data_2RQA # _entry.id 2RQA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.399 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RQA pdb_00002rqa 10.2210/pdb2rqa/pdb RCSB RCSB150156 ? ? WWPDB D_1000150156 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2009-05-05 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-11-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_struct_assembly 3 3 'Structure model' pdbx_struct_oper_list 4 3 'Structure model' struct_ref_seq_dif 5 3 'Structure model' struct_site 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' pdbx_entry_details 9 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RQA _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2009-03-17 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Takahasi, K.' 1 'Kumeta, H.' 2 'Tsuduki, N.' 3 'Narita, R.' 4 'Shigemoto, T.' 5 'Hirai, R.' 6 'Yoneyama, M.' 7 'Horiuchi, M.' 8 'Ogura, K.' 9 'Fujita, T.' 10 'Fuyuhiko, I.' 11 # _citation.id primary _citation.title ;Solution Structures of Cytosolic RNA Sensor MDA5 and LGP2 C-terminal Domains: IDENTIFICATION OF THE RNA RECOGNITION LOOP IN RIG-I-LIKE RECEPTORS ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 284 _citation.page_first 17465 _citation.page_last 17474 _citation.year 2009 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 19380577 _citation.pdbx_database_id_DOI 10.1074/jbc.M109.007179 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Takahasi, K.' 1 ? primary 'Kumeta, H.' 2 ? primary 'Tsuduki, N.' 3 ? primary 'Narita, R.' 4 ? primary 'Shigemoto, T.' 5 ? primary 'Hirai, R.' 6 ? primary 'Yoneyama, M.' 7 ? primary 'Horiuchi, M.' 8 ? primary 'Ogura, K.' 9 ? primary 'Fujita, T.' 10 ? primary 'Inagaki, F.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ATP-dependent RNA helicase DHX58' 15553.013 1 3.6.1.- ? 'UNP residues 546-678' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ATP-dependent helicase LGP2, Protein D11Lgp2 homolog' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPHMQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGL QMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD ; _entity_poly.pdbx_seq_one_letter_code_can ;GPHMQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGL QMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 HIS n 1 4 MET n 1 5 GLN n 1 6 PHE n 1 7 PRO n 1 8 VAL n 1 9 GLU n 1 10 HIS n 1 11 VAL n 1 12 GLN n 1 13 LEU n 1 14 LEU n 1 15 CYS n 1 16 ILE n 1 17 ASN n 1 18 CYS n 1 19 MET n 1 20 VAL n 1 21 ALA n 1 22 VAL n 1 23 GLY n 1 24 HIS n 1 25 GLY n 1 26 SER n 1 27 ASP n 1 28 LEU n 1 29 ARG n 1 30 LYS n 1 31 VAL n 1 32 GLU n 1 33 GLY n 1 34 THR n 1 35 HIS n 1 36 HIS n 1 37 VAL n 1 38 ASN n 1 39 VAL n 1 40 ASN n 1 41 PRO n 1 42 ASN n 1 43 PHE n 1 44 SER n 1 45 ASN n 1 46 TYR n 1 47 TYR n 1 48 ASN n 1 49 VAL n 1 50 SER n 1 51 ARG n 1 52 ASP n 1 53 PRO n 1 54 VAL n 1 55 VAL n 1 56 ILE n 1 57 ASN n 1 58 LYS n 1 59 VAL n 1 60 PHE n 1 61 LYS n 1 62 ASP n 1 63 TRP n 1 64 LYS n 1 65 PRO n 1 66 GLY n 1 67 GLY n 1 68 VAL n 1 69 ILE n 1 70 SER n 1 71 CYS n 1 72 ARG n 1 73 ASN n 1 74 CYS n 1 75 GLY n 1 76 GLU n 1 77 VAL n 1 78 TRP n 1 79 GLY n 1 80 LEU n 1 81 GLN n 1 82 MET n 1 83 ILE n 1 84 TYR n 1 85 LYS n 1 86 SER n 1 87 VAL n 1 88 LYS n 1 89 LEU n 1 90 PRO n 1 91 VAL n 1 92 LEU n 1 93 LYS n 1 94 VAL n 1 95 ARG n 1 96 SER n 1 97 MET n 1 98 LEU n 1 99 LEU n 1 100 GLU n 1 101 THR n 1 102 PRO n 1 103 GLN n 1 104 GLY n 1 105 ARG n 1 106 ILE n 1 107 GLN n 1 108 ALA n 1 109 LYS n 1 110 LYS n 1 111 TRP n 1 112 SER n 1 113 ARG n 1 114 VAL n 1 115 PRO n 1 116 PHE n 1 117 SER n 1 118 VAL n 1 119 PRO n 1 120 ASP n 1 121 PHE n 1 122 ASP n 1 123 PHE n 1 124 LEU n 1 125 GLN n 1 126 HIS n 1 127 CYS n 1 128 ALA n 1 129 GLU n 1 130 ASN n 1 131 LEU n 1 132 SER n 1 133 ASP n 1 134 LEU n 1 135 SER n 1 136 LEU n 1 137 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DHX58, D11LGP2E, LGP2' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pGEX-6P-1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 542 542 GLY GLY A . n A 1 2 PRO 2 543 543 PRO PRO A . n A 1 3 HIS 3 544 544 HIS HIS A . n A 1 4 MET 4 545 545 MET MET A . n A 1 5 GLN 5 546 546 GLN GLN A . n A 1 6 PHE 6 547 547 PHE PHE A . n A 1 7 PRO 7 548 548 PRO PRO A . n A 1 8 VAL 8 549 549 VAL VAL A . n A 1 9 GLU 9 550 550 GLU GLU A . n A 1 10 HIS 10 551 551 HIS HIS A . n A 1 11 VAL 11 552 552 VAL VAL A . n A 1 12 GLN 12 553 553 GLN GLN A . n A 1 13 LEU 13 554 554 LEU LEU A . n A 1 14 LEU 14 555 555 LEU LEU A . n A 1 15 CYS 15 556 556 CYS CYS A . n A 1 16 ILE 16 557 557 ILE ILE A . n A 1 17 ASN 17 558 558 ASN ASN A . n A 1 18 CYS 18 559 559 CYS CYS A . n A 1 19 MET 19 560 560 MET MET A . n A 1 20 VAL 20 561 561 VAL VAL A . n A 1 21 ALA 21 562 562 ALA ALA A . n A 1 22 VAL 22 563 563 VAL VAL A . n A 1 23 GLY 23 564 564 GLY GLY A . n A 1 24 HIS 24 565 565 HIS HIS A . n A 1 25 GLY 25 566 566 GLY GLY A . n A 1 26 SER 26 567 567 SER SER A . n A 1 27 ASP 27 568 568 ASP ASP A . n A 1 28 LEU 28 569 569 LEU LEU A . n A 1 29 ARG 29 570 570 ARG ARG A . n A 1 30 LYS 30 571 571 LYS LYS A . n A 1 31 VAL 31 572 572 VAL VAL A . n A 1 32 GLU 32 573 573 GLU GLU A . n A 1 33 GLY 33 574 574 GLY GLY A . n A 1 34 THR 34 575 575 THR THR A . n A 1 35 HIS 35 576 576 HIS HIS A . n A 1 36 HIS 36 577 577 HIS HIS A . n A 1 37 VAL 37 578 578 VAL VAL A . n A 1 38 ASN 38 579 579 ASN ASN A . n A 1 39 VAL 39 580 580 VAL VAL A . n A 1 40 ASN 40 581 581 ASN ASN A . n A 1 41 PRO 41 582 582 PRO PRO A . n A 1 42 ASN 42 583 583 ASN ASN A . n A 1 43 PHE 43 584 584 PHE PHE A . n A 1 44 SER 44 585 585 SER SER A . n A 1 45 ASN 45 586 586 ASN ASN A . n A 1 46 TYR 46 587 587 TYR TYR A . n A 1 47 TYR 47 588 588 TYR TYR A . n A 1 48 ASN 48 589 589 ASN ASN A . n A 1 49 VAL 49 590 590 VAL VAL A . n A 1 50 SER 50 591 591 SER SER A . n A 1 51 ARG 51 592 592 ARG ARG A . n A 1 52 ASP 52 593 593 ASP ASP A . n A 1 53 PRO 53 594 594 PRO PRO A . n A 1 54 VAL 54 595 595 VAL VAL A . n A 1 55 VAL 55 596 596 VAL VAL A . n A 1 56 ILE 56 597 597 ILE ILE A . n A 1 57 ASN 57 598 598 ASN ASN A . n A 1 58 LYS 58 599 599 LYS LYS A . n A 1 59 VAL 59 600 600 VAL VAL A . n A 1 60 PHE 60 601 601 PHE PHE A . n A 1 61 LYS 61 602 602 LYS LYS A . n A 1 62 ASP 62 603 603 ASP ASP A . n A 1 63 TRP 63 604 604 TRP TRP A . n A 1 64 LYS 64 605 605 LYS LYS A . n A 1 65 PRO 65 606 606 PRO PRO A . n A 1 66 GLY 66 607 607 GLY GLY A . n A 1 67 GLY 67 608 608 GLY GLY A . n A 1 68 VAL 68 609 609 VAL VAL A . n A 1 69 ILE 69 610 610 ILE ILE A . n A 1 70 SER 70 611 611 SER SER A . n A 1 71 CYS 71 612 612 CYS CYS A . n A 1 72 ARG 72 613 613 ARG ARG A . n A 1 73 ASN 73 614 614 ASN ASN A . n A 1 74 CYS 74 615 615 CYS CYS A . n A 1 75 GLY 75 616 616 GLY GLY A . n A 1 76 GLU 76 617 617 GLU GLU A . n A 1 77 VAL 77 618 618 VAL VAL A . n A 1 78 TRP 78 619 619 TRP TRP A . n A 1 79 GLY 79 620 620 GLY GLY A . n A 1 80 LEU 80 621 621 LEU LEU A . n A 1 81 GLN 81 622 622 GLN GLN A . n A 1 82 MET 82 623 623 MET MET A . n A 1 83 ILE 83 624 624 ILE ILE A . n A 1 84 TYR 84 625 625 TYR TYR A . n A 1 85 LYS 85 626 626 LYS LYS A . n A 1 86 SER 86 627 627 SER SER A . n A 1 87 VAL 87 628 628 VAL VAL A . n A 1 88 LYS 88 629 629 LYS LYS A . n A 1 89 LEU 89 630 630 LEU LEU A . n A 1 90 PRO 90 631 631 PRO PRO A . n A 1 91 VAL 91 632 632 VAL VAL A . n A 1 92 LEU 92 633 633 LEU LEU A . n A 1 93 LYS 93 634 634 LYS LYS A . n A 1 94 VAL 94 635 635 VAL VAL A . n A 1 95 ARG 95 636 636 ARG ARG A . n A 1 96 SER 96 637 637 SER SER A . n A 1 97 MET 97 638 638 MET MET A . n A 1 98 LEU 98 639 639 LEU LEU A . n A 1 99 LEU 99 640 640 LEU LEU A . n A 1 100 GLU 100 641 641 GLU GLU A . n A 1 101 THR 101 642 642 THR THR A . n A 1 102 PRO 102 643 643 PRO PRO A . n A 1 103 GLN 103 644 644 GLN GLN A . n A 1 104 GLY 104 645 645 GLY GLY A . n A 1 105 ARG 105 646 646 ARG ARG A . n A 1 106 ILE 106 647 647 ILE ILE A . n A 1 107 GLN 107 648 648 GLN GLN A . n A 1 108 ALA 108 649 649 ALA ALA A . n A 1 109 LYS 109 650 650 LYS LYS A . n A 1 110 LYS 110 651 651 LYS LYS A . n A 1 111 TRP 111 652 652 TRP TRP A . n A 1 112 SER 112 653 653 SER SER A . n A 1 113 ARG 113 654 654 ARG ARG A . n A 1 114 VAL 114 655 655 VAL VAL A . n A 1 115 PRO 115 656 656 PRO PRO A . n A 1 116 PHE 116 657 657 PHE PHE A . n A 1 117 SER 117 658 658 SER SER A . n A 1 118 VAL 118 659 659 VAL VAL A . n A 1 119 PRO 119 660 660 PRO PRO A . n A 1 120 ASP 120 661 661 ASP ASP A . n A 1 121 PHE 121 662 662 PHE PHE A . n A 1 122 ASP 122 663 663 ASP ASP A . n A 1 123 PHE 123 664 664 PHE PHE A . n A 1 124 LEU 124 665 665 LEU LEU A . n A 1 125 GLN 125 666 666 GLN GLN A . n A 1 126 HIS 126 667 667 HIS HIS A . n A 1 127 CYS 127 668 668 CYS CYS A . n A 1 128 ALA 128 669 669 ALA ALA A . n A 1 129 GLU 129 670 670 GLU GLU A . n A 1 130 ASN 130 671 671 ASN ASN A . n A 1 131 LEU 131 672 672 LEU LEU A . n A 1 132 SER 132 673 673 SER SER A . n A 1 133 ASP 133 674 674 ASP ASP A . n A 1 134 LEU 134 675 675 LEU LEU A . n A 1 135 SER 135 676 676 SER SER A . n A 1 136 LEU 136 677 677 LEU LEU A . n A 1 137 ASP 137 678 678 ASP ASP A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 679 _pdbx_nonpoly_scheme.auth_seq_num 556 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RQA _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RQA _struct.title 'Solution structure of LGP2 CTD' _struct.pdbx_model_details 'lowest energy, model 1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RQA _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text ;RNA binding protein, ATP-binding, Coiled coil, Cytoplasm, Helicase, Hydrolase, Immune response, Innate immunity, Nucleotide-binding, Polymorphism, RNA-binding ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DHX58_HUMAN _struct_ref.pdbx_db_accession Q96C10 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;QFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIY KSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD ; _struct_ref.pdbx_align_begin 546 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RQA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 137 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96C10 _struct_ref_seq.db_align_beg 546 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 678 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 546 _struct_ref_seq.pdbx_auth_seq_align_end 678 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2RQA GLY A 1 ? UNP Q96C10 ? ? 'expression tag' 542 1 1 2RQA PRO A 2 ? UNP Q96C10 ? ? 'expression tag' 543 2 1 2RQA HIS A 3 ? UNP Q96C10 ? ? 'expression tag' 544 3 1 2RQA MET A 4 ? UNP Q96C10 ? ? 'expression tag' 545 4 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 41 ? TYR A 46 ? PRO A 582 TYR A 587 5 ? 6 HELX_P HELX_P2 2 ASP A 122 ? LEU A 131 ? ASP A 663 LEU A 672 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 18 SG ? ? ? 1_555 A CYS 74 SG ? ? A CYS 559 A CYS 615 1_555 ? ? ? ? ? ? ? 0.803 ? ? metalc1 metalc ? ? A CYS 15 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 556 A ZN 679 1_555 ? ? ? ? ? ? ? 2.732 ? ? metalc2 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 559 A ZN 679 1_555 ? ? ? ? ? ? ? 2.352 ? ? metalc3 metalc ? ? A CYS 71 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 612 A ZN 679 1_555 ? ? ? ? ? ? ? 2.342 ? ? metalc4 metalc ? ? A CYS 74 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 615 A ZN 679 1_555 ? ? ? ? ? ? ? 2.340 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 15 ? A CYS 556 ? 1_555 ZN ? B ZN . ? A ZN 679 ? 1_555 SG ? A CYS 18 ? A CYS 559 ? 1_555 90.1 ? 2 SG ? A CYS 15 ? A CYS 556 ? 1_555 ZN ? B ZN . ? A ZN 679 ? 1_555 SG ? A CYS 71 ? A CYS 612 ? 1_555 87.2 ? 3 SG ? A CYS 18 ? A CYS 559 ? 1_555 ZN ? B ZN . ? A ZN 679 ? 1_555 SG ? A CYS 71 ? A CYS 612 ? 1_555 101.1 ? 4 SG ? A CYS 15 ? A CYS 556 ? 1_555 ZN ? B ZN . ? A ZN 679 ? 1_555 SG ? A CYS 74 ? A CYS 615 ? 1_555 92.1 ? 5 SG ? A CYS 18 ? A CYS 559 ? 1_555 ZN ? B ZN . ? A ZN 679 ? 1_555 SG ? A CYS 74 ? A CYS 615 ? 1_555 19.7 ? 6 SG ? A CYS 71 ? A CYS 612 ? 1_555 ZN ? B ZN . ? A ZN 679 ? 1_555 SG ? A CYS 74 ? A CYS 615 ? 1_555 120.8 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id CYS _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 18 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 74 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id CYS _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 559 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 615 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom SG _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id . _pdbx_modification_feature.ref_pcm_id . _pdbx_modification_feature.ref_comp_id . _pdbx_modification_feature.type None _pdbx_modification_feature.category 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 23 ? HIS A 24 ? GLY A 564 HIS A 565 A 2 GLN A 12 ? CYS A 15 ? GLN A 553 CYS A 556 A 3 MET A 97 ? GLU A 100 ? MET A 638 GLU A 641 B 1 LEU A 28 ? VAL A 31 ? LEU A 569 VAL A 572 B 2 HIS A 35 ? ASN A 38 ? HIS A 576 ASN A 579 C 1 LYS A 64 ? PRO A 65 ? LYS A 605 PRO A 606 C 2 LEU A 80 ? ILE A 83 ? LEU A 621 ILE A 624 C 3 LYS A 88 ? VAL A 91 ? LYS A 629 VAL A 632 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O GLY A 23 ? O GLY A 564 N LEU A 13 ? N LEU A 554 A 2 3 N LEU A 14 ? N LEU A 555 O LEU A 98 ? O LEU A 639 B 1 2 N ARG A 29 ? N ARG A 570 O VAL A 37 ? O VAL A 578 C 1 2 N LYS A 64 ? N LYS A 605 O ILE A 83 ? O ILE A 624 C 2 3 N MET A 82 ? N MET A 623 O LEU A 89 ? O LEU A 630 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 679 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 5 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 679' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 15 ? CYS A 556 . ? 1_555 ? 2 AC1 5 CYS A 18 ? CYS A 559 . ? 1_555 ? 3 AC1 5 CYS A 71 ? CYS A 612 . ? 1_555 ? 4 AC1 5 CYS A 74 ? CYS A 615 . ? 1_555 ? 5 AC1 5 GLY A 75 ? GLY A 616 . ? 1_555 ? # _pdbx_entry_details.entry_id 2RQA _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 12 SG A CYS 559 ? ? CB A CYS 615 ? ? 2.09 2 12 CB A CYS 559 ? ? SG A CYS 615 ? ? 2.12 3 19 SG A CYS 559 ? ? CB A CYS 615 ? ? 2.11 4 19 CB A CYS 559 ? ? SG A CYS 615 ? ? 2.14 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 543 ? ? -75.01 -166.02 2 1 MET A 545 ? ? -37.80 95.91 3 1 ILE A 557 ? ? -35.58 -33.86 4 1 MET A 560 ? ? 76.92 49.26 5 1 ALA A 562 ? ? 83.26 104.32 6 1 ASN A 581 ? ? 179.51 129.84 7 1 SER A 591 ? ? -56.06 174.57 8 1 ASP A 593 ? ? -44.93 152.95 9 1 PRO A 594 ? ? -74.99 -89.64 10 1 CYS A 615 ? ? -124.29 -74.03 11 1 GLU A 617 ? ? -42.73 102.65 12 1 SER A 627 ? ? 85.11 40.62 13 1 VAL A 655 ? ? -39.94 128.83 14 1 ASP A 663 ? ? -69.99 93.52 15 2 PRO A 543 ? ? -75.02 -165.16 16 2 MET A 545 ? ? -110.97 74.84 17 2 ILE A 557 ? ? -32.21 -37.54 18 2 CYS A 559 ? ? -73.80 -70.35 19 2 MET A 560 ? ? 78.17 43.92 20 2 ALA A 562 ? ? 65.91 108.72 21 2 THR A 575 ? ? -131.35 -71.59 22 2 ASN A 581 ? ? 178.81 128.72 23 2 PRO A 594 ? ? -75.03 -89.56 24 2 CYS A 615 ? ? -129.80 -74.33 25 2 GLU A 617 ? ? -42.50 103.37 26 2 SER A 627 ? ? 81.33 40.39 27 2 ARG A 646 ? ? -39.55 155.15 28 3 ILE A 557 ? ? -35.67 -33.92 29 3 CYS A 559 ? ? -74.03 -70.31 30 3 MET A 560 ? ? 77.31 48.35 31 3 ALA A 562 ? ? 82.46 102.35 32 3 GLU A 573 ? ? 46.86 24.11 33 3 THR A 575 ? ? -36.23 -76.51 34 3 ASN A 581 ? ? 176.49 141.28 35 3 PRO A 594 ? ? -74.90 -89.71 36 3 ASN A 598 ? ? -91.29 -64.64 37 3 LYS A 602 ? ? -108.99 -62.00 38 3 CYS A 615 ? ? -125.35 -75.02 39 3 GLU A 617 ? ? -42.78 102.37 40 3 SER A 627 ? ? 86.02 39.67 41 4 MET A 545 ? ? -101.49 68.06 42 4 ILE A 557 ? ? -34.40 -35.62 43 4 CYS A 559 ? ? -71.01 -71.61 44 4 MET A 560 ? ? 77.36 42.15 45 4 ALA A 562 ? ? 84.09 100.61 46 4 ASN A 581 ? ? 173.35 130.74 47 4 PRO A 594 ? ? -75.01 -76.71 48 4 LYS A 602 ? ? -105.94 -62.84 49 4 CYS A 615 ? ? -123.22 -75.54 50 4 GLU A 617 ? ? -42.61 102.58 51 4 SER A 627 ? ? 85.49 38.71 52 4 LYS A 629 ? ? -67.81 99.35 53 4 LYS A 634 ? ? -109.42 -169.56 54 4 ARG A 646 ? ? -46.77 152.15 55 4 LEU A 675 ? ? -96.67 -66.87 56 5 PRO A 543 ? ? -75.00 -169.75 57 5 ILE A 557 ? ? -31.49 -38.83 58 5 CYS A 559 ? ? -74.96 -70.48 59 5 MET A 560 ? ? 79.14 46.37 60 5 ALA A 562 ? ? 66.07 108.33 61 5 THR A 575 ? ? -131.27 -60.66 62 5 ASN A 581 ? ? 178.86 128.44 63 5 ASP A 593 ? ? -47.42 158.41 64 5 PRO A 594 ? ? -75.01 -89.76 65 5 CYS A 615 ? ? -127.42 -73.34 66 5 GLU A 617 ? ? -42.08 102.85 67 5 SER A 627 ? ? 85.37 39.28 68 5 ARG A 646 ? ? -46.11 152.32 69 5 ASP A 663 ? ? -69.25 93.52 70 5 ASN A 671 ? ? -95.25 -61.03 71 6 ILE A 557 ? ? -36.05 -32.23 72 6 ALA A 562 ? ? 66.17 112.44 73 6 THR A 575 ? ? -125.27 -64.67 74 6 ASN A 581 ? ? 161.82 126.67 75 6 ASP A 593 ? ? -47.78 151.47 76 6 PRO A 594 ? ? -75.00 -89.56 77 6 PRO A 606 ? ? -74.99 -166.49 78 6 CYS A 615 ? ? -122.94 -76.89 79 6 GLU A 617 ? ? -42.90 102.54 80 6 SER A 627 ? ? 85.88 42.04 81 6 LYS A 634 ? ? -105.56 -165.34 82 6 ARG A 646 ? ? -43.95 152.64 83 6 VAL A 655 ? ? -39.94 130.62 84 6 PHE A 664 ? ? -39.61 -28.75 85 6 LEU A 675 ? ? -61.69 -78.32 86 7 ILE A 557 ? ? -34.71 -34.46 87 7 MET A 560 ? ? 78.07 47.94 88 7 ALA A 562 ? ? 83.49 99.85 89 7 ASN A 581 ? ? 161.94 135.19 90 7 SER A 591 ? ? -59.04 174.41 91 7 PRO A 594 ? ? -75.03 -89.61 92 7 CYS A 612 ? ? -56.25 109.25 93 7 CYS A 615 ? ? -118.37 -73.46 94 7 GLU A 617 ? ? -42.17 102.85 95 7 SER A 627 ? ? 85.34 39.51 96 7 VAL A 655 ? ? -40.00 127.06 97 7 ASP A 661 ? ? -42.52 161.97 98 7 LEU A 675 ? ? -83.19 -72.37 99 8 PRO A 543 ? ? -75.03 -83.61 100 8 ILE A 557 ? ? -35.23 -32.64 101 8 ALA A 562 ? ? 66.11 109.32 102 8 ASN A 581 ? ? 176.38 130.05 103 8 SER A 591 ? ? -56.58 173.66 104 8 ASP A 593 ? ? -42.41 155.47 105 8 PRO A 594 ? ? -74.92 -89.58 106 8 CYS A 615 ? ? -122.14 -76.05 107 8 GLU A 617 ? ? -42.09 102.17 108 8 VAL A 618 ? ? -53.98 103.42 109 8 SER A 627 ? ? 84.29 42.32 110 8 LYS A 629 ? ? -62.40 98.23 111 9 ILE A 557 ? ? -35.62 -33.37 112 9 MET A 560 ? ? 76.57 48.55 113 9 ALA A 562 ? ? 83.39 108.20 114 9 ASN A 581 ? ? 176.25 141.85 115 9 ASP A 593 ? ? -41.35 150.47 116 9 PRO A 594 ? ? -75.01 -72.08 117 9 CYS A 615 ? ? -133.96 -73.76 118 9 GLU A 617 ? ? -42.27 104.11 119 9 SER A 627 ? ? 85.66 40.73 120 9 LEU A 675 ? ? -65.54 -72.44 121 10 MET A 545 ? ? -92.80 49.08 122 10 ILE A 557 ? ? -31.94 -37.95 123 10 CYS A 559 ? ? -73.97 -70.74 124 10 MET A 560 ? ? 77.47 41.63 125 10 ALA A 562 ? ? 84.46 102.96 126 10 ASN A 581 ? ? 176.29 142.66 127 10 ASP A 593 ? ? -42.85 150.29 128 10 PRO A 594 ? ? -74.97 -90.25 129 10 CYS A 615 ? ? -123.11 -73.86 130 10 GLU A 617 ? ? -43.04 103.25 131 10 LYS A 626 ? ? 58.54 17.71 132 10 SER A 627 ? ? 86.42 38.61 133 10 LYS A 629 ? ? -64.07 99.19 134 10 ARG A 646 ? ? -42.10 151.61 135 10 PHE A 662 ? ? -58.25 109.41 136 11 ILE A 557 ? ? -34.87 -34.38 137 11 MET A 560 ? ? 77.23 47.18 138 11 ALA A 562 ? ? 81.65 102.16 139 11 GLU A 573 ? ? 38.76 39.43 140 11 HIS A 577 ? ? -39.92 120.62 141 11 ASN A 581 ? ? 170.71 124.66 142 11 SER A 591 ? ? -56.36 174.70 143 11 PRO A 594 ? ? -74.97 -89.72 144 11 CYS A 615 ? ? -130.35 -74.76 145 11 GLU A 617 ? ? -42.79 102.38 146 11 LYS A 626 ? ? 55.71 19.27 147 11 SER A 627 ? ? 85.17 38.70 148 11 SER A 676 ? ? -173.94 144.00 149 12 PRO A 543 ? ? -75.05 -88.33 150 12 MET A 545 ? ? -60.53 83.28 151 12 PHE A 547 ? ? -162.55 94.53 152 12 ILE A 557 ? ? -37.81 -32.91 153 12 MET A 560 ? ? -63.27 71.18 154 12 ALA A 562 ? ? 75.22 105.18 155 12 GLU A 573 ? ? 45.66 25.55 156 12 THR A 575 ? ? -113.60 -74.91 157 12 ASN A 581 ? ? 177.46 129.39 158 12 SER A 591 ? ? -50.15 171.89 159 12 PRO A 594 ? ? -74.91 -89.89 160 12 PRO A 606 ? ? -74.98 -162.53 161 12 CYS A 615 ? ? -138.41 -73.02 162 12 GLU A 617 ? ? -41.95 105.55 163 12 SER A 627 ? ? 85.15 37.30 164 12 ARG A 646 ? ? -46.09 153.16 165 12 VAL A 655 ? ? -39.98 116.50 166 12 PHE A 664 ? ? -37.59 -37.90 167 13 PRO A 543 ? ? -75.00 -87.86 168 13 MET A 545 ? ? -108.30 75.94 169 13 ILE A 557 ? ? -36.32 -32.20 170 13 ALA A 562 ? ? 84.55 107.64 171 13 HIS A 576 ? ? -168.13 106.09 172 13 HIS A 577 ? ? -44.70 151.22 173 13 ASN A 581 ? ? 179.01 132.66 174 13 SER A 591 ? ? -56.30 174.53 175 13 PRO A 594 ? ? -74.97 -89.71 176 13 CYS A 615 ? ? -126.95 -74.24 177 13 GLU A 617 ? ? -42.13 106.68 178 13 SER A 627 ? ? 86.60 40.70 179 13 LYS A 629 ? ? -67.81 99.18 180 13 ARG A 646 ? ? -38.68 148.85 181 13 VAL A 655 ? ? -39.85 119.84 182 13 ASP A 661 ? ? -42.23 151.52 183 13 SER A 676 ? ? -173.71 145.12 184 14 HIS A 544 ? ? -55.25 -178.80 185 14 ILE A 557 ? ? -34.75 -34.20 186 14 MET A 560 ? ? 79.59 45.98 187 14 ALA A 562 ? ? 65.67 111.17 188 14 GLU A 573 ? ? 34.64 43.91 189 14 HIS A 576 ? ? -161.79 112.60 190 14 ASN A 581 ? ? -173.89 136.27 191 14 ASP A 593 ? ? -47.75 158.41 192 14 PRO A 594 ? ? -75.04 -89.68 193 14 CYS A 615 ? ? -126.43 -74.63 194 14 GLU A 617 ? ? -42.49 102.87 195 14 SER A 627 ? ? 87.30 40.07 196 14 PHE A 662 ? ? -49.97 159.99 197 15 ILE A 557 ? ? -33.08 -36.50 198 15 MET A 560 ? ? 78.55 47.07 199 15 ALA A 562 ? ? 85.27 100.52 200 15 HIS A 577 ? ? -49.64 157.70 201 15 ASN A 581 ? ? -179.78 131.58 202 15 PRO A 594 ? ? -74.96 -89.41 203 15 CYS A 615 ? ? -129.56 -74.04 204 15 SER A 627 ? ? 85.37 41.76 205 15 LYS A 629 ? ? -66.45 99.28 206 15 VAL A 655 ? ? -39.86 126.88 207 15 PHE A 662 ? ? -40.53 161.88 208 15 SER A 673 ? ? 86.02 5.13 209 15 SER A 676 ? ? -173.63 141.83 210 16 HIS A 544 ? ? -59.95 179.10 211 16 ILE A 557 ? ? -36.51 -32.36 212 16 ALA A 562 ? ? 82.66 108.09 213 16 ASN A 581 ? ? 173.14 130.89 214 16 ASP A 593 ? ? -45.91 158.26 215 16 LYS A 599 ? ? -173.88 -174.66 216 16 CYS A 615 ? ? -123.47 -76.15 217 16 GLU A 617 ? ? -42.70 102.59 218 16 VAL A 618 ? ? -55.66 109.31 219 16 SER A 627 ? ? 85.66 37.84 220 17 PHE A 547 ? ? -163.13 96.06 221 17 ILE A 557 ? ? -34.65 -34.21 222 17 MET A 560 ? ? 78.26 45.58 223 17 ALA A 562 ? ? 85.78 101.45 224 17 GLU A 573 ? ? 38.67 30.18 225 17 HIS A 576 ? ? -173.64 109.51 226 17 ASN A 581 ? ? 178.06 129.27 227 17 SER A 591 ? ? -54.68 174.04 228 17 PRO A 594 ? ? -74.97 -89.60 229 17 PRO A 606 ? ? -75.04 -169.47 230 17 CYS A 612 ? ? -59.12 108.06 231 17 CYS A 615 ? ? -117.83 -73.66 232 17 GLU A 617 ? ? -42.76 109.12 233 17 SER A 627 ? ? 85.58 39.30 234 17 LYS A 629 ? ? -68.42 99.46 235 17 LEU A 675 ? ? -87.98 -70.20 236 18 ILE A 557 ? ? -36.46 -31.89 237 18 ALA A 562 ? ? 65.80 113.43 238 18 GLU A 573 ? ? 38.97 39.68 239 18 HIS A 576 ? ? -163.53 106.68 240 18 ASN A 581 ? ? 179.42 128.39 241 18 PRO A 594 ? ? -75.02 -85.01 242 18 LYS A 602 ? ? -99.90 -61.38 243 18 CYS A 615 ? ? -121.69 -75.95 244 18 GLU A 617 ? ? -42.81 105.72 245 18 SER A 627 ? ? 85.43 43.29 246 19 ILE A 557 ? ? -37.03 -33.24 247 19 MET A 560 ? ? -61.66 72.57 248 19 ALA A 562 ? ? 81.85 107.46 249 19 ASN A 581 ? ? 173.58 130.43 250 19 PRO A 594 ? ? -74.95 -86.99 251 19 ILE A 597 ? ? -134.30 -44.70 252 19 LYS A 602 ? ? -92.27 36.75 253 19 ASP A 603 ? ? -138.49 -46.36 254 19 PRO A 606 ? ? -74.98 -162.41 255 19 CYS A 612 ? ? -59.15 109.19 256 19 CYS A 615 ? ? -132.60 -74.77 257 19 GLU A 617 ? ? -42.23 105.55 258 19 LYS A 626 ? ? 57.14 18.12 259 19 SER A 627 ? ? 85.12 37.60 260 19 ARG A 646 ? ? -39.06 156.14 261 19 SER A 676 ? ? -170.22 148.46 262 20 PHE A 547 ? ? -160.15 94.83 263 20 ILE A 557 ? ? -34.15 -35.15 264 20 MET A 560 ? ? 77.11 44.48 265 20 ALA A 562 ? ? 83.62 106.72 266 20 GLU A 573 ? ? 37.63 43.83 267 20 THR A 575 ? ? -133.75 -78.68 268 20 ASN A 581 ? ? 178.82 130.34 269 20 ARG A 592 ? ? -36.93 -81.20 270 20 ASP A 593 ? ? -39.77 150.57 271 20 PRO A 594 ? ? -74.98 -89.56 272 20 LYS A 602 ? ? -107.07 -61.39 273 20 CYS A 615 ? ? -118.62 -76.46 274 20 VAL A 618 ? ? -49.31 97.98 275 20 SER A 627 ? ? 85.60 39.69 276 20 LYS A 629 ? ? -68.84 99.62 277 20 ARG A 646 ? ? -49.71 150.97 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.conformers_calculated_total_number 20 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RQA _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RQA _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.contents '1mM [U-100% 13C; U-100% 15N] LGP2, 50mM TRIS-2, 250mM sodium chloride-3, 1mM DTT-4, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id LGP2 1 ? mM '[U-100% 13C; U-100% 15N]' 1 TRIS-2 50 ? mM ? 1 'sodium chloride-3' 250 ? mM ? 1 DTT-4 1 ? mM ? 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength 0.25 _pdbx_nmr_exptl_sample_conditions.pH 7 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '2D 1H-13C HSQC' 1 3 1 '3D CBCA(CO)NH' 1 4 1 '3D C(CO)NH' 1 5 1 '3D HNCO' 1 6 1 '3D HNCA' 1 7 1 '3D HNCACB' 1 8 1 '3D HBHA(CO)NH' 1 9 1 '3D HN(CO)CA' 1 10 1 '3D H(CCO)NH' 1 11 1 '3D HCCH-TOCSY' 1 12 1 '3D HNHA' 1 13 1 '3D 1H-15N NOESY' 1 14 1 '3D 1H-15N TOCSY' 1 15 1 '3D HN(COCA)CB' # _pdbx_nmr_refine.entry_id 2RQA _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.ordinal 'Guntert, Mumenthaler, Wuthrich' 'structure solution' CYANA ? 1 'Guntert, Mumenthaler, Wuthrich' refinement CYANA ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 800 Varian INOVA 1 'Varian INOVA' 600 Varian INOVA 2 'Varian INOVA' # _atom_sites.entry_id 2RQA _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_