data_2ROA # _entry.id 2ROA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2ROA pdb_00002roa 10.2210/pdb2roa/pdb RCSB RCSB150088 ? ? WWPDB D_1000150088 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_site 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2ROA _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2008-03-14 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2RO8 . unspecified PDB 2RO9 . unspecified PDB 2ROB . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ishida, H.' 1 'Huang, H.' 2 'Yamniuk, A.P.' 3 'Takaya, Y.' 4 'Vogel, H.J.' 5 # _citation.id primary _citation.title ;The solution structures of two soybean calmodulin isoforms provide a structural basis for their selective target activation properties ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 283 _citation.page_first 14619 _citation.page_last 14628 _citation.year 2008 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 18347016 _citation.pdbx_database_id_DOI 10.1074/jbc.M801398200 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ishida, H.' 1 ? primary 'Huang, H.' 2 ? primary 'Yamniuk, A.P.' 3 ? primary 'Takaya, Y.' 4 ? primary 'Vogel, H.J.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Calmodulin 8779.618 1 ? ? 'N-terminal domain' ? 2 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ADILSEEQIVDFKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADGNGTIEFDEFLSLMAKKVKDT _entity_poly.pdbx_seq_one_letter_code_can ADILSEEQIVDFKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADGNGTIEFDEFLSLMAKKVKDT _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'CALCIUM ION' _pdbx_entity_nonpoly.comp_id CA # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 ILE n 1 4 LEU n 1 5 SER n 1 6 GLU n 1 7 GLU n 1 8 GLN n 1 9 ILE n 1 10 VAL n 1 11 ASP n 1 12 PHE n 1 13 LYS n 1 14 GLU n 1 15 ALA n 1 16 PHE n 1 17 GLY n 1 18 LEU n 1 19 PHE n 1 20 ASP n 1 21 LYS n 1 22 ASP n 1 23 GLY n 1 24 ASP n 1 25 GLY n 1 26 CYS n 1 27 ILE n 1 28 THR n 1 29 VAL n 1 30 GLU n 1 31 GLU n 1 32 LEU n 1 33 ALA n 1 34 THR n 1 35 VAL n 1 36 ILE n 1 37 ARG n 1 38 SER n 1 39 LEU n 1 40 ASP n 1 41 GLN n 1 42 ASN n 1 43 PRO n 1 44 THR n 1 45 GLU n 1 46 GLU n 1 47 GLU n 1 48 LEU n 1 49 GLN n 1 50 ASP n 1 51 MET n 1 52 ILE n 1 53 SER n 1 54 GLU n 1 55 VAL n 1 56 ASP n 1 57 ALA n 1 58 ASP n 1 59 GLY n 1 60 ASN n 1 61 GLY n 1 62 THR n 1 63 ILE n 1 64 GLU n 1 65 PHE n 1 66 ASP n 1 67 GLU n 1 68 PHE n 1 69 LEU n 1 70 SER n 1 71 LEU n 1 72 MET n 1 73 ALA n 1 74 LYS n 1 75 LYS n 1 76 VAL n 1 77 LYS n 1 78 ASP n 1 79 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name soybean _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Glycine max' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3847 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pET-3d _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 GLN 8 8 8 GLN GLN A . n A 1 9 ILE 9 9 9 ILE ILE A . n A 1 10 VAL 10 10 10 VAL VAL A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PHE 16 16 16 PHE PHE A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 GLY 23 23 23 GLY GLY A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 CYS 26 26 26 CYS CYS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 THR 28 28 28 THR THR A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 THR 34 34 34 THR THR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 ARG 37 37 37 ARG ARG A . n A 1 38 SER 38 38 38 SER SER A . n A 1 39 LEU 39 39 39 LEU LEU A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLN 41 41 41 GLN GLN A . n A 1 42 ASN 42 42 42 ASN ASN A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 THR 44 44 44 THR THR A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ILE 52 52 52 ILE ILE A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 ASP 56 56 56 ASP ASP A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ASN 60 60 60 ASN ASN A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 THR 62 62 62 THR THR A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 GLU 64 64 64 GLU GLU A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 MET 72 72 72 MET MET A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 VAL 76 76 76 VAL VAL A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 THR 79 79 79 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 179 179 CA CA A . C 2 CA 1 192 192 CA CA A . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2ROA _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2ROA _struct.title 'Solution structure of calcium bound soybean calmodulin isoform 4 N-terminal domain' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2ROA _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' _struct_keywords.text 'soybean calmodulin, plant calmodulin, calmodulin isoform, target binding, target activation, Calcium, METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q39890_SOYBN _struct_ref.pdbx_db_accession Q39890 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ADILSEEQIVDFKEAFGLFDKDGDGCITVEELATVIRSLDQNPTEEELQDMISEVDADGNGTIEFDEFLSLMAKKVKDT _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2ROA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 79 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q39890 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 80 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 79 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 7 ? ASP A 20 ? GLU A 7 ASP A 20 1 ? 14 HELX_P HELX_P2 2 VAL A 29 ? LEU A 39 ? VAL A 29 LEU A 39 1 ? 11 HELX_P HELX_P3 3 THR A 44 ? ASP A 56 ? THR A 44 ASP A 56 1 ? 13 HELX_P HELX_P4 4 GLU A 64 ? VAL A 76 ? GLU A 64 VAL A 76 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 20 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 20 A CA 179 1_555 ? ? ? ? ? ? ? 2.611 ? ? metalc2 metalc ? ? A ASP 22 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 22 A CA 179 1_555 ? ? ? ? ? ? ? 2.652 ? ? metalc3 metalc ? ? A ASP 24 OD1 ? ? ? 1_555 B CA . CA ? ? A ASP 24 A CA 179 1_555 ? ? ? ? ? ? ? 2.955 ? ? metalc4 metalc ? ? A ASP 24 OD2 ? ? ? 1_555 B CA . CA ? ? A ASP 24 A CA 179 1_555 ? ? ? ? ? ? ? 2.594 ? ? metalc5 metalc ? ? A CYS 26 O ? ? ? 1_555 B CA . CA ? ? A CYS 26 A CA 179 1_555 ? ? ? ? ? ? ? 2.655 ? ? metalc6 metalc ? ? A GLU 31 OE1 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 179 1_555 ? ? ? ? ? ? ? 2.602 ? ? metalc7 metalc ? ? A GLU 31 OE2 ? ? ? 1_555 B CA . CA ? ? A GLU 31 A CA 179 1_555 ? ? ? ? ? ? ? 2.696 ? ? metalc8 metalc ? ? A ASP 56 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 56 A CA 192 1_555 ? ? ? ? ? ? ? 2.599 ? ? metalc9 metalc ? ? A ASP 56 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 56 A CA 192 1_555 ? ? ? ? ? ? ? 2.673 ? ? metalc10 metalc ? ? A ASP 58 OD1 ? ? ? 1_555 C CA . CA ? ? A ASP 58 A CA 192 1_555 ? ? ? ? ? ? ? 2.602 ? ? metalc11 metalc ? ? A ASP 58 OD2 ? ? ? 1_555 C CA . CA ? ? A ASP 58 A CA 192 1_555 ? ? ? ? ? ? ? 2.986 ? ? metalc12 metalc ? ? A ASN 60 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 60 A CA 192 1_555 ? ? ? ? ? ? ? 2.602 ? ? metalc13 metalc ? ? A ASN 60 ND2 ? ? ? 1_555 C CA . CA ? ? A ASN 60 A CA 192 1_555 ? ? ? ? ? ? ? 2.769 ? ? metalc14 metalc ? ? A THR 62 O ? ? ? 1_555 C CA . CA ? ? A THR 62 A CA 192 1_555 ? ? ? ? ? ? ? 2.601 ? ? metalc15 metalc ? ? A GLU 67 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 192 1_555 ? ? ? ? ? ? ? 2.566 ? ? metalc16 metalc ? ? A GLU 67 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 67 A CA 192 1_555 ? ? ? ? ? ? ? 2.609 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 99.0 ? 2 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 62.8 ? 3 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 138.4 ? 4 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 103.6 ? 5 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 116.9 ? 6 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 45.1 ? 7 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 O ? A CYS 26 ? A CYS 26 ? 1_555 93.4 ? 8 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 O ? A CYS 26 ? A CYS 26 ? 1_555 167.0 ? 9 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 O ? A CYS 26 ? A CYS 26 ? 1_555 51.7 ? 10 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 O ? A CYS 26 ? A CYS 26 ? 1_555 62.9 ? 11 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 150.4 ? 12 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 90.3 ? 13 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 124.6 ? 14 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 96.9 ? 15 O ? A CYS 26 ? A CYS 26 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 77.0 ? 16 OD1 ? A ASP 20 ? A ASP 20 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 150.8 ? 17 OD2 ? A ASP 22 ? A ASP 22 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 51.8 ? 18 OD1 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 135.4 ? 19 OD2 ? A ASP 24 ? A ASP 24 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 90.3 ? 20 O ? A CYS 26 ? A CYS 26 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 115.8 ? 21 OE1 ? A GLU 31 ? A GLU 31 ? 1_555 CA ? B CA . ? A CA 179 ? 1_555 OE2 ? A GLU 31 ? A GLU 31 ? 1_555 47.9 ? 22 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 47.9 ? 23 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 55.0 ? 24 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 101.8 ? 25 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 83.5 ? 26 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 127.3 ? 27 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 44.7 ? 28 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 84.4 ? 29 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 68.9 ? 30 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 116.9 ? 31 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 90.3 ? 32 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 116.0 ? 33 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 117.1 ? 34 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 105.2 ? 35 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 61.1 ? 36 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 48.2 ? 37 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 108.0 ? 38 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 60.3 ? 39 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 161.1 ? 40 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 150.3 ? 41 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 64.6 ? 42 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 O ? A THR 62 ? A THR 62 ? 1_555 89.5 ? 43 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 112.4 ? 44 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 95.0 ? 45 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 102.1 ? 46 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 126.4 ? 47 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 139.8 ? 48 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 131.6 ? 49 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 75.4 ? 50 OD1 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 100.6 ? 51 OD2 ? A ASP 56 ? A ASP 56 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 123.4 ? 52 OD1 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 58.8 ? 53 OD2 ? A ASP 58 ? A ASP 58 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 78.3 ? 54 OD1 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 166.8 ? 55 ND2 ? A ASN 60 ? A ASN 60 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 119.3 ? 56 O ? A THR 62 ? A THR 62 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 124.1 ? 57 OE1 ? A GLU 67 ? A GLU 67 ? 1_555 CA ? C CA . ? A CA 192 ? 1_555 OE2 ? A GLU 67 ? A GLU 67 ? 1_555 49.2 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 27 ? THR A 28 ? ILE A 27 THR A 28 A 2 THR A 62 ? ILE A 63 ? THR A 62 ILE A 63 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ILE _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 27 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 27 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id ILE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 63 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id ILE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 63 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 179 ? 2 'BINDING SITE FOR RESIDUE CA A 179' AC2 Software A CA 192 ? 4 'BINDING SITE FOR RESIDUE CA A 192' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ASP A 20 ? ASP A 20 . ? 1_555 ? 2 AC1 2 ASP A 24 ? ASP A 24 . ? 1_555 ? 3 AC2 4 ILE A 52 ? ILE A 52 . ? 1_555 ? 4 AC2 4 ASP A 56 ? ASP A 56 . ? 1_555 ? 5 AC2 4 ASP A 58 ? ASP A 58 . ? 1_555 ? 6 AC2 4 ASN A 60 ? ASN A 60 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD1 A ASN 60 ? ? H A THR 62 ? ? 1.49 2 1 O A ILE 9 ? ? H A LYS 13 ? ? 1.50 3 1 O A ILE 52 ? ? H A ASP 56 ? ? 1.52 4 1 O A GLN 49 ? ? H A SER 53 ? ? 1.54 5 1 O A GLU 64 ? ? H A PHE 68 ? ? 1.55 6 1 O A ASP 20 ? ? H A GLY 23 ? ? 1.59 7 1 OD1 A ASP 78 ? ? H A THR 79 ? ? 1.59 8 1 O A SER 70 ? ? H A LYS 74 ? ? 1.60 9 2 O A ILE 52 ? ? H A ASP 56 ? ? 1.46 10 2 O A GLN 49 ? ? H A SER 53 ? ? 1.56 11 2 OD1 A ASN 60 ? ? H A THR 62 ? ? 1.58 12 2 O A ASP 20 ? ? H A GLY 23 ? ? 1.58 13 3 O A GLU 45 ? ? H A GLN 49 ? ? 1.47 14 3 OD1 A ASN 60 ? ? H A THR 62 ? ? 1.49 15 3 O A GLN 49 ? ? H A SER 53 ? ? 1.54 16 3 OD1 A ASP 24 ? ? H A CYS 26 ? ? 1.56 17 3 O A ASP 20 ? ? H A GLY 23 ? ? 1.59 18 3 O A GLU 64 ? ? H A PHE 68 ? ? 1.59 19 4 O A SER 70 ? ? H A LYS 74 ? ? 1.47 20 4 O A ASP 20 ? ? H A GLY 23 ? ? 1.54 21 4 O A GLN 49 ? ? H A SER 53 ? ? 1.55 22 4 O A GLU 64 ? ? H A PHE 68 ? ? 1.56 23 4 O A ILE 52 ? ? H A ASP 56 ? ? 1.57 24 5 O A ILE 52 ? ? H A ASP 56 ? ? 1.45 25 5 O A GLN 49 ? ? H A SER 53 ? ? 1.47 26 5 O A ASP 20 ? ? H A GLY 23 ? ? 1.51 27 5 O A GLU 45 ? ? H A GLN 49 ? ? 1.53 28 5 O A ILE 9 ? ? H A LYS 13 ? ? 1.56 29 5 O A SER 70 ? ? H A LYS 74 ? ? 1.60 30 6 O A ILE 52 ? ? H A ASP 56 ? ? 1.49 31 6 O A ILE 9 ? ? H A LYS 13 ? ? 1.51 32 6 O A ASP 20 ? ? H A GLY 23 ? ? 1.54 33 6 OD1 A ASP 56 ? ? H A GLY 59 ? ? 1.55 34 6 OD1 A ASN 60 ? ? H A THR 62 ? ? 1.58 35 7 O A ILE 52 ? ? H A ASP 56 ? ? 1.45 36 7 O A ASP 20 ? ? H A GLY 23 ? ? 1.47 37 7 HD22 A ASN 60 ? ? CA A CA 192 ? ? 1.50 38 7 O A LEU 4 ? ? HG A SER 5 ? ? 1.56 39 8 O A GLN 49 ? ? H A SER 53 ? ? 1.51 40 8 O A ILE 52 ? ? H A ASP 56 ? ? 1.54 41 8 O A SER 70 ? ? H A LYS 74 ? ? 1.56 42 8 O A ASP 20 ? ? H A GLY 23 ? ? 1.60 43 9 O A ASP 20 ? ? H A GLY 23 ? ? 1.52 44 9 O A ILE 52 ? ? H A ASP 56 ? ? 1.54 45 9 O A GLN 49 ? ? H A SER 53 ? ? 1.56 46 9 O A SER 70 ? ? H A LYS 74 ? ? 1.57 47 10 OG A SER 70 ? ? HZ1 A LYS 74 ? ? 1.41 48 10 O A ILE 52 ? ? H A ASP 56 ? ? 1.44 49 10 O A GLU 64 ? ? H A PHE 68 ? ? 1.50 50 10 OD1 A ASN 60 ? ? H A THR 62 ? ? 1.52 51 10 O A ASP 20 ? ? H A GLY 23 ? ? 1.53 52 10 O A GLN 49 ? ? H A SER 53 ? ? 1.60 53 11 O A SER 5 ? ? H A GLU 7 ? ? 1.46 54 11 O A GLN 49 ? ? H A SER 53 ? ? 1.48 55 11 O A ILE 52 ? ? H A ASP 56 ? ? 1.51 56 11 O A GLU 45 ? ? H A GLN 49 ? ? 1.52 57 11 O A ILE 9 ? ? H A LYS 13 ? ? 1.52 58 11 O A ASP 20 ? ? H A GLY 23 ? ? 1.54 59 11 O A LEU 48 ? ? H A ILE 52 ? ? 1.55 60 11 O A SER 70 ? ? H A LYS 74 ? ? 1.56 61 11 OD1 A ASP 78 ? ? H A THR 79 ? ? 1.57 62 12 O A GLN 49 ? ? H A SER 53 ? ? 1.47 63 12 O A ILE 52 ? ? H A ASP 56 ? ? 1.50 64 12 O A ILE 9 ? ? H A LYS 13 ? ? 1.52 65 12 O A GLU 64 ? ? H A PHE 68 ? ? 1.56 66 12 O A ASP 20 ? ? H A GLY 23 ? ? 1.56 67 12 O A SER 70 ? ? H A LYS 74 ? ? 1.57 68 12 O A GLU 45 ? ? H A GLN 49 ? ? 1.60 69 13 O A SER 70 ? ? H A LYS 74 ? ? 1.43 70 13 O A ASP 20 ? ? H A GLY 23 ? ? 1.49 71 13 O A GLU 46 ? ? H A ASP 50 ? ? 1.49 72 13 OD2 A ASP 20 ? ? H A GLY 25 ? ? 1.54 73 13 O A GLU 45 ? ? H A GLN 49 ? ? 1.55 74 13 O A THR 44 ? ? H A LEU 48 ? ? 1.56 75 13 OD1 A ASP 78 ? ? H A THR 79 ? ? 1.56 76 13 OD1 A ASN 60 ? ? H A THR 62 ? ? 1.57 77 14 O A SER 5 ? ? H A GLU 7 ? ? 1.45 78 14 O A ILE 52 ? ? H A ASP 56 ? ? 1.48 79 14 O A ASP 20 ? ? H A GLY 23 ? ? 1.52 80 14 OD1 A ASP 78 ? ? H A THR 79 ? ? 1.53 81 14 O A ILE 9 ? ? H A LYS 13 ? ? 1.53 82 14 O A GLU 46 ? ? H A ASP 50 ? ? 1.56 83 14 O A GLN 49 ? ? H A SER 53 ? ? 1.59 84 15 H1 A ALA 1 ? ? H A ASP 2 ? ? 1.32 85 15 O A GLU 45 ? ? H A GLN 49 ? ? 1.49 86 15 O A GLN 49 ? ? H A SER 53 ? ? 1.49 87 15 O A GLU 64 ? ? H A PHE 68 ? ? 1.56 88 15 O A SER 70 ? ? H A LYS 74 ? ? 1.58 89 15 O A ASP 20 ? ? H A GLY 23 ? ? 1.59 90 16 O A ASP 20 ? ? H A GLY 23 ? ? 1.46 91 16 O A ILE 52 ? ? H A ASP 56 ? ? 1.47 92 16 OE2 A GLU 54 ? ? HZ3 A LYS 74 ? ? 1.54 93 16 O A GLU 45 ? ? H A GLN 49 ? ? 1.57 94 16 O A GLN 49 ? ? H A SER 53 ? ? 1.57 95 16 OD2 A ASP 20 ? ? H A GLY 25 ? ? 1.58 96 17 O A ILE 52 ? ? H A ASP 56 ? ? 1.46 97 17 O A ASP 20 ? ? H A GLY 23 ? ? 1.48 98 17 O A GLU 64 ? ? H A PHE 68 ? ? 1.51 99 17 OD1 A ASN 60 ? ? H A THR 62 ? ? 1.52 100 17 O A GLN 49 ? ? H A SER 53 ? ? 1.56 101 17 O A GLU 46 ? ? H A ASP 50 ? ? 1.57 102 17 O A PHE 65 ? ? H A LEU 69 ? ? 1.57 103 17 OD2 A ASP 20 ? ? H A GLY 25 ? ? 1.59 104 18 O A ILE 52 ? ? H A ASP 56 ? ? 1.46 105 18 O A ASP 20 ? ? H A GLY 23 ? ? 1.47 106 18 OD1 A ASP 78 ? ? H A THR 79 ? ? 1.55 107 19 O A ALA 73 ? ? H A LYS 77 ? ? 1.46 108 19 O A ASP 20 ? ? H A GLY 23 ? ? 1.49 109 19 OD2 A ASP 20 ? ? H A GLY 25 ? ? 1.51 110 19 OD1 A ASN 60 ? ? H A THR 62 ? ? 1.51 111 19 O A ILE 52 ? ? H A ASP 56 ? ? 1.52 112 19 O A GLU 64 ? ? H A PHE 68 ? ? 1.56 113 19 O A ALA 33 ? ? H A ARG 37 ? ? 1.59 114 19 O A ILE 9 ? ? H A LYS 13 ? ? 1.59 115 20 OD1 A ASP 2 ? ? H A ILE 3 ? ? 1.44 116 20 O A GLU 45 ? ? H A GLN 49 ? ? 1.52 117 20 O A GLU 64 ? ? H A PHE 68 ? ? 1.54 118 20 O A GLN 49 ? ? H A SER 53 ? ? 1.55 119 20 O A ASP 20 ? ? H A GLY 23 ? ? 1.59 120 20 OD1 A ASN 60 ? ? H A THR 62 ? ? 1.59 121 20 O A ILE 52 ? ? H A ASP 56 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 3 ? ? -105.63 -101.37 2 1 SER A 5 ? ? -69.77 96.38 3 1 LYS A 21 ? ? -39.02 -23.51 4 1 LEU A 39 ? ? -68.04 22.64 5 1 ASP A 56 ? ? -58.90 86.22 6 2 GLU A 6 ? ? -73.51 48.78 7 2 LYS A 21 ? ? -37.75 -32.54 8 2 ASP A 40 ? ? 155.66 -1.04 9 2 ASP A 56 ? ? -63.52 80.71 10 3 ILE A 3 ? ? 67.73 63.55 11 3 SER A 5 ? ? -156.68 -15.60 12 3 GLU A 6 ? ? 68.96 73.56 13 3 LYS A 21 ? ? -39.51 -26.52 14 3 ASP A 40 ? ? 147.38 2.33 15 3 ASN A 42 ? ? -152.14 70.74 16 3 ASP A 56 ? ? -63.77 77.92 17 3 LYS A 77 ? ? -47.35 -14.71 18 4 SER A 5 ? ? -58.70 -6.81 19 4 GLU A 7 ? ? -93.69 -64.56 20 4 LYS A 21 ? ? -37.02 -31.20 21 4 LEU A 39 ? ? -70.46 26.32 22 4 ASN A 42 ? ? -154.74 83.86 23 4 PRO A 43 ? ? -59.72 170.85 24 5 ILE A 3 ? ? 57.56 144.95 25 5 SER A 5 ? ? 105.95 -156.88 26 5 GLU A 6 ? ? -75.77 26.99 27 5 LYS A 21 ? ? -36.73 -26.59 28 5 ASP A 40 ? ? 151.11 2.24 29 5 ASP A 56 ? ? -61.83 81.44 30 6 ILE A 3 ? ? 58.66 98.86 31 6 SER A 5 ? ? 82.33 -113.69 32 6 GLU A 6 ? ? 79.75 55.20 33 6 LYS A 21 ? ? -38.48 -19.04 34 6 LEU A 39 ? ? -68.92 21.75 35 6 LYS A 77 ? ? -59.06 -7.64 36 7 ILE A 3 ? ? -70.09 -91.78 37 7 SER A 5 ? ? 152.77 -78.54 38 7 GLU A 7 ? ? -94.33 -66.85 39 7 ASP A 20 ? ? -87.62 48.91 40 7 LYS A 21 ? ? -35.41 -28.78 41 7 ASP A 40 ? ? 141.39 12.15 42 7 ASN A 42 ? ? -155.42 69.04 43 7 GLU A 45 ? ? -37.69 -36.67 44 7 ASP A 56 ? ? -64.56 77.31 45 8 ILE A 3 ? ? 57.86 114.13 46 8 SER A 5 ? ? 82.22 51.70 47 8 GLU A 6 ? ? -79.81 44.34 48 8 LYS A 21 ? ? -41.11 -15.37 49 8 LEU A 39 ? ? -68.42 20.72 50 8 ASN A 42 ? ? -150.95 72.56 51 8 ASP A 56 ? ? -60.68 81.85 52 9 ILE A 3 ? ? -157.12 -58.29 53 9 SER A 5 ? ? 73.86 -63.21 54 9 GLU A 6 ? ? 76.69 59.44 55 9 GLU A 7 ? ? -93.95 -68.39 56 9 LYS A 21 ? ? -37.54 -21.48 57 9 ASP A 40 ? ? 154.63 -4.87 58 10 SER A 5 ? ? 176.44 5.01 59 10 ASP A 20 ? ? -78.85 48.14 60 10 LEU A 39 ? ? -67.95 25.78 61 10 ASP A 56 ? ? -63.82 79.41 62 11 ILE A 3 ? ? -138.15 -73.66 63 11 SER A 5 ? ? -167.97 -144.68 64 11 GLU A 6 ? ? 62.85 -41.26 65 11 LYS A 21 ? ? -38.59 -27.19 66 11 ASP A 40 ? ? 142.01 12.56 67 11 ASP A 56 ? ? -63.97 78.53 68 12 ASP A 2 ? ? -170.97 -120.77 69 12 ILE A 3 ? ? 64.91 -0.46 70 12 SER A 5 ? ? 74.47 -53.28 71 12 GLU A 6 ? ? 78.42 56.91 72 12 LYS A 21 ? ? -38.62 -23.05 73 12 ASP A 40 ? ? 141.12 10.68 74 12 ASN A 42 ? ? -154.16 70.72 75 12 ASP A 56 ? ? -59.37 84.21 76 12 LYS A 77 ? ? -49.33 -13.69 77 13 ASP A 2 ? ? 52.98 83.45 78 13 ILE A 3 ? ? -90.09 -108.50 79 13 GLU A 7 ? ? -94.73 -60.78 80 13 ASP A 20 ? ? -79.37 47.13 81 13 LYS A 21 ? ? -36.49 -25.84 82 13 LEU A 39 ? ? -70.82 25.48 83 13 ASN A 42 ? ? -154.17 79.69 84 13 ASP A 56 ? ? -62.99 76.68 85 14 ASP A 2 ? ? -64.46 -76.03 86 14 SER A 5 ? ? 24.11 -98.16 87 14 GLU A 6 ? ? 61.01 -35.00 88 14 ASP A 20 ? ? -78.80 43.32 89 14 LYS A 21 ? ? -37.48 -23.17 90 14 ASP A 40 ? ? 131.54 18.24 91 14 PRO A 43 ? ? -59.52 172.11 92 14 ASP A 56 ? ? -61.53 81.35 93 15 SER A 5 ? ? 62.88 -130.41 94 15 GLU A 6 ? ? -83.84 39.29 95 15 LYS A 21 ? ? -39.18 -30.66 96 15 LEU A 39 ? ? -66.21 19.32 97 15 ASP A 56 ? ? -59.89 81.38 98 15 LYS A 77 ? ? -47.20 -14.04 99 16 GLU A 6 ? ? 68.09 75.16 100 16 GLU A 7 ? ? -94.42 -60.80 101 16 LYS A 21 ? ? -37.23 -27.74 102 16 LEU A 39 ? ? -67.67 23.87 103 16 ASP A 56 ? ? -65.41 98.10 104 17 ILE A 3 ? ? -40.16 156.35 105 17 SER A 5 ? ? -65.23 74.05 106 17 ASP A 20 ? ? -92.53 49.42 107 17 LYS A 21 ? ? -36.50 -30.03 108 17 ASP A 40 ? ? 137.83 17.36 109 17 ASN A 42 ? ? -153.99 84.23 110 17 PRO A 43 ? ? -59.99 179.49 111 17 ASP A 56 ? ? -64.02 76.52 112 18 ASP A 2 ? ? -92.12 55.59 113 18 SER A 5 ? ? 74.46 166.39 114 18 GLU A 7 ? ? -93.84 -64.67 115 18 LYS A 21 ? ? -35.57 -28.72 116 18 ASP A 40 ? ? 134.14 17.44 117 18 ASN A 42 ? ? -150.20 78.59 118 18 PRO A 43 ? ? -58.27 -177.54 119 18 ASP A 56 ? ? -64.20 77.03 120 19 GLU A 7 ? ? -91.58 -60.30 121 19 LYS A 21 ? ? -36.29 -30.69 122 19 ASP A 40 ? ? 150.99 0.24 123 19 ASN A 42 ? ? -153.93 76.87 124 19 PRO A 43 ? ? -52.16 176.44 125 19 ASP A 56 ? ? -64.34 77.44 126 20 ASP A 2 ? ? 63.75 -156.31 127 20 SER A 5 ? ? -47.05 151.56 128 20 GLU A 6 ? ? -159.30 54.68 129 20 GLU A 7 ? ? -95.01 -61.71 130 20 LYS A 21 ? ? -39.54 -18.58 131 20 ASP A 40 ? ? 153.30 0.91 132 20 ASP A 56 ? ? -59.03 84.26 133 20 LYS A 77 ? ? -48.65 -14.15 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 200 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2ROA _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2ROA _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '1 mM [U-100% 13C; U-100% 15N] Calmodulin, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '1 mM [U-100% 15N] Calmodulin, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' '1 mM Calmodulin, 100% D2O' 3 '100% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id Calmodulin 1 mM '[U-100% 13C; U-100% 15N]' 1 Calmodulin 1 mM '[U-100% 15N]' 2 Calmodulin 1 mM ? 3 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.1 _pdbx_nmr_exptl_sample_conditions.pH 6.8 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 303 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '3D HNCACB' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D HNCO' 1 4 1 '3D HN(CA)CO' 1 5 2 '3D 1H-15N NOESY' 1 6 1 '3D 1H-13C NOESY' 1 7 1 '3D H(CCO)NH' 1 8 1 '3D C(CO)NH' 1 9 1 '3D HBHA(CO)NH' 1 10 3 '2D 1H-1H NOESY' # _pdbx_nmr_refine.entry_id 2ROA _pdbx_nmr_refine.method 'torsion angle dynamics, simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler and Wuthrich' 'chemical shift assignment' CYANA 2.0 1 'Guntert, Mumenthaler and Wuthrich' 'structure solution' CYANA 2.0 2 'Schwieters, Kuszewski, Tjandra and Clore' 'structure solution' 'X-PLOR NIH' 2.14 3 'Schwieters, Kuszewski, Tjandra and Clore' refinement 'X-PLOR NIH' 2.14 4 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 ILE N N N N 138 ILE CA C N S 139 ILE C C N N 140 ILE O O N N 141 ILE CB C N S 142 ILE CG1 C N N 143 ILE CG2 C N N 144 ILE CD1 C N N 145 ILE OXT O N N 146 ILE H H N N 147 ILE H2 H N N 148 ILE HA H N N 149 ILE HB H N N 150 ILE HG12 H N N 151 ILE HG13 H N N 152 ILE HG21 H N N 153 ILE HG22 H N N 154 ILE HG23 H N N 155 ILE HD11 H N N 156 ILE HD12 H N N 157 ILE HD13 H N N 158 ILE HXT H N N 159 LEU N N N N 160 LEU CA C N S 161 LEU C C N N 162 LEU O O N N 163 LEU CB C N N 164 LEU CG C N N 165 LEU CD1 C N N 166 LEU CD2 C N N 167 LEU OXT O N N 168 LEU H H N N 169 LEU H2 H N N 170 LEU HA H N N 171 LEU HB2 H N N 172 LEU HB3 H N N 173 LEU HG H N N 174 LEU HD11 H N N 175 LEU HD12 H N N 176 LEU HD13 H N N 177 LEU HD21 H N N 178 LEU HD22 H N N 179 LEU HD23 H N N 180 LEU HXT H N N 181 LYS N N N N 182 LYS CA C N S 183 LYS C C N N 184 LYS O O N N 185 LYS CB C N N 186 LYS CG C N N 187 LYS CD C N N 188 LYS CE C N N 189 LYS NZ N N N 190 LYS OXT O N N 191 LYS H H N N 192 LYS H2 H N N 193 LYS HA H N N 194 LYS HB2 H N N 195 LYS HB3 H N N 196 LYS HG2 H N N 197 LYS HG3 H N N 198 LYS HD2 H N N 199 LYS HD3 H N N 200 LYS HE2 H N N 201 LYS HE3 H N N 202 LYS HZ1 H N N 203 LYS HZ2 H N N 204 LYS HZ3 H N N 205 LYS HXT H N N 206 MET N N N N 207 MET CA C N S 208 MET C C N N 209 MET O O N N 210 MET CB C N N 211 MET CG C N N 212 MET SD S N N 213 MET CE C N N 214 MET OXT O N N 215 MET H H N N 216 MET H2 H N N 217 MET HA H N N 218 MET HB2 H N N 219 MET HB3 H N N 220 MET HG2 H N N 221 MET HG3 H N N 222 MET HE1 H N N 223 MET HE2 H N N 224 MET HE3 H N N 225 MET HXT H N N 226 PHE N N N N 227 PHE CA C N S 228 PHE C C N N 229 PHE O O N N 230 PHE CB C N N 231 PHE CG C Y N 232 PHE CD1 C Y N 233 PHE CD2 C Y N 234 PHE CE1 C Y N 235 PHE CE2 C Y N 236 PHE CZ C Y N 237 PHE OXT O N N 238 PHE H H N N 239 PHE H2 H N N 240 PHE HA H N N 241 PHE HB2 H N N 242 PHE HB3 H N N 243 PHE HD1 H N N 244 PHE HD2 H N N 245 PHE HE1 H N N 246 PHE HE2 H N N 247 PHE HZ H N N 248 PHE HXT H N N 249 PRO N N N N 250 PRO CA C N S 251 PRO C C N N 252 PRO O O N N 253 PRO CB C N N 254 PRO CG C N N 255 PRO CD C N N 256 PRO OXT O N N 257 PRO H H N N 258 PRO HA H N N 259 PRO HB2 H N N 260 PRO HB3 H N N 261 PRO HG2 H N N 262 PRO HG3 H N N 263 PRO HD2 H N N 264 PRO HD3 H N N 265 PRO HXT H N N 266 SER N N N N 267 SER CA C N S 268 SER C C N N 269 SER O O N N 270 SER CB C N N 271 SER OG O N N 272 SER OXT O N N 273 SER H H N N 274 SER H2 H N N 275 SER HA H N N 276 SER HB2 H N N 277 SER HB3 H N N 278 SER HG H N N 279 SER HXT H N N 280 THR N N N N 281 THR CA C N S 282 THR C C N N 283 THR O O N N 284 THR CB C N R 285 THR OG1 O N N 286 THR CG2 C N N 287 THR OXT O N N 288 THR H H N N 289 THR H2 H N N 290 THR HA H N N 291 THR HB H N N 292 THR HG1 H N N 293 THR HG21 H N N 294 THR HG22 H N N 295 THR HG23 H N N 296 THR HXT H N N 297 VAL N N N N 298 VAL CA C N S 299 VAL C C N N 300 VAL O O N N 301 VAL CB C N N 302 VAL CG1 C N N 303 VAL CG2 C N N 304 VAL OXT O N N 305 VAL H H N N 306 VAL H2 H N N 307 VAL HA H N N 308 VAL HB H N N 309 VAL HG11 H N N 310 VAL HG12 H N N 311 VAL HG13 H N N 312 VAL HG21 H N N 313 VAL HG22 H N N 314 VAL HG23 H N N 315 VAL HXT H N N 316 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 ILE N CA sing N N 129 ILE N H sing N N 130 ILE N H2 sing N N 131 ILE CA C sing N N 132 ILE CA CB sing N N 133 ILE CA HA sing N N 134 ILE C O doub N N 135 ILE C OXT sing N N 136 ILE CB CG1 sing N N 137 ILE CB CG2 sing N N 138 ILE CB HB sing N N 139 ILE CG1 CD1 sing N N 140 ILE CG1 HG12 sing N N 141 ILE CG1 HG13 sing N N 142 ILE CG2 HG21 sing N N 143 ILE CG2 HG22 sing N N 144 ILE CG2 HG23 sing N N 145 ILE CD1 HD11 sing N N 146 ILE CD1 HD12 sing N N 147 ILE CD1 HD13 sing N N 148 ILE OXT HXT sing N N 149 LEU N CA sing N N 150 LEU N H sing N N 151 LEU N H2 sing N N 152 LEU CA C sing N N 153 LEU CA CB sing N N 154 LEU CA HA sing N N 155 LEU C O doub N N 156 LEU C OXT sing N N 157 LEU CB CG sing N N 158 LEU CB HB2 sing N N 159 LEU CB HB3 sing N N 160 LEU CG CD1 sing N N 161 LEU CG CD2 sing N N 162 LEU CG HG sing N N 163 LEU CD1 HD11 sing N N 164 LEU CD1 HD12 sing N N 165 LEU CD1 HD13 sing N N 166 LEU CD2 HD21 sing N N 167 LEU CD2 HD22 sing N N 168 LEU CD2 HD23 sing N N 169 LEU OXT HXT sing N N 170 LYS N CA sing N N 171 LYS N H sing N N 172 LYS N H2 sing N N 173 LYS CA C sing N N 174 LYS CA CB sing N N 175 LYS CA HA sing N N 176 LYS C O doub N N 177 LYS C OXT sing N N 178 LYS CB CG sing N N 179 LYS CB HB2 sing N N 180 LYS CB HB3 sing N N 181 LYS CG CD sing N N 182 LYS CG HG2 sing N N 183 LYS CG HG3 sing N N 184 LYS CD CE sing N N 185 LYS CD HD2 sing N N 186 LYS CD HD3 sing N N 187 LYS CE NZ sing N N 188 LYS CE HE2 sing N N 189 LYS CE HE3 sing N N 190 LYS NZ HZ1 sing N N 191 LYS NZ HZ2 sing N N 192 LYS NZ HZ3 sing N N 193 LYS OXT HXT sing N N 194 MET N CA sing N N 195 MET N H sing N N 196 MET N H2 sing N N 197 MET CA C sing N N 198 MET CA CB sing N N 199 MET CA HA sing N N 200 MET C O doub N N 201 MET C OXT sing N N 202 MET CB CG sing N N 203 MET CB HB2 sing N N 204 MET CB HB3 sing N N 205 MET CG SD sing N N 206 MET CG HG2 sing N N 207 MET CG HG3 sing N N 208 MET SD CE sing N N 209 MET CE HE1 sing N N 210 MET CE HE2 sing N N 211 MET CE HE3 sing N N 212 MET OXT HXT sing N N 213 PHE N CA sing N N 214 PHE N H sing N N 215 PHE N H2 sing N N 216 PHE CA C sing N N 217 PHE CA CB sing N N 218 PHE CA HA sing N N 219 PHE C O doub N N 220 PHE C OXT sing N N 221 PHE CB CG sing N N 222 PHE CB HB2 sing N N 223 PHE CB HB3 sing N N 224 PHE CG CD1 doub Y N 225 PHE CG CD2 sing Y N 226 PHE CD1 CE1 sing Y N 227 PHE CD1 HD1 sing N N 228 PHE CD2 CE2 doub Y N 229 PHE CD2 HD2 sing N N 230 PHE CE1 CZ doub Y N 231 PHE CE1 HE1 sing N N 232 PHE CE2 CZ sing Y N 233 PHE CE2 HE2 sing N N 234 PHE CZ HZ sing N N 235 PHE OXT HXT sing N N 236 PRO N CA sing N N 237 PRO N CD sing N N 238 PRO N H sing N N 239 PRO CA C sing N N 240 PRO CA CB sing N N 241 PRO CA HA sing N N 242 PRO C O doub N N 243 PRO C OXT sing N N 244 PRO CB CG sing N N 245 PRO CB HB2 sing N N 246 PRO CB HB3 sing N N 247 PRO CG CD sing N N 248 PRO CG HG2 sing N N 249 PRO CG HG3 sing N N 250 PRO CD HD2 sing N N 251 PRO CD HD3 sing N N 252 PRO OXT HXT sing N N 253 SER N CA sing N N 254 SER N H sing N N 255 SER N H2 sing N N 256 SER CA C sing N N 257 SER CA CB sing N N 258 SER CA HA sing N N 259 SER C O doub N N 260 SER C OXT sing N N 261 SER CB OG sing N N 262 SER CB HB2 sing N N 263 SER CB HB3 sing N N 264 SER OG HG sing N N 265 SER OXT HXT sing N N 266 THR N CA sing N N 267 THR N H sing N N 268 THR N H2 sing N N 269 THR CA C sing N N 270 THR CA CB sing N N 271 THR CA HA sing N N 272 THR C O doub N N 273 THR C OXT sing N N 274 THR CB OG1 sing N N 275 THR CB CG2 sing N N 276 THR CB HB sing N N 277 THR OG1 HG1 sing N N 278 THR CG2 HG21 sing N N 279 THR CG2 HG22 sing N N 280 THR CG2 HG23 sing N N 281 THR OXT HXT sing N N 282 VAL N CA sing N N 283 VAL N H sing N N 284 VAL N H2 sing N N 285 VAL CA C sing N N 286 VAL CA CB sing N N 287 VAL CA HA sing N N 288 VAL C O doub N N 289 VAL C OXT sing N N 290 VAL CB CG1 sing N N 291 VAL CB CG2 sing N N 292 VAL CB HB sing N N 293 VAL CG1 HG11 sing N N 294 VAL CG1 HG12 sing N N 295 VAL CG1 HG13 sing N N 296 VAL CG2 HG21 sing N N 297 VAL CG2 HG22 sing N N 298 VAL CG2 HG23 sing N N 299 VAL OXT HXT sing N N 300 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 500 Bruker AVANCE 1 'Bruker Avance' 700 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2ROA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S # loop_