopic_labeling '[U-99% 13C; U-99% 15N]' _pdbx_nmr_exptl_sample.solution_id 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.05 _pdbx_nmr_exptl_sample_conditions.pH 5.5 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HNCACB' 1 5 1 '3D HCCH-TOCSY' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D 1H-15N NOESY' 1 8 1 '3D 1H-13C NOESY' 1 9 1 '3D HNCO' # _pdbx_nmr_refine.entry_id 2RMM _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details 'AMBER 8.0 with GB model' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_software.authors 'Case, Darden, Cheatham, Simmerling, Wang, Duke, Luo, Koll' _pdbx_nmr_software.classification refinement _pdbx_nmr_software.name Amber _pdbx_nmr_software.version 8.0 _pdbx_nmr_software.ordinal 1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 GLN N N N N 47 GLN CA C N S 48 GLN C C N N 49 GLN O O N N 50 GLN CB C N N 51 GLN CG C N N 52 GLN CD C N N 53 GLN OE1 O N N 54 GLN NE2 N N N 55 GLN OXT O N N 56 GLN H H N N 57 GLN H2 H N N 58 GLN HA H N N 59 GLN HB2 H N N 60 GLN HB3 H N N 61 GLN HG2 H N N 62 GLN HG3 H N N 63 GLN HE21 H N N 64 GLN HE22 H N N 65 GLN HXT H N N 66 GLU N N N N 67 GLU CA C N S 68 GLU C C N N 69 GLU O O N N 70 GLU CB C N N 71 GLU CG C N N 72 GLU CD C N N 73 GLU OE1 O N N 74 GLU OE2 O N N 75 GLU OXT O N N 76 GLU H H N N 77 GLU H2 H N N 78 GLU HA H N N 79 GLU HB2 H N N 80 GLU HB3 H N N 81 GLU HG2 H N N 82 GLU HG3 H N N 83 GLU HE2 H N N 84 GLU HXT H N N 85 GLY N N N N 86 GLY CA C N N 87 GLY C C N N 88 GLY O O N N 89 GLY OXT O N N 90 GLY H H N N 91 GLY H2 H N N 92 GLY HA2 H N N 93 GLY HA3 H N N 94 GLY HXT H N N 95 ILE N N N N 96 ILE CA C N S 97 ILE C C N N 98 ILE O O N N 99 ILE CB C N S 100 ILE CG1 C N N 101 ILE CG2 C N N 102 ILE CD1 C N N 103 ILE OXT O N N 104 ILE H H N N 105 ILE H2 H N N 106 ILE HA H N N 107 ILE HB H N N 108 ILE HG12 H N N 109 ILE HG13 H N N 110 ILE HG21 H N N 111 ILE HG22 H N N 112 ILE HG23 H N N 113 ILE HD11 H N N 114 ILE HD12 H N N 115 ILE HD13 H N N 116 ILE HXT H N N 117 LEU N N N N 118 LEU CA C N S 119 LEU C C N N 120 LEU O O N N 121 LEU CB C N N 122 LEU CG C N N 123 LEU CD1 C N N 124 LEU CD2 C N N 125 LEU OXT O N N 126 LEU H H N N 127 LEU H2 H N N 128 LEU HA H N N 129 LEU HB2 H N N 130 LEU HB3 H N N 131 LEU HG H N N 132 LEU HD11 H N N 133 LEU HD12 H N N 134 LEU HD13 H N N 135 LEU HD21 H N N 136 LEU HD22 H N N 137 LEU HD23 H N N 138 LEU HXT H N N 139 LYS N N N N 140 LYS CA C N S 141 LYS C C N N 142 LYS O O N N 143 LYS CB C N N 144 LYS CG C N N 145 LYS CD C N N 146 LYS CE C N N 147 LYS NZ N N N 148 LYS OXT O N N 149 LYS H H N N 150 LYS H2 H N N 151 LYS HA H N N 152 LYS HB2 H N N 153 LYS HB3 H N N 154 LYS HG2 H N N 155 LYS HG3 H N N 156 LYS HD2 H N N 157 LYS HD3 H N N 158 LYS HE2 H N N 159 LYS HE3 H N N 160 LYS HZ1 H N N 161 LYS HZ2 H N N 162 LYS HZ3 H N N 163 LYS HXT H N N 164 MET N N N N 165 MET CA C N S 166 MET C C N N 167 MET O O N N 168 MET CB C N N 169 MET CG C N N 170 MET SD S N N 171 MET CE C N N 172 MET OXT O N N 173 MET H H N N 174 MET H2 H N N 175 MET HA H N N 176 MET HB2 H N N 177 MET HB3 H N N 178 MET HG2 H N N 179 MET HG3 H N N 180 MET HE1 H N N 181 MET HE2 H N N 182 MET HE3 H N N 183 MET HXT H N N 184 PHE N N N N 185 PHE CA C N S 186 PHE C C N N 187 PHE O O N N 188 PHE CB C N N 189 PHE CG C Y N 190 PHE CD1 C Y N 191 PHE CD2 C Y N 192 PHE CE1 C Y N 193 PHE CE2 C Y N 194 PHE CZ C Y N 195 PHE OXT O N N 196 PHE H H N N 197 PHE H2 H N N 198 PHE HA H N N 199 PHE HB2 H N N 200 PHE HB3 H N N 201 PHE HD1 H N N 202 PHE HD2 H N N 203 PHE HE1 H N N 204 PHE HE2 H N N 205 PHE HZ H N N 206 PHE HXT H N N 207 THR N N N N 208 THR CA C N S 209 THR C C N N 210 THR O O N N 211 THR CB C N R 212 THR OG1 O N N 213 THR CG2 C N N 214 THR OXT O N N 215 THR H H N N 216 THR H2 H N N 217 THR HA H N N 218 THR HB H N N 219 THR HG1 H N N 220 THR HG21 H N N 221 THR HG22 H N N 222 THR HG23 H N N 223 THR HXT H N N 224 TRP N N N N 225 TRP CA C N S 226 TRP C C N N 227 TRP O O N N 228 TRP CB C N N 229 TRP CG C Y N 230 TRP CD1 C Y N 231 TRP CD2 C Y N 232 TRP NE1 N Y N 233 TRP CE2 C Y N 234 TRP CE3 C Y N 235 TRP CZ2 C Y N 236 TRP CZ3 C Y N 237 TRP CH2 C Y N 238 TRP OXT O N N 239 TRP H H N N 240 TRP H2 H N N 241 TRP HA H N N 242 TRP HB2 H N N 243 TRP HB3 H N N 244 TRP HD1 H N N 245 TRP HE1 H N N 246 TRP HE3 H N N 247 TRP HZ2 H N N 248 TRP HZ3 H N N 249 TRP HH2 H N N 250 TRP HXT H N N 251 TYR N N N N 252 TYR CA C N S 253 TYR C C N N 254 TYR O O N N 255 TYR CB C N N 256 TYR CG C Y N 257 TYR CD1 C Y N 258 TYR CD2 C Y N 259 TYR CE1 C Y N 260 TYR CE2 C Y N 261 TYR CZ C Y N 262 TYR OH O N N 263 TYR OXT O N N 264 TYR H H N N 265 TYR H2 H N N 266 TYR HA H N N 267 TYR HB2 H N N 268 TYR HB3 H N N 269 TYR HD1 H N N 270 TYR HD2 H N N 271 TYR HE1 H N N 272 TYR HE2 H N N 273 TYR HH H N N 274 TYR HXT H N N 275 VAL N N N N 276 VAL CA C N S 277 VAL C C N N 278 VAL O O N N 279 VAL CB C N N 280 VAL CG1 C N N 281 VAL CG2 C N N 282 VAL OXT O N N 283 VAL H H N N 284 VAL H2 H N N 285 VAL HA H N N 286 VAL HB H N N 287 VAL HG11 H N N 288 VAL HG12 H N N 289 VAL HG13 H N N 290 VAL HG21 H N N 291 VAL HG22 H N N 292 VAL HG23 H N N 293 VAL HXT H N N 294 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 ILE N CA sing N N 90 ILE N H sing N N 91 ILE N H2 sing N N 92 ILE CA C sing N N 93 ILE CA CB sing N N 94 ILE CA HA sing N N 95 ILE C O doub N N 96 ILE C OXT sing N N 97 ILE CB CG1 sing N N 98 ILE CB CG2 sing N N 99 ILE CB HB sing N N 100 ILE CG1 CD1 sing N N 101 ILE CG1 HG12 sing N N 102 ILE CG1 HG13 sing N N 103 ILE CG2 HG21 sing N N 104 ILE CG2 HG22 sing N N 105 ILE CG2 HG23 sing N N 106 ILE CD1 HD11 sing N N 107 ILE CD1 HD12 sing N N 108 ILE CD1 HD13 sing N N 109 ILE OXT HXT sing N N 110 LEU N CA sing N N 111 LEU N H sing N N 112 LEU N H2 sing N N 113 LEU CA C sing N N 114 LEU CA CB sing N N 115 LEU CA HA sing N N 116 LEU C O doub N N 117 LEU C OXT sing N N 118 LEU CB CG sing N N 119 LEU CB HB2 sing N N 120 LEU CB HB3 sing N N 121 LEU CG CD1 sing N N 122 LEU CG CD2 sing N N 123 LEU CG HG sing N N 124 LEU CD1 HD11 sing N N 125 LEU CD1 HD12 sing N N 126 LEU CD1 HD13 sing N N 127 LEU CD2 HD21 sing N N 128 LEU CD2 HD22 sing N N 129 LEU CD2 HD23 sing N N 130 LEU OXT HXT sing N N 131 LYS N CA sing N N 132 LYS N H sing N N 133 LYS N H2 sing N N 134 LYS CA C sing N N 135 LYS CA CB sing N N 136 LYS CA HA sing N N 137 LYS C O doub N N 138 LYS C OXT sing N N 139 LYS CB CG sing N N 140 LYS CB HB2 sing N N 141 LYS CB HB3 sing N N 142 LYS CG CD sing N N 143 LYS CG HG2 sing N N 144 LYS CG HG3 sing N N 145 LYS CD CE sing N N 146 LYS CD HD2 sing N N 147 LYS CD HD3 sing N N 148 LYS CE NZ sing N N 149 LYS CE HE2 sing N N 150 LYS CE HE3 sing N N 151 LYS NZ HZ1 sing N N 152 LYS NZ HZ2 sing N N 153 LYS NZ HZ3 sing N N 154 LYS OXT HXT sing N N 155 MET N CA sing N N 156 MET N H sing N N 157 MET N H2 sing N N 158 MET CA C sing N N 159 MET CA CB sing N N 160 MET CA HA sing N N 161 MET C O doub N N 162 MET C OXT sing N N 163 MET CB CG sing N N 164 MET CB HB2 sing N N 165 MET CB HB3 sing N N 166 MET CG SD sing N N 167 MET CG HG2 sing N N 168 MET CG HG3 sing N N 169 MET SD CE sing N N 170 MET CE HE1 sing N N 171 MET CE HE2 sing N N 172 MET CE HE3 sing N N 173 MET OXT HXT sing N N 174 PHE N CA sing N N 175 PHE N H sing N N 176 PHE N H2 sing N N 177 PHE CA C sing N N 178 PHE CA CB sing N N 179 PHE CA HA sing N N 180 PHE C O doub N N 181 PHE C OXT sing N N 182 PHE CB CG sing N N 183 PHE CB HB2 sing N N 184 PHE CB HB3 sing N N 185 PHE CG CD1 doub Y N 186 PHE CG CD2 sing Y N 187 PHE CD1 CE1 sing Y N 188 PHE CD1 HD1 sing N N 189 PHE CD2 CE2 doub Y N 190 PHE CD2 HD2 sing N N 191 PHE CE1 CZ doub Y N 192 PHE CE1 HE1 sing N N 193 PHE CE2 CZ sing Y N 194 PHE CE2 HE2 sing N N 195 PHE CZ HZ sing N N 196 PHE OXT HXT sing N N 197 THR N CA sing N N 198 THR N H sing N N 199 THR N H2 sing N N 200 THR CA C sing N N 201 THR CA CB sing N N 202 THR CA HA sing N N 203 THR C O doub N N 204 THR C OXT sing N N 205 THR CB OG1 sing N N 206 THR CB CG2 sing N N 207 THR CB HB sing N N 208 THR OG1 HG1 sing N N 209 THR CG2 HG21 sing N N 210 THR CG2 HG22 sing N N 211 THR CG2 HG23 sing N N 212 THR OXT HXT sing N N 213 TRP N CA sing N N 214 TRP N H sing N N 215 TRP N H2 sing N N 216 TRP CA C sing N N 217 TRP CA CB sing N N 218 TRP CA HA sing N N 219 TRP C O doub N N 220 TRP C OXT sing N N 221 TRP CB CG sing N N 222 TRP CB HB2 sing N N 223 TRP CB HB3 sing N N 224 TRP CG CD1 doub Y N 225 TRP CG CD2 sing Y N 226 TRP CD1 NE1 sing Y N 227 TRP CD1 HD1 sing N N 228 TRP CD2 CE2 doub Y N 229 TRP CD2 CE3 sing Y N 230 TRP NE1 CE2 sing Y N 231 TRP NE1 HE1 sing N N 232 TRP CE2 CZ2 sing Y N 233 TRP CE3 CZ3 doub Y N 234 TRP CE3 HE3 sing N N 235 TRP CZ2 CH2 doub Y N 236 TRP CZ2 HZ2 sing N N 237 TRP CZ3 CH2 sing Y N 238 TRP CZ3 HZ3 sing N N 239 TRP CH2 HH2 sing N N 240 TRP OXT HXT sing N N 241 TYR N CA sing N N 242 TYR N H sing N N 243 TYR N H2 sing N N 244 TYR CA C sing N N 245 TYR CA CB sing N N 246 TYR CA HA sing N N 247 TYR C O doub N N 248 TYR C OXT sing N N 249 TYR CB CG sing N N 250 TYR CB HB2 sing N N 251 TYR CB HB3 sing N N 252 TYR CG CD1 doub Y N 253 TYR CG CD2 sing Y N 254 TYR CD1 CE1 sing Y N 255 TYR CD1 HD1 sing N N 256 TYR CD2 CE2 doub Y N 257 TYR CD2 HD2 sing N N 258 TYR CE1 CZ doub Y N 259 TYR CE1 HE1 sing N N 260 TYR CE2 CZ sing Y N 261 TYR CE2 HE2 sing N N 262 TYR CZ OH sing N N 263 TYR OH HH sing N N 264 TYR OXT HXT sing N N 265 VAL N CA sing N N 266 VAL N H sing N N 267 VAL N H2 sing N N 268 VAL CA C sing N N 269 VAL CA CB sing N N 270 VAL CA HA sing N N 271 VAL C O doub N N 272 VAL C OXT sing N N 273 VAL CB CG1 sing N N 274 VAL CB CG2 sing N N 275 VAL CB HB sing N N 276 VAL CG1 HG11 sing N N 277 VAL CG1 HG12 sing N N 278 VAL CG1 HG13 sing N N 279 VAL CG2 HG21 sing N N 280 VAL CG2 HG22 sing N N 281 VAL CG2 HG23 sing N N 282 VAL OXT HXT sing N N 283 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker DRX 1 'Bruker DRX' 600 Bruker DRX 2 'Bruker DRX' 800 Bruker DRX 3 'Bruker DRX' # _atom_sites.entry_id 2RMM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_