data_2RST # _entry.id 2RST # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2RST pdb_00002rst 10.2210/pdb2rst/pdb RCSB RCSB150240 ? ? BMRB 6226 ? 10.13018/BMR6226 WWPDB D_1000150240 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-04-17 2 'Structure model' 1 1 2023-06-14 3 'Structure model' 1 2 2024-05-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' Other 4 3 'Structure model' 'Data collection' 5 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' database_2 2 2 'Structure model' pdbx_database_status 3 2 'Structure model' pdbx_nmr_software 4 2 'Structure model' pdbx_nmr_spectrometer 5 2 'Structure model' struct_ref_seq_dif 6 3 'Structure model' chem_comp_atom 7 3 'Structure model' chem_comp_bond 8 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_pdbx_database_status.status_code_nmr_data' 4 2 'Structure model' '_pdbx_nmr_software.name' 5 2 'Structure model' '_pdbx_nmr_spectrometer.model' 6 2 'Structure model' '_struct_ref_seq_dif.details' 7 3 'Structure model' '_database_2.pdbx_DOI' # _pdbx_database_status.deposit_site BMRB _pdbx_database_status.entry_id 2RST _pdbx_database_status.methods_development_category ? _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2012-05-29 _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code REL _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs REL _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data REL # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 6226 _pdbx_database_related.db_name BMRB _pdbx_database_related.details . # _audit_author.name 'Hemmi, H.' _audit_author.pdbx_ordinal 1 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary 'NMR structure and dynamics of the C-terminal domain of R-type lectin from the earthworm Lumbricus terrestris' 'Febs J.' 280 70 82 2013 ? UK 1742-464X ? ? 23122331 10.1111/febs.12050 1 ;(1)H, (13)C, and (15)N chemical shift assignment of the C-terminal 15 kDa domain of a novel galactose-binding protein from the earthworm Lumbricus terrestris ; J.Biomol.Nmr 30 377 378 2004 JBNME9 NE 0925-2738 0800 ? 15756471 10.1007/s10858-005-1845-6 2 'NMR studies on the interaction of sugars with the C-terminal domain of an R-type lectin from the earthworm Lumbricus terrestris' 'Febs J.' 276 2095 2105 2009 ? UK 1742-464X ? ? 19292877 10.1111/j.1742-4658.2009.06944.x # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hemmi, H.' 1 ? primary 'Kuno, A.' 2 ? primary 'Hirabayashi, J.' 3 ? 1 'Hemmi, H.' 4 ? 1 'Kuno, A.' 5 ? 1 'Ito, S.' 6 ? 1 'Suzuki, R.' 7 ? 1 'Kaneko, S.' 8 ? 1 'Hasegawa, T.' 9 ? 1 'Hirabayashi, J.' 10 ? 1 'Kasai, K.' 11 ? 2 'Hemmi, H.' 12 ? 2 'Kuno, A.' 13 ? 2 'Ito, S.' 14 ? 2 'Suzuki, R.' 15 ? 2 'Hasegawa, T.' 16 ? 2 'Hirabayashi, J.' 17 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description '29-kDa galactose-binding lectin' _entity.formula_weight 14877.745 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'C-terminal domain, UNP residues 130-260' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'EW29, APP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKPKFFYIKSELNGKVLDIEGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNP KRAWIVSGNTIAQLSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQKFIIESE ; _entity_poly.pdbx_seq_one_letter_code_can ;MKPKFFYIKSELNGKVLDIEGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNP KRAWIVSGNTIAQLSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQKFIIESE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 PRO n 1 4 LYS n 1 5 PHE n 1 6 PHE n 1 7 TYR n 1 8 ILE n 1 9 LYS n 1 10 SER n 1 11 GLU n 1 12 LEU n 1 13 ASN n 1 14 GLY n 1 15 LYS n 1 16 VAL n 1 17 LEU n 1 18 ASP n 1 19 ILE n 1 20 GLU n 1 21 GLY n 1 22 GLN n 1 23 ASN n 1 24 PRO n 1 25 ALA n 1 26 PRO n 1 27 GLY n 1 28 SER n 1 29 LYS n 1 30 ILE n 1 31 ILE n 1 32 THR n 1 33 TRP n 1 34 ASP n 1 35 GLN n 1 36 LYS n 1 37 LYS n 1 38 GLY n 1 39 PRO n 1 40 THR n 1 41 ALA n 1 42 VAL n 1 43 ASN n 1 44 GLN n 1 45 LEU n 1 46 TRP n 1 47 TYR n 1 48 THR n 1 49 ASP n 1 50 GLN n 1 51 GLN n 1 52 GLY n 1 53 VAL n 1 54 ILE n 1 55 ARG n 1 56 SER n 1 57 LYS n 1 58 LEU n 1 59 ASN n 1 60 ASP n 1 61 PHE n 1 62 ALA n 1 63 ILE n 1 64 ASP n 1 65 ALA n 1 66 SER n 1 67 HIS n 1 68 GLU n 1 69 GLN n 1 70 ILE n 1 71 GLU n 1 72 THR n 1 73 GLN n 1 74 PRO n 1 75 PHE n 1 76 ASP n 1 77 PRO n 1 78 ASN n 1 79 ASN n 1 80 PRO n 1 81 LYS n 1 82 ARG n 1 83 ALA n 1 84 TRP n 1 85 ILE n 1 86 VAL n 1 87 SER n 1 88 GLY n 1 89 ASN n 1 90 THR n 1 91 ILE n 1 92 ALA n 1 93 GLN n 1 94 LEU n 1 95 SER n 1 96 ASP n 1 97 ARG n 1 98 ASP n 1 99 ILE n 1 100 VAL n 1 101 LEU n 1 102 ASP n 1 103 ILE n 1 104 ILE n 1 105 LYS n 1 106 SER n 1 107 ASP n 1 108 LYS n 1 109 GLU n 1 110 ALA n 1 111 GLY n 1 112 ALA n 1 113 HIS n 1 114 ILE n 1 115 CYS n 1 116 ALA n 1 117 TRP n 1 118 LYS n 1 119 GLN n 1 120 HIS n 1 121 GLY n 1 122 GLY n 1 123 PRO n 1 124 ASN n 1 125 GLN n 1 126 LYS n 1 127 PHE n 1 128 ILE n 1 129 ILE n 1 130 GLU n 1 131 SER n 1 132 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'Common earthworm' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lumbricus terrestris' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 6398 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type vector _entity_src_gen.pdbx_host_org_vector pCRII _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 PRO 3 3 3 PRO PRO A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 PHE 5 5 5 PHE PHE A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ASN 13 13 13 ASN ASN A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ILE 19 19 19 ILE ILE A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ASN 23 23 23 ASN ASN A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 TRP 33 33 33 TRP TRP A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 LYS 37 37 37 LYS LYS A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 THR 40 40 40 THR THR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 GLN 44 44 44 GLN GLN A . n A 1 45 LEU 45 45 45 LEU LEU A . n A 1 46 TRP 46 46 46 TRP TRP A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 ILE 54 54 54 ILE ILE A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 ILE 63 63 63 ILE ILE A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 HIS 67 67 67 HIS HIS A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 GLN 69 69 69 GLN GLN A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 GLU 71 71 71 GLU GLU A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 GLN 73 73 73 GLN GLN A . n A 1 74 PRO 74 74 74 PRO PRO A . n A 1 75 PHE 75 75 75 PHE PHE A . n A 1 76 ASP 76 76 76 ASP ASP A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 PRO 80 80 80 PRO PRO A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 TRP 84 84 84 TRP TRP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 ASN 89 89 89 ASN ASN A . n A 1 90 THR 90 90 90 THR THR A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ARG 97 97 97 ARG ARG A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 ILE 99 99 99 ILE ILE A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 LEU 101 101 101 LEU LEU A . n A 1 102 ASP 102 102 102 ASP ASP A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 ILE 104 104 104 ILE ILE A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 SER 106 106 106 SER SER A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 LYS 108 108 108 LYS LYS A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 ILE 114 114 114 ILE ILE A . n A 1 115 CYS 115 115 115 CYS CYS A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 TRP 117 117 117 TRP TRP A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLN 119 119 119 GLN GLN A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 PRO 123 123 123 PRO PRO A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 GLN 125 125 125 GLN GLN A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 PHE 127 127 127 PHE PHE A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ILE 129 129 129 ILE ILE A . n A 1 130 GLU 130 130 130 GLU GLU A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 GLU 132 132 132 GLU GLU A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.crystals_number ? _exptl.details ? _exptl.entry_id 2RST _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 2RST _struct.title 'NMR structure of the C-terminal domain of EW29' _struct.pdbx_model_details 'lowest energy, model1' _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2RST _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' _struct_keywords.text 'R-type lectin, SUGAR BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O96048_LUMTE _struct_ref.pdbx_db_accession O96048 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KPKFFYIKSELNGKVLDIEGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPK RAWIVSGNTIAQLSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQKFIIESE ; _struct_ref.pdbx_align_begin 130 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2RST _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 132 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O96048 _struct_ref_seq.db_align_beg 130 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 260 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 132 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 2RST _struct_ref_seq_dif.mon_id MET _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O96048 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 41 ? ASN A 43 ? ALA A 41 ASN A 43 5 ? 3 HELX_P HELX_P2 2 LYS A 105 ? ASP A 107 ? LYS A 105 ASP A 107 5 ? 3 HELX_P HELX_P3 3 GLY A 122 ? GLN A 125 ? GLY A 122 GLN A 125 5 ? 4 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? C ? 2 ? D ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel C 1 2 ? anti-parallel D 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ILE A 54 ? SER A 56 ? ILE A 54 SER A 56 A 2 LEU A 45 ? THR A 48 ? LEU A 45 THR A 48 A 3 PHE A 5 ? SER A 10 ? PHE A 5 SER A 10 A 4 PHE A 127 ? GLU A 130 ? PHE A 127 GLU A 130 B 1 VAL A 16 ? ILE A 19 ? VAL A 16 ILE A 19 B 2 SER A 28 ? TRP A 33 ? SER A 28 TRP A 33 B 3 GLU A 71 ? GLN A 73 ? GLU A 71 GLN A 73 B 4 ALA A 62 ? ASP A 64 ? ALA A 62 ASP A 64 C 1 TRP A 84 ? SER A 87 ? TRP A 84 SER A 87 C 2 THR A 90 ? GLN A 93 ? THR A 90 GLN A 93 D 1 ILE A 99 ? ILE A 103 ? ILE A 99 ILE A 103 D 2 ILE A 114 ? LYS A 118 ? ILE A 114 LYS A 118 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O ARG A 55 ? O ARG A 55 N TYR A 47 ? N TYR A 47 A 2 3 O TRP A 46 ? O TRP A 46 N PHE A 6 ? N PHE A 6 A 3 4 N LYS A 9 ? N LYS A 9 O ILE A 128 ? O ILE A 128 B 1 2 N ASP A 18 ? N ASP A 18 O ILE A 31 ? O ILE A 31 B 2 3 N SER A 28 ? N SER A 28 O THR A 72 ? O THR A 72 B 3 4 O GLU A 71 ? O GLU A 71 N ASP A 64 ? N ASP A 64 C 1 2 N SER A 87 ? N SER A 87 O THR A 90 ? O THR A 90 D 1 2 N VAL A 100 ? N VAL A 100 O TRP A 117 ? O TRP A 117 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 3 ? ? -68.00 -170.35 2 1 GLU A 20 ? ? -63.42 95.87 3 1 ALA A 25 ? ? -45.51 99.49 4 1 ASN A 59 ? ? 177.91 178.67 5 1 ASP A 60 ? ? -67.74 84.00 6 1 ALA A 65 ? ? -97.28 43.63 7 1 PRO A 80 ? ? -76.78 24.57 8 1 LEU A 101 ? ? -47.09 154.40 9 1 LYS A 105 ? ? 76.01 -4.02 10 1 SER A 131 ? ? -54.77 108.12 11 2 GLN A 22 ? ? 61.48 -168.69 12 2 SER A 56 ? ? -66.88 -178.36 13 2 ASN A 59 ? ? 85.43 -9.15 14 2 ASP A 60 ? ? -176.68 53.54 15 2 ALA A 65 ? ? -96.83 42.77 16 2 PRO A 80 ? ? -77.78 20.42 17 2 LEU A 101 ? ? -45.96 153.24 18 2 LYS A 105 ? ? 71.46 -2.13 19 3 GLU A 20 ? ? -40.51 96.77 20 3 GLN A 22 ? ? 59.47 -163.27 21 3 ASN A 59 ? ? 178.34 -171.15 22 3 ALA A 65 ? ? -94.30 39.62 23 3 PRO A 80 ? ? -77.27 20.10 24 3 LEU A 101 ? ? -45.62 154.21 25 3 LYS A 105 ? ? 80.88 -9.03 26 4 GLU A 20 ? ? -61.72 96.13 27 4 ALA A 25 ? ? -43.35 102.43 28 4 ASN A 59 ? ? -179.36 -179.69 29 4 ALA A 65 ? ? -97.42 43.49 30 4 PRO A 80 ? ? -76.66 21.16 31 4 LEU A 101 ? ? -46.39 155.19 32 4 LYS A 105 ? ? 82.43 -20.81 33 5 LYS A 2 ? ? 63.59 126.21 34 5 GLU A 20 ? ? -41.16 96.00 35 5 GLN A 22 ? ? 65.74 -74.31 36 5 ASN A 23 ? ? 59.80 92.52 37 5 ASN A 59 ? ? -171.24 -72.30 38 5 ASP A 60 ? ? -176.42 81.89 39 5 ALA A 65 ? ? -95.07 42.05 40 5 PRO A 80 ? ? -77.16 21.28 41 5 LEU A 101 ? ? -46.26 154.09 42 6 LYS A 4 ? ? -47.94 151.35 43 6 GLU A 20 ? ? -41.85 101.57 44 6 GLN A 22 ? ? 63.48 -76.06 45 6 ASN A 23 ? ? 63.32 100.44 46 6 ASN A 59 ? ? 174.74 -169.82 47 6 ALA A 65 ? ? -104.06 42.37 48 6 ASP A 76 ? ? 61.29 118.15 49 6 LEU A 101 ? ? -46.06 154.29 50 6 SER A 106 ? ? 45.69 -139.18 51 6 ASP A 107 ? ? 68.84 162.88 52 6 HIS A 120 ? ? -142.54 16.07 53 6 SER A 131 ? ? -54.29 107.09 54 7 GLN A 22 ? ? 45.84 29.81 55 7 ASN A 59 ? ? -179.86 -81.46 56 7 ASP A 60 ? ? -176.44 77.64 57 7 ALA A 65 ? ? -96.18 40.96 58 7 PRO A 80 ? ? -76.44 25.48 59 7 LEU A 101 ? ? -46.47 153.79 60 8 LYS A 2 ? ? 60.33 82.12 61 8 GLU A 20 ? ? -40.64 96.30 62 8 GLN A 22 ? ? 67.67 -66.06 63 8 ASN A 23 ? ? 63.55 90.75 64 8 ASN A 59 ? ? 170.77 -171.86 65 8 ALA A 65 ? ? -96.73 41.78 66 8 PRO A 80 ? ? -77.34 20.07 67 8 LEU A 101 ? ? -46.72 154.37 68 8 LYS A 105 ? ? 78.40 -9.80 69 8 SER A 131 ? ? -53.47 109.30 70 9 LYS A 4 ? ? -102.76 76.84 71 9 GLU A 20 ? ? -51.04 109.20 72 9 SER A 56 ? ? -68.80 -177.20 73 9 ASN A 59 ? ? 84.44 -10.24 74 9 ASP A 60 ? ? -175.36 53.49 75 9 ALA A 65 ? ? -99.65 41.44 76 9 PRO A 80 ? ? -77.62 22.05 77 9 LEU A 101 ? ? -47.94 154.22 78 9 LYS A 105 ? ? 75.61 -7.21 79 9 SER A 106 ? ? 46.61 29.15 80 10 GLN A 22 ? ? 47.63 27.49 81 10 ASN A 59 ? ? 172.52 -53.47 82 10 ASP A 60 ? ? 179.71 76.82 83 10 ALA A 65 ? ? -98.13 44.08 84 10 PRO A 80 ? ? -76.47 25.37 85 10 LEU A 101 ? ? -45.53 153.40 86 10 LYS A 105 ? ? 76.56 -5.83 87 10 SER A 106 ? ? 46.36 29.69 88 11 LYS A 2 ? ? 61.92 153.77 89 11 PRO A 3 ? ? -58.70 -178.01 90 11 ASN A 59 ? ? 176.31 172.82 91 11 ASP A 60 ? ? -65.41 79.24 92 11 ALA A 65 ? ? -99.06 43.29 93 11 PRO A 80 ? ? -77.09 24.70 94 11 LEU A 101 ? ? -45.53 153.30 95 12 PRO A 3 ? ? -52.12 105.55 96 12 GLU A 20 ? ? -43.60 96.25 97 12 GLN A 22 ? ? 68.41 -66.54 98 12 ASN A 23 ? ? 64.82 90.73 99 12 ASN A 59 ? ? -166.06 -69.24 100 12 ASP A 60 ? ? 179.65 82.54 101 12 ALA A 65 ? ? -94.29 40.80 102 12 PRO A 80 ? ? -77.32 21.63 103 12 LEU A 101 ? ? -46.15 154.89 104 12 LYS A 105 ? ? 70.34 -0.80 105 12 SER A 131 ? ? -49.96 109.64 106 13 GLU A 20 ? ? -39.67 95.97 107 13 GLN A 22 ? ? 68.31 -66.33 108 13 ASN A 23 ? ? 61.83 92.53 109 13 ASN A 59 ? ? 170.89 -173.96 110 13 ASP A 60 ? ? -69.38 84.58 111 13 ALA A 65 ? ? -100.25 40.09 112 13 LEU A 101 ? ? -45.55 152.20 113 13 LYS A 105 ? ? 81.34 -9.68 114 13 SER A 106 ? ? 46.76 29.99 115 14 LYS A 2 ? ? 60.72 94.13 116 14 PRO A 3 ? ? -50.09 178.60 117 14 PRO A 24 ? ? -86.18 36.98 118 14 SER A 56 ? ? -69.51 -177.53 119 14 ASN A 59 ? ? 91.91 -34.54 120 14 ASP A 60 ? ? -156.51 60.33 121 14 ALA A 65 ? ? -95.32 41.42 122 14 PRO A 80 ? ? -77.20 21.45 123 14 LEU A 101 ? ? -46.71 154.70 124 14 LYS A 105 ? ? 48.62 24.99 125 14 SER A 106 ? ? 44.48 -121.32 126 14 ASP A 107 ? ? 61.11 150.26 127 15 PRO A 3 ? ? -61.14 79.71 128 15 GLU A 20 ? ? -39.39 104.79 129 15 ASN A 23 ? ? -46.28 102.63 130 15 PRO A 39 ? ? -48.12 166.72 131 15 THR A 40 ? ? 44.34 23.14 132 15 ASN A 59 ? ? 178.93 -178.00 133 15 ALA A 65 ? ? -93.58 41.26 134 15 PRO A 80 ? ? -74.94 27.98 135 15 LEU A 101 ? ? -45.58 154.13 136 15 LYS A 105 ? ? 76.95 -7.32 137 15 SER A 106 ? ? 46.56 28.85 138 15 SER A 131 ? ? -51.04 108.67 139 16 GLU A 20 ? ? -65.26 96.13 140 16 ALA A 25 ? ? -40.39 97.80 141 16 ASN A 59 ? ? 175.43 -55.34 142 16 ASP A 60 ? ? 179.55 77.60 143 16 ALA A 65 ? ? -93.33 43.48 144 16 PRO A 80 ? ? -72.51 32.63 145 16 LEU A 101 ? ? -45.98 153.84 146 16 LYS A 105 ? ? 80.13 -9.82 147 16 SER A 106 ? ? 46.76 29.51 148 17 GLU A 20 ? ? -41.26 96.08 149 17 GLN A 22 ? ? 37.52 48.09 150 17 ASN A 23 ? ? -48.34 105.85 151 17 ASN A 59 ? ? -176.56 -173.82 152 17 ASP A 60 ? ? -68.02 82.55 153 17 ALA A 65 ? ? -93.95 39.92 154 17 PRO A 80 ? ? -77.37 23.09 155 17 LEU A 101 ? ? -45.97 154.00 156 18 GLU A 20 ? ? -44.45 104.27 157 18 GLN A 22 ? ? 65.82 -71.17 158 18 ASN A 23 ? ? 68.25 91.71 159 18 THR A 40 ? ? 43.85 23.99 160 18 ASN A 59 ? ? -172.12 -179.74 161 18 ASP A 60 ? ? -69.83 84.77 162 18 ALA A 65 ? ? -97.75 39.86 163 18 PRO A 80 ? ? -76.73 25.14 164 18 LEU A 101 ? ? -45.31 153.99 165 18 LYS A 105 ? ? 56.12 18.36 166 18 SER A 106 ? ? 45.10 -132.87 167 18 ASP A 107 ? ? 65.45 162.90 168 19 GLU A 20 ? ? -52.67 105.90 169 19 ASN A 23 ? ? -58.77 108.46 170 19 PRO A 24 ? ? -78.52 36.61 171 19 SER A 56 ? ? -69.58 -176.77 172 19 ASN A 59 ? ? 89.53 -25.64 173 19 ASP A 60 ? ? -164.93 58.20 174 19 ALA A 65 ? ? -99.36 42.41 175 19 ASP A 76 ? ? 63.56 118.83 176 19 LEU A 101 ? ? -46.32 153.87 177 19 LYS A 105 ? ? 78.92 -6.10 178 19 SER A 106 ? ? 46.45 29.70 179 20 GLU A 20 ? ? -34.14 97.85 180 20 ASN A 23 ? ? -47.11 102.87 181 20 ASN A 59 ? ? -178.12 -176.47 182 20 ASP A 60 ? ? -66.75 83.26 183 20 ALA A 65 ? ? -97.51 41.66 184 20 PRO A 80 ? ? -76.84 27.11 185 20 LEU A 101 ? ? -46.20 154.31 186 20 LYS A 105 ? ? 73.54 -3.71 187 20 SER A 131 ? ? -57.15 108.06 # _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the lowest energy' _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.entry_id 2RST _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.representative_conformer 1 _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.entry_id 2RST _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.solvent_system '0.9 mM [U-15N; U-13C] C-terminal domain of EW29-1, 90% H2O/10% D2O' 1 '90% H2O/10% D2O' '0.9 mM [U-15N] C-terminal domain of EW29-2, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' # loop_ _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling _pdbx_nmr_exptl_sample.solution_id 'C-terminal domain of EW29-1' 0.9 ? mM '[U-15N; U-13C]' 1 'C-terminal domain of EW29-2' 0.9 ? mM '[U-15N]' 2 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pH 6.1 _pdbx_nmr_exptl_sample_conditions.pressure ? _pdbx_nmr_exptl_sample_conditions.pressure_units ? _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type 1 1 1 '2D 1H-15N HSQC' 1 2 1 '3D CBCA(CO)NH' 1 3 1 '3D C(CO)NH' 1 4 1 '3D HNCO' 1 5 1 '3D HNCACB' 1 6 1 '3D H(CCO)NH' 1 7 1 '3D HCCH-TOCSY' 1 8 1 '3D HNHA' 1 9 1 '3D 1H-15N NOESY' 1 10 1 '3D 1H-13C NOESY' 1 11 1 '3D HNHB' 1 12 1 '3D HCCH-COSY' 1 13 1 '2D 1H-1H NOESY' 1 14 2 '2D 1H-15N IPAP' # _pdbx_nmr_refine.entry_id 2RST _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.authors _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.ordinal _pdbx_nmr_software.version 'Bruker Biospin' acquisiton XwinNMR 1 3.5 'Accelrys Software Inc.' processing Felix 2 2000 Goddard 'peak assignment' Sparky 3 3.100 'Brunger, Adams, Clore, Gros, Nilges and Read' refinement CNS 4 1.1 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # loop_ _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.type 600 Bruker DRX 1 'Bruker DRX' 800 Bruker AVANCE 2 'Bruker Avance' # _atom_sites.entry_id 2RST _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_