data_2RSD
# 
_entry.id   2RSD 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.392 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2RSD         pdb_00002rsd 10.2210/pdb2rsd/pdb 
RCSB  RCSB150226   ?            ?                   
BMRB  11469        ?            10.13018/BMR11469   
WWPDB D_1000150226 ?            ?                   
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2012-08-15 
2 'Structure model' 1 1 2023-06-14 
3 'Structure model' 1 2 2024-05-15 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
4 2 'Structure model' Other                  
5 3 'Structure model' 'Data collection'      
6 3 'Structure model' 'Database references'  
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' database_2             
2  2 'Structure model' pdbx_database_status   
3  2 'Structure model' pdbx_nmr_software      
4  2 'Structure model' pdbx_struct_conn_angle 
5  2 'Structure model' struct_conn            
6  2 'Structure model' struct_ref_seq_dif     
7  2 'Structure model' struct_site            
8  3 'Structure model' chem_comp_atom         
9  3 'Structure model' chem_comp_bond         
10 3 'Structure model' database_2             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_database_2.pdbx_DOI'                        
2  2 'Structure model' '_database_2.pdbx_database_accession'         
3  2 'Structure model' '_pdbx_database_status.status_code_nmr_data'  
4  2 'Structure model' '_pdbx_nmr_software.name'                     
5  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
6  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
7  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
8  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
9  2 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
10 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
11 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
12 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
13 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
14 2 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
15 2 'Structure model' '_pdbx_struct_conn_angle.value'               
16 2 'Structure model' '_struct_conn.pdbx_dist_value'                
17 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
18 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
19 2 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
20 2 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
21 2 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
22 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
23 2 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
24 2 'Structure model' '_struct_ref_seq_dif.details'                 
25 2 'Structure model' '_struct_site.pdbx_auth_asym_id'              
26 2 'Structure model' '_struct_site.pdbx_auth_comp_id'              
27 2 'Structure model' '_struct_site.pdbx_auth_seq_id'               
28 3 'Structure model' '_database_2.pdbx_DOI'                        
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2RSD 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2012-01-12 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            REL 
# 
_pdbx_database_related.db_id          11469 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shindo, H.'   1 
'Tsuchiya, W.' 2 
'Suzuki, R.'   3 
'Yamazaki, T.' 4 
# 
_citation.id                        primary 
_citation.title                     
'PHD finger of the SUMO ligase Siz/PIAS family in rice reveals specific binding for methylated histone H3 at lysine 4 and arginine 2' 
_citation.journal_abbrev            'Febs Lett.' 
_citation.journal_volume            586 
_citation.page_first                1783 
_citation.page_last                 1789 
_citation.year                      2012 
_citation.journal_id_ASTM           FEBLAL 
_citation.country                   NE 
_citation.journal_id_ISSN           0014-5793 
_citation.journal_id_CSD            0165 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22626555 
_citation.pdbx_database_id_DOI      10.1016/j.febslet.2012.04.063 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shindo, H.'    1 ? 
primary 'Suzuki, R.'    2 ? 
primary 'Tsuchiya, W.'  3 ? 
primary 'Taichi, M.'    4 ? 
primary 'Nishiuchi, Y.' 5 ? 
primary 'Yamazaki, T.'  6 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'E3 SUMO-protein ligase SIZ1' 7671.724 1 6.3.2.- ? 'Plant homeodomain, UNP residues 107-172' ? 
2 non-polymer syn 'ZINC ION'                    65.409   2 ?       ? ?                                         ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       GSDSFQPEAKVRCICSSTMVNDSMIQCEDQRCQVWQHLNCVLIPDKPGESAEVPPVFYCELCRLSRAD 
_entity_poly.pdbx_seq_one_letter_code_can   GSDSFQPEAKVRCICSSTMVNDSMIQCEDQRCQVWQHLNCVLIPDKPGESAEVPPVFYCELCRLSRAD 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        'ZINC ION' 
_pdbx_entity_nonpoly.comp_id     ZN 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  ASP n 
1 4  SER n 
1 5  PHE n 
1 6  GLN n 
1 7  PRO n 
1 8  GLU n 
1 9  ALA n 
1 10 LYS n 
1 11 VAL n 
1 12 ARG n 
1 13 CYS n 
1 14 ILE n 
1 15 CYS n 
1 16 SER n 
1 17 SER n 
1 18 THR n 
1 19 MET n 
1 20 VAL n 
1 21 ASN n 
1 22 ASP n 
1 23 SER n 
1 24 MET n 
1 25 ILE n 
1 26 GLN n 
1 27 CYS n 
1 28 GLU n 
1 29 ASP n 
1 30 GLN n 
1 31 ARG n 
1 32 CYS n 
1 33 GLN n 
1 34 VAL n 
1 35 TRP n 
1 36 GLN n 
1 37 HIS n 
1 38 LEU n 
1 39 ASN n 
1 40 CYS n 
1 41 VAL n 
1 42 LEU n 
1 43 ILE n 
1 44 PRO n 
1 45 ASP n 
1 46 LYS n 
1 47 PRO n 
1 48 GLY n 
1 49 GLU n 
1 50 SER n 
1 51 ALA n 
1 52 GLU n 
1 53 VAL n 
1 54 PRO n 
1 55 PRO n 
1 56 VAL n 
1 57 PHE n 
1 58 TYR n 
1 59 CYS n 
1 60 GLU n 
1 61 LEU n 
1 62 CYS n 
1 63 ARG n 
1 64 LEU n 
1 65 SER n 
1 66 ARG n 
1 67 ALA n 
1 68 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Japanese rice' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SIZ1, Os05g0125000, LOC_Os05g03430, OSJNBb0079L11.3' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Oryza sativa Japonica Group' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     39947 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pGEX-4T-3 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  105 105 GLY GLY A . n 
A 1 2  SER 2  106 106 SER SER A . n 
A 1 3  ASP 3  107 107 ASP ASP A . n 
A 1 4  SER 4  108 108 SER SER A . n 
A 1 5  PHE 5  109 109 PHE PHE A . n 
A 1 6  GLN 6  110 110 GLN GLN A . n 
A 1 7  PRO 7  111 111 PRO PRO A . n 
A 1 8  GLU 8  112 112 GLU GLU A . n 
A 1 9  ALA 9  113 113 ALA ALA A . n 
A 1 10 LYS 10 114 114 LYS LYS A . n 
A 1 11 VAL 11 115 115 VAL VAL A . n 
A 1 12 ARG 12 116 116 ARG ARG A . n 
A 1 13 CYS 13 117 117 CYS CYS A . n 
A 1 14 ILE 14 118 118 ILE ILE A . n 
A 1 15 CYS 15 119 119 CYS CYS A . n 
A 1 16 SER 16 120 120 SER SER A . n 
A 1 17 SER 17 121 121 SER SER A . n 
A 1 18 THR 18 122 122 THR THR A . n 
A 1 19 MET 19 123 123 MET MET A . n 
A 1 20 VAL 20 124 124 VAL VAL A . n 
A 1 21 ASN 21 125 125 ASN ASN A . n 
A 1 22 ASP 22 126 126 ASP ASP A . n 
A 1 23 SER 23 127 127 SER SER A . n 
A 1 24 MET 24 128 128 MET MET A . n 
A 1 25 ILE 25 129 129 ILE ILE A . n 
A 1 26 GLN 26 130 130 GLN GLN A . n 
A 1 27 CYS 27 131 131 CYS CYS A . n 
A 1 28 GLU 28 132 132 GLU GLU A . n 
A 1 29 ASP 29 133 133 ASP ASP A . n 
A 1 30 GLN 30 134 134 GLN GLN A . n 
A 1 31 ARG 31 135 135 ARG ARG A . n 
A 1 32 CYS 32 136 136 CYS CYS A . n 
A 1 33 GLN 33 137 137 GLN GLN A . n 
A 1 34 VAL 34 138 138 VAL VAL A . n 
A 1 35 TRP 35 139 139 TRP TRP A . n 
A 1 36 GLN 36 140 140 GLN GLN A . n 
A 1 37 HIS 37 141 141 HIS HIS A . n 
A 1 38 LEU 38 142 142 LEU LEU A . n 
A 1 39 ASN 39 143 143 ASN ASN A . n 
A 1 40 CYS 40 144 144 CYS CYS A . n 
A 1 41 VAL 41 145 145 VAL VAL A . n 
A 1 42 LEU 42 146 146 LEU LEU A . n 
A 1 43 ILE 43 147 147 ILE ILE A . n 
A 1 44 PRO 44 148 148 PRO PRO A . n 
A 1 45 ASP 45 149 149 ASP ASP A . n 
A 1 46 LYS 46 150 150 LYS LYS A . n 
A 1 47 PRO 47 151 151 PRO PRO A . n 
A 1 48 GLY 48 152 152 GLY GLY A . n 
A 1 49 GLU 49 153 153 GLU GLU A . n 
A 1 50 SER 50 154 154 SER SER A . n 
A 1 51 ALA 51 155 155 ALA ALA A . n 
A 1 52 GLU 52 156 156 GLU GLU A . n 
A 1 53 VAL 53 157 157 VAL VAL A . n 
A 1 54 PRO 54 158 158 PRO PRO A . n 
A 1 55 PRO 55 159 159 PRO PRO A . n 
A 1 56 VAL 56 160 160 VAL VAL A . n 
A 1 57 PHE 57 161 161 PHE PHE A . n 
A 1 58 TYR 58 162 162 TYR TYR A . n 
A 1 59 CYS 59 163 163 CYS CYS A . n 
A 1 60 GLU 60 164 164 GLU GLU A . n 
A 1 61 LEU 61 165 165 LEU LEU A . n 
A 1 62 CYS 62 166 166 CYS CYS A . n 
A 1 63 ARG 63 167 167 ARG ARG A . n 
A 1 64 LEU 64 168 168 LEU LEU A . n 
A 1 65 SER 65 169 169 SER SER A . n 
A 1 66 ARG 66 170 170 ARG ARG A . n 
A 1 67 ALA 67 171 171 ALA ALA A . n 
A 1 68 ASP 68 172 172 ASP ASP A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN 1 901 901 ZN ZN A . 
C 2 ZN 1 902 902 ZN ZN A . 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2RSD 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2RSD 
_struct.title                     'Solution structure of the plant homeodomain (PHD) of the E3 SUMO ligase Siz1 from rice' 
_struct.pdbx_model_details        'closest to the average, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2RSD 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'E3 SUMO ligase, plant homeodomain (PHD), histone binding, LIGASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SIZ1_ORYSJ 
_struct_ref.pdbx_db_accession          Q6L4L4 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   DSFQPEAKVRCICSSTMVNDSMIQCEDQRCQVWQHLNCVLIPDKPGESAEVPPVFYCELCRLSRAD 
_struct_ref.pdbx_align_begin           107 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2RSD 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 68 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q6L4L4 
_struct_ref_seq.db_align_beg                  107 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  172 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       107 
_struct_ref_seq.pdbx_auth_seq_align_end       172 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2RSD GLY A 1 ? UNP Q6L4L4 ? ? 'expression tag' 105 1 
1 2RSD SER A 2 ? UNP Q6L4L4 ? ? 'expression tag' 106 2 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       1 
_struct_conf.beg_label_comp_id       CYS 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        59 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       ALA 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        67 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        CYS 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         163 
_struct_conf.end_auth_comp_id        ALA 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         171 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A CYS 13 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 117 A ZN 901 1_555 ? ? ? ? ? ? ? 2.416 ? ? 
metalc2 metalc ? ? A CYS 15 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 119 A ZN 901 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc3 metalc ? ? A CYS 27 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 131 A ZN 902 1_555 ? ? ? ? ? ? ? 2.419 ? ? 
metalc4 metalc ? ? A CYS 32 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 136 A ZN 902 1_555 ? ? ? ? ? ? ? 2.542 ? ? 
metalc5 metalc ? ? A HIS 37 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 141 A ZN 901 1_555 ? ? ? ? ? ? ? 2.071 ? ? 
metalc6 metalc ? ? A CYS 40 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 144 A ZN 901 1_555 ? ? ? ? ? ? ? 2.414 ? ? 
metalc7 metalc ? ? A CYS 59 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 163 A ZN 902 1_555 ? ? ? ? ? ? ? 2.452 ? ? 
metalc8 metalc ? ? A CYS 62 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 166 A ZN 902 1_555 ? ? ? ? ? ? ? 2.412 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 13 ? A CYS 117 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 SG  ? A CYS 15 ? A CYS 119 ? 1_555 101.0 ? 
2  SG  ? A CYS 13 ? A CYS 117 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 ND1 ? A HIS 37 ? A HIS 141 ? 1_555 112.1 ? 
3  SG  ? A CYS 15 ? A CYS 119 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 ND1 ? A HIS 37 ? A HIS 141 ? 1_555 96.7  ? 
4  SG  ? A CYS 13 ? A CYS 117 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 SG  ? A CYS 40 ? A CYS 144 ? 1_555 98.0  ? 
5  SG  ? A CYS 15 ? A CYS 119 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 SG  ? A CYS 40 ? A CYS 144 ? 1_555 130.7 ? 
6  ND1 ? A HIS 37 ? A HIS 141 ? 1_555 ZN ? B ZN . ? A ZN 901 ? 1_555 SG  ? A CYS 40 ? A CYS 144 ? 1_555 117.2 ? 
7  SG  ? A CYS 27 ? A CYS 131 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 SG  ? A CYS 32 ? A CYS 136 ? 1_555 126.3 ? 
8  SG  ? A CYS 27 ? A CYS 131 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 SG  ? A CYS 59 ? A CYS 163 ? 1_555 131.6 ? 
9  SG  ? A CYS 32 ? A CYS 136 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 SG  ? A CYS 59 ? A CYS 163 ? 1_555 90.0  ? 
10 SG  ? A CYS 27 ? A CYS 131 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 SG  ? A CYS 62 ? A CYS 166 ? 1_555 95.5  ? 
11 SG  ? A CYS 32 ? A CYS 136 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 SG  ? A CYS 62 ? A CYS 166 ? 1_555 93.8  ? 
12 SG  ? A CYS 59 ? A CYS 163 ? 1_555 ZN ? C ZN . ? A ZN 902 ? 1_555 SG  ? A CYS 62 ? A CYS 166 ? 1_555 114.6 ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 10 ? VAL A 11 ? LYS A 114 VAL A 115 
A 2 VAL A 34 ? HIS A 37 ? VAL A 138 HIS A 141 
A 3 MET A 24 ? GLN A 26 ? MET A 128 GLN A 130 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LYS A 10 ? N LYS A 114 O TRP A 35 ? O TRP A 139 
A 2 3 O GLN A 36 ? O GLN A 140 N ILE A 25 ? N ILE A 129 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 901 ? 4 'BINDING SITE FOR RESIDUE ZN A 901' 
AC2 Software A ZN 902 ? 5 'BINDING SITE FOR RESIDUE ZN A 902' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 13 ? CYS A 117 . ? 1_555 ? 
2 AC1 4 CYS A 15 ? CYS A 119 . ? 1_555 ? 
3 AC1 4 HIS A 37 ? HIS A 141 . ? 1_555 ? 
4 AC1 4 CYS A 40 ? CYS A 144 . ? 1_555 ? 
5 AC2 5 CYS A 27 ? CYS A 131 . ? 1_555 ? 
6 AC2 5 CYS A 32 ? CYS A 136 . ? 1_555 ? 
7 AC2 5 VAL A 34 ? VAL A 138 . ? 1_555 ? 
8 AC2 5 CYS A 59 ? CYS A 163 . ? 1_555 ? 
9 AC2 5 CYS A 62 ? CYS A 166 . ? 1_555 ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1  SER A 106 ? ? -160.33 -57.37  
2   1  THR A 122 ? ? -94.23  31.39   
3   1  ASN A 125 ? ? -70.48  -169.25 
4   1  CYS A 136 ? ? -123.09 -59.66  
5   1  CYS A 163 ? ? -56.07  -178.69 
6   2  SER A 106 ? ? 72.10   -69.28  
7   2  ASP A 107 ? ? -96.50  32.27   
8   2  PHE A 109 ? ? -69.52  92.22   
9   2  THR A 122 ? ? -94.49  31.18   
10  2  ASN A 125 ? ? -69.03  -169.02 
11  2  CYS A 136 ? ? -130.92 -60.83  
12  2  CYS A 163 ? ? -57.57  -175.89 
13  3  THR A 122 ? ? -94.29  31.41   
14  3  ASN A 125 ? ? -59.86  -169.97 
15  3  CYS A 136 ? ? -128.88 -61.30  
16  3  CYS A 163 ? ? -57.59  -176.07 
17  4  SER A 106 ? ? -173.07 -42.66  
18  4  SER A 108 ? ? -178.13 -35.62  
19  4  PHE A 109 ? ? -67.63  92.23   
20  4  THR A 122 ? ? -94.36  31.88   
21  4  ASN A 125 ? ? -60.14  -169.63 
22  4  CYS A 136 ? ? -125.84 -58.54  
23  4  CYS A 163 ? ? -57.21  -176.37 
24  5  SER A 106 ? ? -95.58  51.99   
25  5  THR A 122 ? ? -93.99  31.33   
26  5  ASN A 125 ? ? -69.46  -169.10 
27  5  CYS A 136 ? ? -127.75 -59.92  
28  5  GLU A 153 ? ? -75.68  -169.82 
29  5  CYS A 163 ? ? -57.63  -175.42 
30  6  SER A 108 ? ? -166.43 47.08   
31  6  THR A 122 ? ? -94.54  31.22   
32  6  ASN A 125 ? ? -70.06  -168.43 
33  6  CYS A 136 ? ? -124.49 -59.14  
34  6  GLU A 153 ? ? -69.19  -169.86 
35  6  ALA A 155 ? ? -48.64  165.27  
36  6  CYS A 163 ? ? -56.99  -177.28 
37  7  SER A 106 ? ? 72.13   -69.26  
38  7  SER A 108 ? ? -152.29 46.80   
39  7  VAL A 124 ? ? -65.37  89.94   
40  7  ASN A 125 ? ? -60.59  -168.72 
41  7  CYS A 136 ? ? -128.12 -60.05  
42  7  CYS A 163 ? ? -57.45  -175.82 
43  8  SER A 106 ? ? -169.70 39.46   
44  8  THR A 122 ? ? -94.55  31.97   
45  8  ASN A 125 ? ? -60.08  -169.74 
46  8  CYS A 136 ? ? -125.53 -58.74  
47  8  GLU A 153 ? ? -76.04  -169.69 
48  8  CYS A 163 ? ? -57.64  -175.30 
49  9  SER A 106 ? ? 52.78   70.63   
50  9  THR A 122 ? ? -94.03  31.11   
51  9  ASN A 125 ? ? -68.83  -169.21 
52  9  CYS A 136 ? ? -127.06 -59.98  
53  9  CYS A 163 ? ? -57.81  -175.54 
54  10 PHE A 109 ? ? -68.75  92.24   
55  10 ASN A 125 ? ? -61.34  -166.82 
56  10 CYS A 136 ? ? -126.19 -59.20  
57  10 GLU A 153 ? ? -69.12  -177.78 
58  10 CYS A 163 ? ? -58.16  -174.31 
59  10 ALA A 171 ? ? -178.11 -66.46  
60  11 SER A 108 ? ? -177.20 84.49   
61  11 THR A 122 ? ? -94.39  31.39   
62  11 ASN A 125 ? ? -60.12  -169.44 
63  11 CYS A 136 ? ? -124.52 -59.10  
64  11 ALA A 155 ? ? -48.33  161.80  
65  11 CYS A 163 ? ? -57.02  -176.87 
66  12 THR A 122 ? ? -93.95  31.05   
67  12 ASN A 125 ? ? -69.19  -169.00 
68  12 CYS A 136 ? ? -129.70 -59.75  
69  12 CYS A 163 ? ? -48.55  160.68  
70  13 MET A 123 ? ? -57.61  -177.25 
71  13 ASN A 125 ? ? -61.53  -166.42 
72  13 CYS A 136 ? ? -124.33 -59.57  
73  13 CYS A 163 ? ? -56.57  -177.72 
74  14 SER A 106 ? ? -94.87  53.87   
75  14 SER A 108 ? ? -175.14 84.88   
76  14 THR A 122 ? ? -93.83  30.94   
77  14 ASN A 125 ? ? -68.07  -168.95 
78  14 CYS A 136 ? ? -126.21 -59.54  
79  14 CYS A 163 ? ? -57.14  -176.79 
80  15 SER A 106 ? ? 61.10   82.72   
81  15 SER A 108 ? ? -147.45 25.24   
82  15 THR A 122 ? ? -94.28  31.31   
83  15 ASN A 125 ? ? -69.19  -169.20 
84  15 CYS A 136 ? ? -121.86 -59.96  
85  15 CYS A 163 ? ? -55.36  -179.92 
86  15 ALA A 171 ? ? -178.20 -67.25  
87  16 ASP A 107 ? ? -120.93 -54.96  
88  16 THR A 122 ? ? -94.05  30.75   
89  16 ASN A 125 ? ? -69.13  -164.41 
90  16 CYS A 136 ? ? -127.20 -60.02  
91  16 CYS A 163 ? ? -57.78  -175.38 
92  17 THR A 122 ? ? -94.09  31.15   
93  17 ASN A 125 ? ? -68.37  -169.22 
94  17 CYS A 136 ? ? -134.41 -62.23  
95  17 CYS A 163 ? ? -47.69  157.80  
96  18 SER A 108 ? ? -158.49 24.61   
97  18 ALA A 113 ? ? -150.43 80.70   
98  18 THR A 122 ? ? -93.51  31.06   
99  18 ASN A 125 ? ? -67.55  -168.58 
100 18 CYS A 136 ? ? -125.58 -59.50  
101 18 CYS A 163 ? ? -58.04  -174.88 
102 18 ALA A 171 ? ? -174.73 -68.68  
103 19 THR A 122 ? ? -94.25  30.98   
104 19 ASN A 125 ? ? -69.66  -168.45 
105 19 CYS A 136 ? ? -124.25 -61.18  
106 19 CYS A 163 ? ? -57.47  -175.51 
107 19 ALA A 171 ? ? -179.05 55.47   
108 20 SER A 108 ? ? -171.73 84.57   
109 20 THR A 122 ? ? -94.04  31.20   
110 20 ASN A 125 ? ? -69.42  -169.05 
111 20 CYS A 136 ? ? -131.13 -61.04  
112 20 CYS A 163 ? ? -47.76  157.14  
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2RSD 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2RSD 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.5-1.0 mM [U-13C; U-15N] OsSiz1-PHD-1, 1.0-2.0 mM ZINC ION-2, 100 mM sodium chloride-3, 10 mM potassium phosphate-4, 5 mM DTT-5, 100% D2O
;
1 '100% D2O'       
;0.5-1.0 mM [U-13C; U-15N] OsSiz1-PHD-6, 1.0-2.0 mM ZINC ION-7, 100 mM sodium chloride-8, 10 mM potassium phosphate-9, 5 mM DTT-10, 92% H2O/8% D2O
;
2 '92% H2O/8% D2O' 
# 
loop_
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
_pdbx_nmr_exptl_sample.solution_id 
OsSiz1-PHD-1            ?   0.5-1.0 mM '[U-13C; U-15N]' 1 
'ZINC ION-2'            ?   1.0-2.0 mM ?                1 
'sodium chloride-3'     100 ?       mM ?                1 
'potassium phosphate-4' 10  ?       mM ?                1 
DTT-5                   5   ?       mM ?                1 
OsSiz1-PHD-6            ?   0.5-1.0 mM '[U-13C; U-15N]' 2 
'ZINC ION-7'            ?   1.0-2.0 mM ?                2 
'sodium chloride-8'     100 ?       mM ?                2 
'potassium phosphate-9' 10  ?       mM ?                2 
DTT-10                  5   ?       mM ?                2 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  2 '2D 1H-15N HSQC'                  
1 2  1 '2D 1H-13C HSQC'                  
1 3  2 '3D CBCA(CO)NH'                   
1 4  2 '3D HNCO'                         
1 5  2 '3D HNCA'                         
1 6  1 '3D HCABGCO'                      
1 7  1 '3D HCCH-COSY'                    
1 8  2 '3D 15N-separated NOESY-HSQC'     
1 9  2 '3D 13C/15N-separated NOESY-HSQC' 
1 10 1 '4D 13C/13C-separated NOESY-HSQC' 
# 
_pdbx_nmr_refine.entry_id           2RSD 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Bruker Biospin'                                    collection                  XwinNMR     1 3.1                        
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe     2 'released at Feb 10, 2006' 
Goddard                                             'peak picking'              Sparky      3 3.113                      
Goddard                                             'chemical shift assignment' Sparky      4 3.113                      
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA       5 2.1                        
'Guntert, Mumenthaler and Wuthrich'                 refinement                  CYANA       6 2.1                        
'Shen, Delaglio, Cornilescu and Bax'                'data analysis'             TALOS+      7 1.01F                      
'Rullmann, Doreleijers and Kaptein'                 'data analysis'             AQUA        8 3.2                        
'Laskowski and MacArthur'                           'data analysis'             ProcheckNMR 9 3.5.4                      
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
ALA N    N  N N 1   
ALA CA   C  N S 2   
ALA C    C  N N 3   
ALA O    O  N N 4   
ALA CB   C  N N 5   
ALA OXT  O  N N 6   
ALA H    H  N N 7   
ALA H2   H  N N 8   
ALA HA   H  N N 9   
ALA HB1  H  N N 10  
ALA HB2  H  N N 11  
ALA HB3  H  N N 12  
ALA HXT  H  N N 13  
ARG N    N  N N 14  
ARG CA   C  N S 15  
ARG C    C  N N 16  
ARG O    O  N N 17  
ARG CB   C  N N 18  
ARG CG   C  N N 19  
ARG CD   C  N N 20  
ARG NE   N  N N 21  
ARG CZ   C  N N 22  
ARG NH1  N  N N 23  
ARG NH2  N  N N 24  
ARG OXT  O  N N 25  
ARG H    H  N N 26  
ARG H2   H  N N 27  
ARG HA   H  N N 28  
ARG HB2  H  N N 29  
ARG HB3  H  N N 30  
ARG HG2  H  N N 31  
ARG HG3  H  N N 32  
ARG HD2  H  N N 33  
ARG HD3  H  N N 34  
ARG HE   H  N N 35  
ARG HH11 H  N N 36  
ARG HH12 H  N N 37  
ARG HH21 H  N N 38  
ARG HH22 H  N N 39  
ARG HXT  H  N N 40  
ASN N    N  N N 41  
ASN CA   C  N S 42  
ASN C    C  N N 43  
ASN O    O  N N 44  
ASN CB   C  N N 45  
ASN CG   C  N N 46  
ASN OD1  O  N N 47  
ASN ND2  N  N N 48  
ASN OXT  O  N N 49  
ASN H    H  N N 50  
ASN H2   H  N N 51  
ASN HA   H  N N 52  
ASN HB2  H  N N 53  
ASN HB3  H  N N 54  
ASN HD21 H  N N 55  
ASN HD22 H  N N 56  
ASN HXT  H  N N 57  
ASP N    N  N N 58  
ASP CA   C  N S 59  
ASP C    C  N N 60  
ASP O    O  N N 61  
ASP CB   C  N N 62  
ASP CG   C  N N 63  
ASP OD1  O  N N 64  
ASP OD2  O  N N 65  
ASP OXT  O  N N 66  
ASP H    H  N N 67  
ASP H2   H  N N 68  
ASP HA   H  N N 69  
ASP HB2  H  N N 70  
ASP HB3  H  N N 71  
ASP HD2  H  N N 72  
ASP HXT  H  N N 73  
CYS N    N  N N 74  
CYS CA   C  N R 75  
CYS C    C  N N 76  
CYS O    O  N N 77  
CYS CB   C  N N 78  
CYS SG   S  N N 79  
CYS OXT  O  N N 80  
CYS H    H  N N 81  
CYS H2   H  N N 82  
CYS HA   H  N N 83  
CYS HB2  H  N N 84  
CYS HB3  H  N N 85  
CYS HG   H  N N 86  
CYS HXT  H  N N 87  
GLN N    N  N N 88  
GLN CA   C  N S 89  
GLN C    C  N N 90  
GLN O    O  N N 91  
GLN CB   C  N N 92  
GLN CG   C  N N 93  
GLN CD   C  N N 94  
GLN OE1  O  N N 95  
GLN NE2  N  N N 96  
GLN OXT  O  N N 97  
GLN H    H  N N 98  
GLN H2   H  N N 99  
GLN HA   H  N N 100 
GLN HB2  H  N N 101 
GLN HB3  H  N N 102 
GLN HG2  H  N N 103 
GLN HG3  H  N N 104 
GLN HE21 H  N N 105 
GLN HE22 H  N N 106 
GLN HXT  H  N N 107 
GLU N    N  N N 108 
GLU CA   C  N S 109 
GLU C    C  N N 110 
GLU O    O  N N 111 
GLU CB   C  N N 112 
GLU CG   C  N N 113 
GLU CD   C  N N 114 
GLU OE1  O  N N 115 
GLU OE2  O  N N 116 
GLU OXT  O  N N 117 
GLU H    H  N N 118 
GLU H2   H  N N 119 
GLU HA   H  N N 120 
GLU HB2  H  N N 121 
GLU HB3  H  N N 122 
GLU HG2  H  N N 123 
GLU HG3  H  N N 124 
GLU HE2  H  N N 125 
GLU HXT  H  N N 126 
GLY N    N  N N 127 
GLY CA   C  N N 128 
GLY C    C  N N 129 
GLY O    O  N N 130 
GLY OXT  O  N N 131 
GLY H    H  N N 132 
GLY H2   H  N N 133 
GLY HA2  H  N N 134 
GLY HA3  H  N N 135 
GLY HXT  H  N N 136 
HIS N    N  N N 137 
HIS CA   C  N S 138 
HIS C    C  N N 139 
HIS O    O  N N 140 
HIS CB   C  N N 141 
HIS CG   C  Y N 142 
HIS ND1  N  Y N 143 
HIS CD2  C  Y N 144 
HIS CE1  C  Y N 145 
HIS NE2  N  Y N 146 
HIS OXT  O  N N 147 
HIS H    H  N N 148 
HIS H2   H  N N 149 
HIS HA   H  N N 150 
HIS HB2  H  N N 151 
HIS HB3  H  N N 152 
HIS HD1  H  N N 153 
HIS HD2  H  N N 154 
HIS HE1  H  N N 155 
HIS HE2  H  N N 156 
HIS HXT  H  N N 157 
ILE N    N  N N 158 
ILE CA   C  N S 159 
ILE C    C  N N 160 
ILE O    O  N N 161 
ILE CB   C  N S 162 
ILE CG1  C  N N 163 
ILE CG2  C  N N 164 
ILE CD1  C  N N 165 
ILE OXT  O  N N 166 
ILE H    H  N N 167 
ILE H2   H  N N 168 
ILE HA   H  N N 169 
ILE HB   H  N N 170 
ILE HG12 H  N N 171 
ILE HG13 H  N N 172 
ILE HG21 H  N N 173 
ILE HG22 H  N N 174 
ILE HG23 H  N N 175 
ILE HD11 H  N N 176 
ILE HD12 H  N N 177 
ILE HD13 H  N N 178 
ILE HXT  H  N N 179 
LEU N    N  N N 180 
LEU CA   C  N S 181 
LEU C    C  N N 182 
LEU O    O  N N 183 
LEU CB   C  N N 184 
LEU CG   C  N N 185 
LEU CD1  C  N N 186 
LEU CD2  C  N N 187 
LEU OXT  O  N N 188 
LEU H    H  N N 189 
LEU H2   H  N N 190 
LEU HA   H  N N 191 
LEU HB2  H  N N 192 
LEU HB3  H  N N 193 
LEU HG   H  N N 194 
LEU HD11 H  N N 195 
LEU HD12 H  N N 196 
LEU HD13 H  N N 197 
LEU HD21 H  N N 198 
LEU HD22 H  N N 199 
LEU HD23 H  N N 200 
LEU HXT  H  N N 201 
LYS N    N  N N 202 
LYS CA   C  N S 203 
LYS C    C  N N 204 
LYS O    O  N N 205 
LYS CB   C  N N 206 
LYS CG   C  N N 207 
LYS CD   C  N N 208 
LYS CE   C  N N 209 
LYS NZ   N  N N 210 
LYS OXT  O  N N 211 
LYS H    H  N N 212 
LYS H2   H  N N 213 
LYS HA   H  N N 214 
LYS HB2  H  N N 215 
LYS HB3  H  N N 216 
LYS HG2  H  N N 217 
LYS HG3  H  N N 218 
LYS HD2  H  N N 219 
LYS HD3  H  N N 220 
LYS HE2  H  N N 221 
LYS HE3  H  N N 222 
LYS HZ1  H  N N 223 
LYS HZ2  H  N N 224 
LYS HZ3  H  N N 225 
LYS HXT  H  N N 226 
MET N    N  N N 227 
MET CA   C  N S 228 
MET C    C  N N 229 
MET O    O  N N 230 
MET CB   C  N N 231 
MET CG   C  N N 232 
MET SD   S  N N 233 
MET CE   C  N N 234 
MET OXT  O  N N 235 
MET H    H  N N 236 
MET H2   H  N N 237 
MET HA   H  N N 238 
MET HB2  H  N N 239 
MET HB3  H  N N 240 
MET HG2  H  N N 241 
MET HG3  H  N N 242 
MET HE1  H  N N 243 
MET HE2  H  N N 244 
MET HE3  H  N N 245 
MET HXT  H  N N 246 
PHE N    N  N N 247 
PHE CA   C  N S 248 
PHE C    C  N N 249 
PHE O    O  N N 250 
PHE CB   C  N N 251 
PHE CG   C  Y N 252 
PHE CD1  C  Y N 253 
PHE CD2  C  Y N 254 
PHE CE1  C  Y N 255 
PHE CE2  C  Y N 256 
PHE CZ   C  Y N 257 
PHE OXT  O  N N 258 
PHE H    H  N N 259 
PHE H2   H  N N 260 
PHE HA   H  N N 261 
PHE HB2  H  N N 262 
PHE HB3  H  N N 263 
PHE HD1  H  N N 264 
PHE HD2  H  N N 265 
PHE HE1  H  N N 266 
PHE HE2  H  N N 267 
PHE HZ   H  N N 268 
PHE HXT  H  N N 269 
PRO N    N  N N 270 
PRO CA   C  N S 271 
PRO C    C  N N 272 
PRO O    O  N N 273 
PRO CB   C  N N 274 
PRO CG   C  N N 275 
PRO CD   C  N N 276 
PRO OXT  O  N N 277 
PRO H    H  N N 278 
PRO HA   H  N N 279 
PRO HB2  H  N N 280 
PRO HB3  H  N N 281 
PRO HG2  H  N N 282 
PRO HG3  H  N N 283 
PRO HD2  H  N N 284 
PRO HD3  H  N N 285 
PRO HXT  H  N N 286 
SER N    N  N N 287 
SER CA   C  N S 288 
SER C    C  N N 289 
SER O    O  N N 290 
SER CB   C  N N 291 
SER OG   O  N N 292 
SER OXT  O  N N 293 
SER H    H  N N 294 
SER H2   H  N N 295 
SER HA   H  N N 296 
SER HB2  H  N N 297 
SER HB3  H  N N 298 
SER HG   H  N N 299 
SER HXT  H  N N 300 
THR N    N  N N 301 
THR CA   C  N S 302 
THR C    C  N N 303 
THR O    O  N N 304 
THR CB   C  N R 305 
THR OG1  O  N N 306 
THR CG2  C  N N 307 
THR OXT  O  N N 308 
THR H    H  N N 309 
THR H2   H  N N 310 
THR HA   H  N N 311 
THR HB   H  N N 312 
THR HG1  H  N N 313 
THR HG21 H  N N 314 
THR HG22 H  N N 315 
THR HG23 H  N N 316 
THR HXT  H  N N 317 
TRP N    N  N N 318 
TRP CA   C  N S 319 
TRP C    C  N N 320 
TRP O    O  N N 321 
TRP CB   C  N N 322 
TRP CG   C  Y N 323 
TRP CD1  C  Y N 324 
TRP CD2  C  Y N 325 
TRP NE1  N  Y N 326 
TRP CE2  C  Y N 327 
TRP CE3  C  Y N 328 
TRP CZ2  C  Y N 329 
TRP CZ3  C  Y N 330 
TRP CH2  C  Y N 331 
TRP OXT  O  N N 332 
TRP H    H  N N 333 
TRP H2   H  N N 334 
TRP HA   H  N N 335 
TRP HB2  H  N N 336 
TRP HB3  H  N N 337 
TRP HD1  H  N N 338 
TRP HE1  H  N N 339 
TRP HE3  H  N N 340 
TRP HZ2  H  N N 341 
TRP HZ3  H  N N 342 
TRP HH2  H  N N 343 
TRP HXT  H  N N 344 
TYR N    N  N N 345 
TYR CA   C  N S 346 
TYR C    C  N N 347 
TYR O    O  N N 348 
TYR CB   C  N N 349 
TYR CG   C  Y N 350 
TYR CD1  C  Y N 351 
TYR CD2  C  Y N 352 
TYR CE1  C  Y N 353 
TYR CE2  C  Y N 354 
TYR CZ   C  Y N 355 
TYR OH   O  N N 356 
TYR OXT  O  N N 357 
TYR H    H  N N 358 
TYR H2   H  N N 359 
TYR HA   H  N N 360 
TYR HB2  H  N N 361 
TYR HB3  H  N N 362 
TYR HD1  H  N N 363 
TYR HD2  H  N N 364 
TYR HE1  H  N N 365 
TYR HE2  H  N N 366 
TYR HH   H  N N 367 
TYR HXT  H  N N 368 
VAL N    N  N N 369 
VAL CA   C  N S 370 
VAL C    C  N N 371 
VAL O    O  N N 372 
VAL CB   C  N N 373 
VAL CG1  C  N N 374 
VAL CG2  C  N N 375 
VAL OXT  O  N N 376 
VAL H    H  N N 377 
VAL H2   H  N N 378 
VAL HA   H  N N 379 
VAL HB   H  N N 380 
VAL HG11 H  N N 381 
VAL HG12 H  N N 382 
VAL HG13 H  N N 383 
VAL HG21 H  N N 384 
VAL HG22 H  N N 385 
VAL HG23 H  N N 386 
VAL HXT  H  N N 387 
ZN  ZN   ZN N N 388 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
ALA N   CA   sing N N 1   
ALA N   H    sing N N 2   
ALA N   H2   sing N N 3   
ALA CA  C    sing N N 4   
ALA CA  CB   sing N N 5   
ALA CA  HA   sing N N 6   
ALA C   O    doub N N 7   
ALA C   OXT  sing N N 8   
ALA CB  HB1  sing N N 9   
ALA CB  HB2  sing N N 10  
ALA CB  HB3  sing N N 11  
ALA OXT HXT  sing N N 12  
ARG N   CA   sing N N 13  
ARG N   H    sing N N 14  
ARG N   H2   sing N N 15  
ARG CA  C    sing N N 16  
ARG CA  CB   sing N N 17  
ARG CA  HA   sing N N 18  
ARG C   O    doub N N 19  
ARG C   OXT  sing N N 20  
ARG CB  CG   sing N N 21  
ARG CB  HB2  sing N N 22  
ARG CB  HB3  sing N N 23  
ARG CG  CD   sing N N 24  
ARG CG  HG2  sing N N 25  
ARG CG  HG3  sing N N 26  
ARG CD  NE   sing N N 27  
ARG CD  HD2  sing N N 28  
ARG CD  HD3  sing N N 29  
ARG NE  CZ   sing N N 30  
ARG NE  HE   sing N N 31  
ARG CZ  NH1  sing N N 32  
ARG CZ  NH2  doub N N 33  
ARG NH1 HH11 sing N N 34  
ARG NH1 HH12 sing N N 35  
ARG NH2 HH21 sing N N 36  
ARG NH2 HH22 sing N N 37  
ARG OXT HXT  sing N N 38  
ASN N   CA   sing N N 39  
ASN N   H    sing N N 40  
ASN N   H2   sing N N 41  
ASN CA  C    sing N N 42  
ASN CA  CB   sing N N 43  
ASN CA  HA   sing N N 44  
ASN C   O    doub N N 45  
ASN C   OXT  sing N N 46  
ASN CB  CG   sing N N 47  
ASN CB  HB2  sing N N 48  
ASN CB  HB3  sing N N 49  
ASN CG  OD1  doub N N 50  
ASN CG  ND2  sing N N 51  
ASN ND2 HD21 sing N N 52  
ASN ND2 HD22 sing N N 53  
ASN OXT HXT  sing N N 54  
ASP N   CA   sing N N 55  
ASP N   H    sing N N 56  
ASP N   H2   sing N N 57  
ASP CA  C    sing N N 58  
ASP CA  CB   sing N N 59  
ASP CA  HA   sing N N 60  
ASP C   O    doub N N 61  
ASP C   OXT  sing N N 62  
ASP CB  CG   sing N N 63  
ASP CB  HB2  sing N N 64  
ASP CB  HB3  sing N N 65  
ASP CG  OD1  doub N N 66  
ASP CG  OD2  sing N N 67  
ASP OD2 HD2  sing N N 68  
ASP OXT HXT  sing N N 69  
CYS N   CA   sing N N 70  
CYS N   H    sing N N 71  
CYS N   H2   sing N N 72  
CYS CA  C    sing N N 73  
CYS CA  CB   sing N N 74  
CYS CA  HA   sing N N 75  
CYS C   O    doub N N 76  
CYS C   OXT  sing N N 77  
CYS CB  SG   sing N N 78  
CYS CB  HB2  sing N N 79  
CYS CB  HB3  sing N N 80  
CYS SG  HG   sing N N 81  
CYS OXT HXT  sing N N 82  
GLN N   CA   sing N N 83  
GLN N   H    sing N N 84  
GLN N   H2   sing N N 85  
GLN CA  C    sing N N 86  
GLN CA  CB   sing N N 87  
GLN CA  HA   sing N N 88  
GLN C   O    doub N N 89  
GLN C   OXT  sing N N 90  
GLN CB  CG   sing N N 91  
GLN CB  HB2  sing N N 92  
GLN CB  HB3  sing N N 93  
GLN CG  CD   sing N N 94  
GLN CG  HG2  sing N N 95  
GLN CG  HG3  sing N N 96  
GLN CD  OE1  doub N N 97  
GLN CD  NE2  sing N N 98  
GLN NE2 HE21 sing N N 99  
GLN NE2 HE22 sing N N 100 
GLN OXT HXT  sing N N 101 
GLU N   CA   sing N N 102 
GLU N   H    sing N N 103 
GLU N   H2   sing N N 104 
GLU CA  C    sing N N 105 
GLU CA  CB   sing N N 106 
GLU CA  HA   sing N N 107 
GLU C   O    doub N N 108 
GLU C   OXT  sing N N 109 
GLU CB  CG   sing N N 110 
GLU CB  HB2  sing N N 111 
GLU CB  HB3  sing N N 112 
GLU CG  CD   sing N N 113 
GLU CG  HG2  sing N N 114 
GLU CG  HG3  sing N N 115 
GLU CD  OE1  doub N N 116 
GLU CD  OE2  sing N N 117 
GLU OE2 HE2  sing N N 118 
GLU OXT HXT  sing N N 119 
GLY N   CA   sing N N 120 
GLY N   H    sing N N 121 
GLY N   H2   sing N N 122 
GLY CA  C    sing N N 123 
GLY CA  HA2  sing N N 124 
GLY CA  HA3  sing N N 125 
GLY C   O    doub N N 126 
GLY C   OXT  sing N N 127 
GLY OXT HXT  sing N N 128 
HIS N   CA   sing N N 129 
HIS N   H    sing N N 130 
HIS N   H2   sing N N 131 
HIS CA  C    sing N N 132 
HIS CA  CB   sing N N 133 
HIS CA  HA   sing N N 134 
HIS C   O    doub N N 135 
HIS C   OXT  sing N N 136 
HIS CB  CG   sing N N 137 
HIS CB  HB2  sing N N 138 
HIS CB  HB3  sing N N 139 
HIS CG  ND1  sing Y N 140 
HIS CG  CD2  doub Y N 141 
HIS ND1 CE1  doub Y N 142 
HIS ND1 HD1  sing N N 143 
HIS CD2 NE2  sing Y N 144 
HIS CD2 HD2  sing N N 145 
HIS CE1 NE2  sing Y N 146 
HIS CE1 HE1  sing N N 147 
HIS NE2 HE2  sing N N 148 
HIS OXT HXT  sing N N 149 
ILE N   CA   sing N N 150 
ILE N   H    sing N N 151 
ILE N   H2   sing N N 152 
ILE CA  C    sing N N 153 
ILE CA  CB   sing N N 154 
ILE CA  HA   sing N N 155 
ILE C   O    doub N N 156 
ILE C   OXT  sing N N 157 
ILE CB  CG1  sing N N 158 
ILE CB  CG2  sing N N 159 
ILE CB  HB   sing N N 160 
ILE CG1 CD1  sing N N 161 
ILE CG1 HG12 sing N N 162 
ILE CG1 HG13 sing N N 163 
ILE CG2 HG21 sing N N 164 
ILE CG2 HG22 sing N N 165 
ILE CG2 HG23 sing N N 166 
ILE CD1 HD11 sing N N 167 
ILE CD1 HD12 sing N N 168 
ILE CD1 HD13 sing N N 169 
ILE OXT HXT  sing N N 170 
LEU N   CA   sing N N 171 
LEU N   H    sing N N 172 
LEU N   H2   sing N N 173 
LEU CA  C    sing N N 174 
LEU CA  CB   sing N N 175 
LEU CA  HA   sing N N 176 
LEU C   O    doub N N 177 
LEU C   OXT  sing N N 178 
LEU CB  CG   sing N N 179 
LEU CB  HB2  sing N N 180 
LEU CB  HB3  sing N N 181 
LEU CG  CD1  sing N N 182 
LEU CG  CD2  sing N N 183 
LEU CG  HG   sing N N 184 
LEU CD1 HD11 sing N N 185 
LEU CD1 HD12 sing N N 186 
LEU CD1 HD13 sing N N 187 
LEU CD2 HD21 sing N N 188 
LEU CD2 HD22 sing N N 189 
LEU CD2 HD23 sing N N 190 
LEU OXT HXT  sing N N 191 
LYS N   CA   sing N N 192 
LYS N   H    sing N N 193 
LYS N   H2   sing N N 194 
LYS CA  C    sing N N 195 
LYS CA  CB   sing N N 196 
LYS CA  HA   sing N N 197 
LYS C   O    doub N N 198 
LYS C   OXT  sing N N 199 
LYS CB  CG   sing N N 200 
LYS CB  HB2  sing N N 201 
LYS CB  HB3  sing N N 202 
LYS CG  CD   sing N N 203 
LYS CG  HG2  sing N N 204 
LYS CG  HG3  sing N N 205 
LYS CD  CE   sing N N 206 
LYS CD  HD2  sing N N 207 
LYS CD  HD3  sing N N 208 
LYS CE  NZ   sing N N 209 
LYS CE  HE2  sing N N 210 
LYS CE  HE3  sing N N 211 
LYS NZ  HZ1  sing N N 212 
LYS NZ  HZ2  sing N N 213 
LYS NZ  HZ3  sing N N 214 
LYS OXT HXT  sing N N 215 
MET N   CA   sing N N 216 
MET N   H    sing N N 217 
MET N   H2   sing N N 218 
MET CA  C    sing N N 219 
MET CA  CB   sing N N 220 
MET CA  HA   sing N N 221 
MET C   O    doub N N 222 
MET C   OXT  sing N N 223 
MET CB  CG   sing N N 224 
MET CB  HB2  sing N N 225 
MET CB  HB3  sing N N 226 
MET CG  SD   sing N N 227 
MET CG  HG2  sing N N 228 
MET CG  HG3  sing N N 229 
MET SD  CE   sing N N 230 
MET CE  HE1  sing N N 231 
MET CE  HE2  sing N N 232 
MET CE  HE3  sing N N 233 
MET OXT HXT  sing N N 234 
PHE N   CA   sing N N 235 
PHE N   H    sing N N 236 
PHE N   H2   sing N N 237 
PHE CA  C    sing N N 238 
PHE CA  CB   sing N N 239 
PHE CA  HA   sing N N 240 
PHE C   O    doub N N 241 
PHE C   OXT  sing N N 242 
PHE CB  CG   sing N N 243 
PHE CB  HB2  sing N N 244 
PHE CB  HB3  sing N N 245 
PHE CG  CD1  doub Y N 246 
PHE CG  CD2  sing Y N 247 
PHE CD1 CE1  sing Y N 248 
PHE CD1 HD1  sing N N 249 
PHE CD2 CE2  doub Y N 250 
PHE CD2 HD2  sing N N 251 
PHE CE1 CZ   doub Y N 252 
PHE CE1 HE1  sing N N 253 
PHE CE2 CZ   sing Y N 254 
PHE CE2 HE2  sing N N 255 
PHE CZ  HZ   sing N N 256 
PHE OXT HXT  sing N N 257 
PRO N   CA   sing N N 258 
PRO N   CD   sing N N 259 
PRO N   H    sing N N 260 
PRO CA  C    sing N N 261 
PRO CA  CB   sing N N 262 
PRO CA  HA   sing N N 263 
PRO C   O    doub N N 264 
PRO C   OXT  sing N N 265 
PRO CB  CG   sing N N 266 
PRO CB  HB2  sing N N 267 
PRO CB  HB3  sing N N 268 
PRO CG  CD   sing N N 269 
PRO CG  HG2  sing N N 270 
PRO CG  HG3  sing N N 271 
PRO CD  HD2  sing N N 272 
PRO CD  HD3  sing N N 273 
PRO OXT HXT  sing N N 274 
SER N   CA   sing N N 275 
SER N   H    sing N N 276 
SER N   H2   sing N N 277 
SER CA  C    sing N N 278 
SER CA  CB   sing N N 279 
SER CA  HA   sing N N 280 
SER C   O    doub N N 281 
SER C   OXT  sing N N 282 
SER CB  OG   sing N N 283 
SER CB  HB2  sing N N 284 
SER CB  HB3  sing N N 285 
SER OG  HG   sing N N 286 
SER OXT HXT  sing N N 287 
THR N   CA   sing N N 288 
THR N   H    sing N N 289 
THR N   H2   sing N N 290 
THR CA  C    sing N N 291 
THR CA  CB   sing N N 292 
THR CA  HA   sing N N 293 
THR C   O    doub N N 294 
THR C   OXT  sing N N 295 
THR CB  OG1  sing N N 296 
THR CB  CG2  sing N N 297 
THR CB  HB   sing N N 298 
THR OG1 HG1  sing N N 299 
THR CG2 HG21 sing N N 300 
THR CG2 HG22 sing N N 301 
THR CG2 HG23 sing N N 302 
THR OXT HXT  sing N N 303 
TRP N   CA   sing N N 304 
TRP N   H    sing N N 305 
TRP N   H2   sing N N 306 
TRP CA  C    sing N N 307 
TRP CA  CB   sing N N 308 
TRP CA  HA   sing N N 309 
TRP C   O    doub N N 310 
TRP C   OXT  sing N N 311 
TRP CB  CG   sing N N 312 
TRP CB  HB2  sing N N 313 
TRP CB  HB3  sing N N 314 
TRP CG  CD1  doub Y N 315 
TRP CG  CD2  sing Y N 316 
TRP CD1 NE1  sing Y N 317 
TRP CD1 HD1  sing N N 318 
TRP CD2 CE2  doub Y N 319 
TRP CD2 CE3  sing Y N 320 
TRP NE1 CE2  sing Y N 321 
TRP NE1 HE1  sing N N 322 
TRP CE2 CZ2  sing Y N 323 
TRP CE3 CZ3  doub Y N 324 
TRP CE3 HE3  sing N N 325 
TRP CZ2 CH2  doub Y N 326 
TRP CZ2 HZ2  sing N N 327 
TRP CZ3 CH2  sing Y N 328 
TRP CZ3 HZ3  sing N N 329 
TRP CH2 HH2  sing N N 330 
TRP OXT HXT  sing N N 331 
TYR N   CA   sing N N 332 
TYR N   H    sing N N 333 
TYR N   H2   sing N N 334 
TYR CA  C    sing N N 335 
TYR CA  CB   sing N N 336 
TYR CA  HA   sing N N 337 
TYR C   O    doub N N 338 
TYR C   OXT  sing N N 339 
TYR CB  CG   sing N N 340 
TYR CB  HB2  sing N N 341 
TYR CB  HB3  sing N N 342 
TYR CG  CD1  doub Y N 343 
TYR CG  CD2  sing Y N 344 
TYR CD1 CE1  sing Y N 345 
TYR CD1 HD1  sing N N 346 
TYR CD2 CE2  doub Y N 347 
TYR CD2 HD2  sing N N 348 
TYR CE1 CZ   doub Y N 349 
TYR CE1 HE1  sing N N 350 
TYR CE2 CZ   sing Y N 351 
TYR CE2 HE2  sing N N 352 
TYR CZ  OH   sing N N 353 
TYR OH  HH   sing N N 354 
TYR OXT HXT  sing N N 355 
VAL N   CA   sing N N 356 
VAL N   H    sing N N 357 
VAL N   H2   sing N N 358 
VAL CA  C    sing N N 359 
VAL CA  CB   sing N N 360 
VAL CA  HA   sing N N 361 
VAL C   O    doub N N 362 
VAL C   OXT  sing N N 363 
VAL CB  CG1  sing N N 364 
VAL CB  CG2  sing N N 365 
VAL CB  HB   sing N N 366 
VAL CG1 HG11 sing N N 367 
VAL CG1 HG12 sing N N 368 
VAL CG1 HG13 sing N N 369 
VAL CG2 HG21 sing N N 370 
VAL CG2 HG22 sing N N 371 
VAL CG2 HG23 sing N N 372 
VAL OXT HXT  sing N N 373 
# 
_pdbx_nmr_spectrometer.field_strength    750 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DMX' 
# 
_atom_sites.entry_id                    2RSD 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_