data_2XHS # _entry.id 2XHS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.294 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2XHS PDBE EBI-44070 WWPDB D_1290044070 # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2011-07-20 _pdbx_database_PDB_obs_spr.pdb_id 2XHS _pdbx_database_PDB_obs_spr.replace_pdb_id 2IZ2 _pdbx_database_PDB_obs_spr.details ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 1FTZ unspecified . PDB 2IZ2 unspecified 'CRYSTAL STRUCTURE OF THE LIGAND BINDING DOMAIN OF FUSHI TARAZU FACTOR 1 FROM DROSOPHILA MELANOGASTER' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2XHS _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-06-21 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Yoo, J.H.' 1 'Cho, H.S.' 2 # _citation.id primary _citation.title ;Crystal Structure of Fushi Tarazu Factor 1 Ligand Binding Domain/Fushi Tarazu Peptide Complex Identifies New Class of Nuclear Receptors. ; _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 286 _citation.page_first 31225 _citation.page_last ? _citation.year 2011 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21775434 _citation.pdbx_database_id_DOI 10.1074/JBC.M111.252916 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Yoo, J.' 1 primary 'Ko, S.' 2 primary 'Kim, H.' 3 primary 'Sampson, H.' 4 primary 'Yun, J.H.' 5 primary 'Choe, K.M.' 6 primary 'Chang, I.' 7 primary 'Arrowsmith, C.H.' 8 primary 'Krause, H.M.' 9 primary 'Cho, H.S.' 10 primary 'Lee, W.' 11 # _cell.entry_id 2XHS _cell.length_a 97.931 _cell.length_b 97.931 _cell.length_c 123.466 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2XHS _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NUCLEAR HORMONE RECEPTOR FTZ-F1' 28804.346 1 ? ? 'LIGAND BINDING DOMAIN, RESIDUES 791-1027' ? 2 polymer syn 'SEGMENTATION PROTEIN FUSHI TARAZU' 989.148 1 ? ? 'RESIDUES 107-115' ? 3 water nat water 18.015 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FTZ-F1 ALPHA, NUCLEAR RECEPTOR SUBFAMILY 5 GROUP A MEMBER 3, NR5A3' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;GSH(MSE)LEDPLRVSP(MSE)IREFVQSIDDREWQTQLFALLQKQTYNQVEVDLFEL(MSE)CKVLDQNLFSQVDWARN TVFFKDLKVDDQ(MSE)KLLQHSWSD(MSE)LVLDHLHHRIHNGLPDETQLNNGQVFNL(MSE)SLGLLGVPQLGDYFNE LQNKLQDLKFD(MSE)GDYVC(MSE)KFLILLNPSVRGIVNRKTVSEGHDNVQAALLDYTLTCYPSVNDKFRGLVNILPE IHA(MSE)AVRGEDHLYTKHCAGSAPTQTLL(MSE)E(MSE)LHAKRKG ; ;GSHMLEDPLRVSPMIREFVQSIDDREWQTQLFALLQKQTYNQVEVDLFELMCKVLDQNLFSQVDWARNTVFFKDLKVDDQ MKLLQHSWSDMLVLDHLHHRIHNGLPDETQLNNGQVFNLMSLGLLGVPQLGDYFNELQNKLQDLKFDMGDYVCMKFLILL NPSVRGIVNRKTVSEGHDNVQAALLDYTLTCYPSVNDKFRGLVNILPEIHAMAVRGEDHLYTKHCAGSAPTQTLLMEMLH AKRKG ; A ? 2 'polypeptide(L)' no no STLRALLTN STLRALLTN B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MSE n 1 5 LEU n 1 6 GLU n 1 7 ASP n 1 8 PRO n 1 9 LEU n 1 10 ARG n 1 11 VAL n 1 12 SER n 1 13 PRO n 1 14 MSE n 1 15 ILE n 1 16 ARG n 1 17 GLU n 1 18 PHE n 1 19 VAL n 1 20 GLN n 1 21 SER n 1 22 ILE n 1 23 ASP n 1 24 ASP n 1 25 ARG n 1 26 GLU n 1 27 TRP n 1 28 GLN n 1 29 THR n 1 30 GLN n 1 31 LEU n 1 32 PHE n 1 33 ALA n 1 34 LEU n 1 35 LEU n 1 36 GLN n 1 37 LYS n 1 38 GLN n 1 39 THR n 1 40 TYR n 1 41 ASN n 1 42 GLN n 1 43 VAL n 1 44 GLU n 1 45 VAL n 1 46 ASP n 1 47 LEU n 1 48 PHE n 1 49 GLU n 1 50 LEU n 1 51 MSE n 1 52 CYS n 1 53 LYS n 1 54 VAL n 1 55 LEU n 1 56 ASP n 1 57 GLN n 1 58 ASN n 1 59 LEU n 1 60 PHE n 1 61 SER n 1 62 GLN n 1 63 VAL n 1 64 ASP n 1 65 TRP n 1 66 ALA n 1 67 ARG n 1 68 ASN n 1 69 THR n 1 70 VAL n 1 71 PHE n 1 72 PHE n 1 73 LYS n 1 74 ASP n 1 75 LEU n 1 76 LYS n 1 77 VAL n 1 78 ASP n 1 79 ASP n 1 80 GLN n 1 81 MSE n 1 82 LYS n 1 83 LEU n 1 84 LEU n 1 85 GLN n 1 86 HIS n 1 87 SER n 1 88 TRP n 1 89 SER n 1 90 ASP n 1 91 MSE n 1 92 LEU n 1 93 VAL n 1 94 LEU n 1 95 ASP n 1 96 HIS n 1 97 LEU n 1 98 HIS n 1 99 HIS n 1 100 ARG n 1 101 ILE n 1 102 HIS n 1 103 ASN n 1 104 GLY n 1 105 LEU n 1 106 PRO n 1 107 ASP n 1 108 GLU n 1 109 THR n 1 110 GLN n 1 111 LEU n 1 112 ASN n 1 113 ASN n 1 114 GLY n 1 115 GLN n 1 116 VAL n 1 117 PHE n 1 118 ASN n 1 119 LEU n 1 120 MSE n 1 121 SER n 1 122 LEU n 1 123 GLY n 1 124 LEU n 1 125 LEU n 1 126 GLY n 1 127 VAL n 1 128 PRO n 1 129 GLN n 1 130 LEU n 1 131 GLY n 1 132 ASP n 1 133 TYR n 1 134 PHE n 1 135 ASN n 1 136 GLU n 1 137 LEU n 1 138 GLN n 1 139 ASN n 1 140 LYS n 1 141 LEU n 1 142 GLN n 1 143 ASP n 1 144 LEU n 1 145 LYS n 1 146 PHE n 1 147 ASP n 1 148 MSE n 1 149 GLY n 1 150 ASP n 1 151 TYR n 1 152 VAL n 1 153 CYS n 1 154 MSE n 1 155 LYS n 1 156 PHE n 1 157 LEU n 1 158 ILE n 1 159 LEU n 1 160 LEU n 1 161 ASN n 1 162 PRO n 1 163 SER n 1 164 VAL n 1 165 ARG n 1 166 GLY n 1 167 ILE n 1 168 VAL n 1 169 ASN n 1 170 ARG n 1 171 LYS n 1 172 THR n 1 173 VAL n 1 174 SER n 1 175 GLU n 1 176 GLY n 1 177 HIS n 1 178 ASP n 1 179 ASN n 1 180 VAL n 1 181 GLN n 1 182 ALA n 1 183 ALA n 1 184 LEU n 1 185 LEU n 1 186 ASP n 1 187 TYR n 1 188 THR n 1 189 LEU n 1 190 THR n 1 191 CYS n 1 192 TYR n 1 193 PRO n 1 194 SER n 1 195 VAL n 1 196 ASN n 1 197 ASP n 1 198 LYS n 1 199 PHE n 1 200 ARG n 1 201 GLY n 1 202 LEU n 1 203 VAL n 1 204 ASN n 1 205 ILE n 1 206 LEU n 1 207 PRO n 1 208 GLU n 1 209 ILE n 1 210 HIS n 1 211 ALA n 1 212 MSE n 1 213 ALA n 1 214 VAL n 1 215 ARG n 1 216 GLY n 1 217 GLU n 1 218 ASP n 1 219 HIS n 1 220 LEU n 1 221 TYR n 1 222 THR n 1 223 LYS n 1 224 HIS n 1 225 CYS n 1 226 ALA n 1 227 GLY n 1 228 SER n 1 229 ALA n 1 230 PRO n 1 231 THR n 1 232 GLN n 1 233 THR n 1 234 LEU n 1 235 LEU n 1 236 MSE n 1 237 GLU n 1 238 MSE n 1 239 LEU n 1 240 HIS n 1 241 ALA n 1 242 LYS n 1 243 ARG n 1 244 LYS n 1 245 GLY n 2 1 SER n 2 2 THR n 2 3 LEU n 2 4 ARG n 2 5 ALA n 2 6 LEU n 2 7 LEU n 2 8 THR n 2 9 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'FRUIT FLY' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'DROSOPHILA MELANOGASTER' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector 'PET15(B)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'DROSOPHILA MELANOGASTER' _pdbx_entity_src_syn.organism_common_name 'FRUIT FLY' _pdbx_entity_src_syn.ncbi_taxonomy_id 7227 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP FTZF1_DROME 1 ? ? P33244 ? 2 UNP FTZ_DROME 2 ? ? P02835 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2XHS A 8 ? 245 ? P33244 790 ? 1027 ? 790 1027 2 2 2XHS B 1 ? 9 ? P02835 107 ? 115 ? 1 9 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2XHS GLY A 1 ? UNP P33244 ? ? 'expression tag' 783 1 1 2XHS SER A 2 ? UNP P33244 ? ? 'expression tag' 784 2 1 2XHS HIS A 3 ? UNP P33244 ? ? 'expression tag' 785 3 1 2XHS MSE A 4 ? UNP P33244 ? ? 'expression tag' 786 4 1 2XHS LEU A 5 ? UNP P33244 ? ? 'expression tag' 787 5 1 2XHS GLU A 6 ? UNP P33244 ? ? 'expression tag' 788 6 1 2XHS ASP A 7 ? UNP P33244 ? ? 'expression tag' 789 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2XHS _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.32 _exptl_crystal.density_percent_sol 47.00 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.3M SODIUM CITRATE TRI-BASIC, 0.1M HEPES PH 7.5' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type BRUKER _diffrn_detector.pdbx_collection_date ? _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97939 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PAL/PLS BEAMLINE 6B' _diffrn_source.pdbx_synchrotron_site PAL/PLS _diffrn_source.pdbx_synchrotron_beamline 6B _diffrn_source.pdbx_wavelength 0.97939 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2XHS _reflns.observed_criterion_sigma_I 0.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 20.00 _reflns.d_resolution_high 2.80 _reflns.number_obs 25725 _reflns.number_all ? _reflns.percent_possible_obs 99.9 _reflns.pdbx_Rmerge_I_obs 0.12 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 19.08 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 15.3 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.80 _reflns_shell.d_res_low 2.90 _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_obs 0.42 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.50 _reflns_shell.pdbx_redundancy 10.7 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2XHS _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 16400 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 18.60 _refine.ls_d_res_high 2.80 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.219 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.217 _refine.ls_R_factor_R_free 0.246 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.10 _refine.ls_number_reflns_R_free 875 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.932 _refine.correlation_coeff_Fo_to_Fc_free 0.911 _refine.B_iso_mean 54.35 _refine.aniso_B[1][1] 0.04 _refine.aniso_B[2][2] 0.04 _refine.aniso_B[3][3] -0.06 _refine.aniso_B[1][2] 0.02 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITION. U VALUES REFINED INDIVIDUALLY.' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.307 _refine.pdbx_overall_ESU_R_Free 0.247 _refine.overall_SU_ML 0.218 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 11.591 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2039 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 2042 _refine_hist.d_res_high 2.80 _refine_hist.d_res_low 18.60 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.023 0.022 ? 2070 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.707 1.960 ? 2795 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 5.276 5.000 ? 247 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 32.372 25.000 ? 104 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 20.768 15.000 ? 376 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 20.290 15.000 ? 11 'X-RAY DIFFRACTION' ? r_chiral_restr 0.095 0.200 ? 316 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.007 0.021 ? 1548 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.260 0.200 ? 970 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.335 0.200 ? 1453 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.150 0.200 ? 60 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.257 0.200 ? 22 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.288 0.200 ? 3 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.099 1.500 ? 1247 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.233 2.000 ? 2011 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 4.148 3.000 ? 823 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 6.238 4.500 ? 784 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.80 _refine_ls_shell.d_res_low 2.87 _refine_ls_shell.number_reflns_R_work 1173 _refine_ls_shell.R_factor_R_work 0.37 _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.R_factor_R_free 0.3530 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 62 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? # _struct.entry_id 2XHS _struct.title 'Crystal structure of the ligand binding domain of Fushi tarazu factor 1 of Drosophila melanogaster.' _struct.pdbx_descriptor 'NUCLEAR HORMONE RECEPTOR FTZ-F1, SEGMENTATION PROTEIN FUSHI TARAZU' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2XHS _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 7 ? VAL A 11 ? ASP A 789 VAL A 793 5 ? 5 HELX_P HELX_P2 2 SER A 12 ? SER A 21 ? SER A 794 SER A 803 1 ? 10 HELX_P HELX_P3 3 ASP A 23 ? TYR A 40 ? ASP A 805 TYR A 822 1 ? 18 HELX_P HELX_P4 4 ASP A 46 ? ASN A 68 ? ASP A 828 ASN A 850 1 ? 23 HELX_P HELX_P5 5 PHE A 71 ? LEU A 75 ? PHE A 853 LEU A 857 5 ? 5 HELX_P HELX_P6 6 LYS A 76 ? ASN A 103 ? LYS A 858 ASN A 885 1 ? 28 HELX_P HELX_P7 7 MSE A 120 ? LEU A 124 ? MSE A 902 LEU A 906 5 ? 5 HELX_P HELX_P8 8 VAL A 127 ? GLN A 129 ? VAL A 909 GLN A 911 5 ? 3 HELX_P HELX_P9 9 LEU A 130 ? LEU A 144 ? LEU A 912 LEU A 926 1 ? 15 HELX_P HELX_P10 10 ASP A 147 ? LEU A 160 ? ASP A 929 LEU A 942 1 ? 14 HELX_P HELX_P11 11 ASN A 169 ? TYR A 192 ? ASN A 951 TYR A 974 1 ? 24 HELX_P HELX_P12 12 ASP A 197 ? ALA A 226 ? ASP A 979 ALA A 1008 1 ? 30 HELX_P HELX_P13 13 THR A 233 ? ALA A 241 ? THR A 1015 ALA A 1023 1 ? 9 HELX_P HELX_P14 14 SER B 1 ? THR B 8 ? SER B 1 THR B 8 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A HIS 3 C ? ? ? 1_555 A MSE 4 N ? ? A HIS 785 A MSE 786 1_555 ? ? ? ? ? ? ? 1.317 ? covale2 covale both ? A MSE 4 C ? ? ? 1_555 A LEU 5 N ? ? A MSE 786 A LEU 787 1_555 ? ? ? ? ? ? ? 1.312 ? covale3 covale both ? A PRO 13 C ? ? ? 1_555 A MSE 14 N ? ? A PRO 795 A MSE 796 1_555 ? ? ? ? ? ? ? 1.315 ? covale4 covale both ? A MSE 14 C ? ? ? 1_555 A ILE 15 N ? ? A MSE 796 A ILE 797 1_555 ? ? ? ? ? ? ? 1.305 ? covale5 covale both ? A LEU 50 C ? ? ? 1_555 A MSE 51 N ? ? A LEU 832 A MSE 833 1_555 ? ? ? ? ? ? ? 1.305 ? covale6 covale both ? A MSE 51 C ? ? ? 1_555 A CYS 52 N ? ? A MSE 833 A CYS 834 1_555 ? ? ? ? ? ? ? 1.311 ? covale7 covale both ? A GLN 80 C ? ? ? 1_555 A MSE 81 N ? ? A GLN 862 A MSE 863 1_555 ? ? ? ? ? ? ? 1.310 ? covale8 covale both ? A MSE 81 C ? ? ? 1_555 A LYS 82 N ? ? A MSE 863 A LYS 864 1_555 ? ? ? ? ? ? ? 1.301 ? covale9 covale both ? A ASP 90 C ? ? ? 1_555 A MSE 91 N ? ? A ASP 872 A MSE 873 1_555 ? ? ? ? ? ? ? 1.310 ? covale10 covale both ? A MSE 91 C ? ? ? 1_555 A LEU 92 N ? ? A MSE 873 A LEU 874 1_555 ? ? ? ? ? ? ? 1.300 ? covale11 covale both ? A LEU 119 C ? ? ? 1_555 A MSE 120 N ? ? A LEU 901 A MSE 902 1_555 ? ? ? ? ? ? ? 1.305 ? covale12 covale both ? A MSE 120 C ? ? ? 1_555 A SER 121 N ? ? A MSE 902 A SER 903 1_555 ? ? ? ? ? ? ? 1.313 ? covale13 covale both ? A ASP 147 C ? ? ? 1_555 A MSE 148 N ? ? A ASP 929 A MSE 930 1_555 ? ? ? ? ? ? ? 1.312 ? covale14 covale both ? A MSE 148 C ? ? ? 1_555 A GLY 149 N ? ? A MSE 930 A GLY 931 1_555 ? ? ? ? ? ? ? 1.304 ? covale15 covale both ? A CYS 153 C ? ? ? 1_555 A MSE 154 N ? ? A CYS 935 A MSE 936 1_555 ? ? ? ? ? ? ? 1.327 ? covale16 covale both ? A MSE 154 C ? ? ? 1_555 A LYS 155 N ? ? A MSE 936 A LYS 937 1_555 ? ? ? ? ? ? ? 1.307 ? covale17 covale both ? A ALA 211 C ? ? ? 1_555 A MSE 212 N ? ? A ALA 993 A MSE 994 1_555 ? ? ? ? ? ? ? 1.314 ? covale18 covale both ? A MSE 212 C ? ? ? 1_555 A ALA 213 N ? ? A MSE 994 A ALA 995 1_555 ? ? ? ? ? ? ? 1.315 ? covale19 covale both ? A LEU 235 C ? ? ? 1_555 A MSE 236 N ? ? A LEU 1017 A MSE 1018 1_555 ? ? ? ? ? ? ? 1.312 ? covale20 covale both ? A MSE 236 C ? ? ? 1_555 A GLU 237 N ? ? A MSE 1018 A GLU 1019 1_555 ? ? ? ? ? ? ? 1.302 ? covale21 covale both ? A GLU 237 C ? ? ? 1_555 A MSE 238 N ? ? A GLU 1019 A MSE 1020 1_555 ? ? ? ? ? ? ? 1.307 ? covale22 covale both ? A MSE 238 C ? ? ? 1_555 A LEU 239 N ? ? A MSE 1020 A LEU 1021 1_555 ? ? ? ? ? ? ? 1.305 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLU A 108 ? GLN A 110 ? GLU A 890 GLN A 892 AA 2 VAL A 116 ? ASN A 118 ? VAL A 898 ASN A 900 # _pdbx_struct_sheet_hbond.sheet_id AA _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id THR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 109 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id THR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 891 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 117 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 899 # _database_PDB_matrix.entry_id 2XHS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2XHS _atom_sites.fract_transf_matrix[1][1] 0.010211 _atom_sites.fract_transf_matrix[1][2] 0.005895 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011791 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008099 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 783 783 GLY GLY A . n A 1 2 SER 2 784 784 SER SER A . n A 1 3 HIS 3 785 785 HIS HIS A . n A 1 4 MSE 4 786 786 MSE MSE A . n A 1 5 LEU 5 787 787 LEU LEU A . n A 1 6 GLU 6 788 788 GLU GLU A . n A 1 7 ASP 7 789 789 ASP ASP A . n A 1 8 PRO 8 790 790 PRO PRO A . n A 1 9 LEU 9 791 791 LEU LEU A . n A 1 10 ARG 10 792 792 ARG ARG A . n A 1 11 VAL 11 793 793 VAL VAL A . n A 1 12 SER 12 794 794 SER SER A . n A 1 13 PRO 13 795 795 PRO PRO A . n A 1 14 MSE 14 796 796 MSE MSE A . n A 1 15 ILE 15 797 797 ILE ILE A . n A 1 16 ARG 16 798 798 ARG ARG A . n A 1 17 GLU 17 799 799 GLU GLU A . n A 1 18 PHE 18 800 800 PHE PHE A . n A 1 19 VAL 19 801 801 VAL VAL A . n A 1 20 GLN 20 802 802 GLN GLN A . n A 1 21 SER 21 803 803 SER SER A . n A 1 22 ILE 22 804 804 ILE ILE A . n A 1 23 ASP 23 805 805 ASP ASP A . n A 1 24 ASP 24 806 806 ASP ASP A . n A 1 25 ARG 25 807 807 ARG ARG A . n A 1 26 GLU 26 808 808 GLU GLU A . n A 1 27 TRP 27 809 809 TRP TRP A . n A 1 28 GLN 28 810 810 GLN GLN A . n A 1 29 THR 29 811 811 THR THR A . n A 1 30 GLN 30 812 812 GLN GLN A . n A 1 31 LEU 31 813 813 LEU LEU A . n A 1 32 PHE 32 814 814 PHE PHE A . n A 1 33 ALA 33 815 815 ALA ALA A . n A 1 34 LEU 34 816 816 LEU LEU A . n A 1 35 LEU 35 817 817 LEU LEU A . n A 1 36 GLN 36 818 818 GLN GLN A . n A 1 37 LYS 37 819 819 LYS LYS A . n A 1 38 GLN 38 820 820 GLN GLN A . n A 1 39 THR 39 821 821 THR THR A . n A 1 40 TYR 40 822 822 TYR TYR A . n A 1 41 ASN 41 823 823 ASN ASN A . n A 1 42 GLN 42 824 824 GLN GLN A . n A 1 43 VAL 43 825 825 VAL VAL A . n A 1 44 GLU 44 826 826 GLU GLU A . n A 1 45 VAL 45 827 827 VAL VAL A . n A 1 46 ASP 46 828 828 ASP ASP A . n A 1 47 LEU 47 829 829 LEU LEU A . n A 1 48 PHE 48 830 830 PHE PHE A . n A 1 49 GLU 49 831 831 GLU GLU A . n A 1 50 LEU 50 832 832 LEU LEU A . n A 1 51 MSE 51 833 833 MSE MSE A . n A 1 52 CYS 52 834 834 CYS CYS A . n A 1 53 LYS 53 835 835 LYS LYS A . n A 1 54 VAL 54 836 836 VAL VAL A . n A 1 55 LEU 55 837 837 LEU LEU A . n A 1 56 ASP 56 838 838 ASP ASP A . n A 1 57 GLN 57 839 839 GLN GLN A . n A 1 58 ASN 58 840 840 ASN ASN A . n A 1 59 LEU 59 841 841 LEU LEU A . n A 1 60 PHE 60 842 842 PHE PHE A . n A 1 61 SER 61 843 843 SER SER A . n A 1 62 GLN 62 844 844 GLN GLN A . n A 1 63 VAL 63 845 845 VAL VAL A . n A 1 64 ASP 64 846 846 ASP ASP A . n A 1 65 TRP 65 847 847 TRP TRP A . n A 1 66 ALA 66 848 848 ALA ALA A . n A 1 67 ARG 67 849 849 ARG ARG A . n A 1 68 ASN 68 850 850 ASN ASN A . n A 1 69 THR 69 851 851 THR THR A . n A 1 70 VAL 70 852 852 VAL VAL A . n A 1 71 PHE 71 853 853 PHE PHE A . n A 1 72 PHE 72 854 854 PHE PHE A . n A 1 73 LYS 73 855 855 LYS LYS A . n A 1 74 ASP 74 856 856 ASP ASP A . n A 1 75 LEU 75 857 857 LEU LEU A . n A 1 76 LYS 76 858 858 LYS LYS A . n A 1 77 VAL 77 859 859 VAL VAL A . n A 1 78 ASP 78 860 860 ASP ASP A . n A 1 79 ASP 79 861 861 ASP ASP A . n A 1 80 GLN 80 862 862 GLN GLN A . n A 1 81 MSE 81 863 863 MSE MSE A . n A 1 82 LYS 82 864 864 LYS LYS A . n A 1 83 LEU 83 865 865 LEU LEU A . n A 1 84 LEU 84 866 866 LEU LEU A . n A 1 85 GLN 85 867 867 GLN GLN A . n A 1 86 HIS 86 868 868 HIS HIS A . n A 1 87 SER 87 869 869 SER SER A . n A 1 88 TRP 88 870 870 TRP TRP A . n A 1 89 SER 89 871 871 SER SER A . n A 1 90 ASP 90 872 872 ASP ASP A . n A 1 91 MSE 91 873 873 MSE MSE A . n A 1 92 LEU 92 874 874 LEU LEU A . n A 1 93 VAL 93 875 875 VAL VAL A . n A 1 94 LEU 94 876 876 LEU LEU A . n A 1 95 ASP 95 877 877 ASP ASP A . n A 1 96 HIS 96 878 878 HIS HIS A . n A 1 97 LEU 97 879 879 LEU LEU A . n A 1 98 HIS 98 880 880 HIS HIS A . n A 1 99 HIS 99 881 881 HIS HIS A . n A 1 100 ARG 100 882 882 ARG ARG A . n A 1 101 ILE 101 883 883 ILE ILE A . n A 1 102 HIS 102 884 884 HIS HIS A . n A 1 103 ASN 103 885 885 ASN ASN A . n A 1 104 GLY 104 886 886 GLY GLY A . n A 1 105 LEU 105 887 887 LEU LEU A . n A 1 106 PRO 106 888 888 PRO PRO A . n A 1 107 ASP 107 889 889 ASP ASP A . n A 1 108 GLU 108 890 890 GLU GLU A . n A 1 109 THR 109 891 891 THR THR A . n A 1 110 GLN 110 892 892 GLN GLN A . n A 1 111 LEU 111 893 893 LEU LEU A . n A 1 112 ASN 112 894 894 ASN ASN A . n A 1 113 ASN 113 895 895 ASN ASN A . n A 1 114 GLY 114 896 896 GLY GLY A . n A 1 115 GLN 115 897 897 GLN GLN A . n A 1 116 VAL 116 898 898 VAL VAL A . n A 1 117 PHE 117 899 899 PHE PHE A . n A 1 118 ASN 118 900 900 ASN ASN A . n A 1 119 LEU 119 901 901 LEU LEU A . n A 1 120 MSE 120 902 902 MSE MSE A . n A 1 121 SER 121 903 903 SER SER A . n A 1 122 LEU 122 904 904 LEU LEU A . n A 1 123 GLY 123 905 905 GLY GLY A . n A 1 124 LEU 124 906 906 LEU LEU A . n A 1 125 LEU 125 907 907 LEU LEU A . n A 1 126 GLY 126 908 908 GLY GLY A . n A 1 127 VAL 127 909 909 VAL VAL A . n A 1 128 PRO 128 910 910 PRO PRO A . n A 1 129 GLN 129 911 911 GLN GLN A . n A 1 130 LEU 130 912 912 LEU LEU A . n A 1 131 GLY 131 913 913 GLY GLY A . n A 1 132 ASP 132 914 914 ASP ASP A . n A 1 133 TYR 133 915 915 TYR TYR A . n A 1 134 PHE 134 916 916 PHE PHE A . n A 1 135 ASN 135 917 917 ASN ASN A . n A 1 136 GLU 136 918 918 GLU GLU A . n A 1 137 LEU 137 919 919 LEU LEU A . n A 1 138 GLN 138 920 920 GLN GLN A . n A 1 139 ASN 139 921 921 ASN ASN A . n A 1 140 LYS 140 922 922 LYS LYS A . n A 1 141 LEU 141 923 923 LEU LEU A . n A 1 142 GLN 142 924 924 GLN GLN A . n A 1 143 ASP 143 925 925 ASP ASP A . n A 1 144 LEU 144 926 926 LEU LEU A . n A 1 145 LYS 145 927 927 LYS LYS A . n A 1 146 PHE 146 928 928 PHE PHE A . n A 1 147 ASP 147 929 929 ASP ASP A . n A 1 148 MSE 148 930 930 MSE MSE A . n A 1 149 GLY 149 931 931 GLY GLY A . n A 1 150 ASP 150 932 932 ASP ASP A . n A 1 151 TYR 151 933 933 TYR TYR A . n A 1 152 VAL 152 934 934 VAL VAL A . n A 1 153 CYS 153 935 935 CYS CYS A . n A 1 154 MSE 154 936 936 MSE MSE A . n A 1 155 LYS 155 937 937 LYS LYS A . n A 1 156 PHE 156 938 938 PHE PHE A . n A 1 157 LEU 157 939 939 LEU LEU A . n A 1 158 ILE 158 940 940 ILE ILE A . n A 1 159 LEU 159 941 941 LEU LEU A . n A 1 160 LEU 160 942 942 LEU LEU A . n A 1 161 ASN 161 943 943 ASN ASN A . n A 1 162 PRO 162 944 944 PRO PRO A . n A 1 163 SER 163 945 945 SER SER A . n A 1 164 VAL 164 946 946 VAL VAL A . n A 1 165 ARG 165 947 947 ARG ARG A . n A 1 166 GLY 166 948 948 GLY GLY A . n A 1 167 ILE 167 949 949 ILE ILE A . n A 1 168 VAL 168 950 950 VAL VAL A . n A 1 169 ASN 169 951 951 ASN ASN A . n A 1 170 ARG 170 952 952 ARG ARG A . n A 1 171 LYS 171 953 953 LYS LYS A . n A 1 172 THR 172 954 954 THR THR A . n A 1 173 VAL 173 955 955 VAL VAL A . n A 1 174 SER 174 956 956 SER SER A . n A 1 175 GLU 175 957 957 GLU GLU A . n A 1 176 GLY 176 958 958 GLY GLY A . n A 1 177 HIS 177 959 959 HIS HIS A . n A 1 178 ASP 178 960 960 ASP ASP A . n A 1 179 ASN 179 961 961 ASN ASN A . n A 1 180 VAL 180 962 962 VAL VAL A . n A 1 181 GLN 181 963 963 GLN GLN A . n A 1 182 ALA 182 964 964 ALA ALA A . n A 1 183 ALA 183 965 965 ALA ALA A . n A 1 184 LEU 184 966 966 LEU LEU A . n A 1 185 LEU 185 967 967 LEU LEU A . n A 1 186 ASP 186 968 968 ASP ASP A . n A 1 187 TYR 187 969 969 TYR TYR A . n A 1 188 THR 188 970 970 THR THR A . n A 1 189 LEU 189 971 971 LEU LEU A . n A 1 190 THR 190 972 972 THR THR A . n A 1 191 CYS 191 973 973 CYS CYS A . n A 1 192 TYR 192 974 974 TYR TYR A . n A 1 193 PRO 193 975 975 PRO PRO A . n A 1 194 SER 194 976 976 SER SER A . n A 1 195 VAL 195 977 977 VAL VAL A . n A 1 196 ASN 196 978 978 ASN ASN A . n A 1 197 ASP 197 979 979 ASP ASP A . n A 1 198 LYS 198 980 980 LYS LYS A . n A 1 199 PHE 199 981 981 PHE PHE A . n A 1 200 ARG 200 982 982 ARG ARG A . n A 1 201 GLY 201 983 983 GLY GLY A . n A 1 202 LEU 202 984 984 LEU LEU A . n A 1 203 VAL 203 985 985 VAL VAL A . n A 1 204 ASN 204 986 986 ASN ASN A . n A 1 205 ILE 205 987 987 ILE ILE A . n A 1 206 LEU 206 988 988 LEU LEU A . n A 1 207 PRO 207 989 989 PRO PRO A . n A 1 208 GLU 208 990 990 GLU GLU A . n A 1 209 ILE 209 991 991 ILE ILE A . n A 1 210 HIS 210 992 992 HIS HIS A . n A 1 211 ALA 211 993 993 ALA ALA A . n A 1 212 MSE 212 994 994 MSE MSE A . n A 1 213 ALA 213 995 995 ALA ALA A . n A 1 214 VAL 214 996 996 VAL VAL A . n A 1 215 ARG 215 997 997 ARG ARG A . n A 1 216 GLY 216 998 998 GLY GLY A . n A 1 217 GLU 217 999 999 GLU GLU A . n A 1 218 ASP 218 1000 1000 ASP ASP A . n A 1 219 HIS 219 1001 1001 HIS HIS A . n A 1 220 LEU 220 1002 1002 LEU LEU A . n A 1 221 TYR 221 1003 1003 TYR TYR A . n A 1 222 THR 222 1004 1004 THR THR A . n A 1 223 LYS 223 1005 1005 LYS LYS A . n A 1 224 HIS 224 1006 1006 HIS HIS A . n A 1 225 CYS 225 1007 1007 CYS CYS A . n A 1 226 ALA 226 1008 1008 ALA ALA A . n A 1 227 GLY 227 1009 1009 GLY GLY A . n A 1 228 SER 228 1010 1010 SER SER A . n A 1 229 ALA 229 1011 1011 ALA ALA A . n A 1 230 PRO 230 1012 1012 PRO PRO A . n A 1 231 THR 231 1013 1013 THR THR A . n A 1 232 GLN 232 1014 1014 GLN GLN A . n A 1 233 THR 233 1015 1015 THR THR A . n A 1 234 LEU 234 1016 1016 LEU LEU A . n A 1 235 LEU 235 1017 1017 LEU LEU A . n A 1 236 MSE 236 1018 1018 MSE MSE A . n A 1 237 GLU 237 1019 1019 GLU GLU A . n A 1 238 MSE 238 1020 1020 MSE MSE A . n A 1 239 LEU 239 1021 1021 LEU LEU A . n A 1 240 HIS 240 1022 1022 HIS HIS A . n A 1 241 ALA 241 1023 1023 ALA ALA A . n A 1 242 LYS 242 1024 1024 LYS LYS A . n A 1 243 ARG 243 1025 1025 ARG ARG A . n A 1 244 LYS 244 1026 1026 LYS LYS A . n A 1 245 GLY 245 1027 ? ? ? A . n B 2 1 SER 1 1 1 SER SER B . n B 2 2 THR 2 2 2 THR THR B . n B 2 3 LEU 3 3 3 LEU LEU B . n B 2 4 ARG 4 4 4 ARG ARG B . n B 2 5 ALA 5 5 5 ALA ALA B . n B 2 6 LEU 6 6 6 LEU LEU B . n B 2 7 LEU 7 7 7 LEU LEU B . n B 2 8 THR 8 8 8 THR THR B . n B 2 9 ASN 9 9 9 ASN ASN B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 2001 2001 HOH HOH A . C 3 HOH 2 2002 2002 HOH HOH A . C 3 HOH 3 2003 2003 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 4 A MSE 786 ? MET SELENOMETHIONINE 2 A MSE 14 A MSE 796 ? MET SELENOMETHIONINE 3 A MSE 51 A MSE 833 ? MET SELENOMETHIONINE 4 A MSE 81 A MSE 863 ? MET SELENOMETHIONINE 5 A MSE 91 A MSE 873 ? MET SELENOMETHIONINE 6 A MSE 120 A MSE 902 ? MET SELENOMETHIONINE 7 A MSE 148 A MSE 930 ? MET SELENOMETHIONINE 8 A MSE 154 A MSE 936 ? MET SELENOMETHIONINE 9 A MSE 212 A MSE 994 ? MET SELENOMETHIONINE 10 A MSE 236 A MSE 1018 ? MET SELENOMETHIONINE 11 A MSE 238 A MSE 1020 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 900 ? 1 MORE -6.7 ? 1 'SSA (A^2)' 12160 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-07-20 2 'Structure model' 1 1 2011-09-14 3 'Structure model' 1 2 2018-06-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' Advisory 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 2 3 'Structure model' pdbx_validate_close_contact 3 3 'Structure model' struct_conn # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.5.0109 ? 1 HKL-2000 'data reduction' . ? 2 SCALEPACK 'data scaling' . ? 3 SOLVE phasing . ? 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O _pdbx_validate_close_contact.auth_asym_id_1 B _pdbx_validate_close_contact.auth_comp_id_1 LEU _pdbx_validate_close_contact.auth_seq_id_1 3 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CD2 _pdbx_validate_close_contact.auth_asym_id_2 B _pdbx_validate_close_contact.auth_comp_id_2 LEU _pdbx_validate_close_contact.auth_seq_id_2 7 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.73 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 894 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 82.10 _pdbx_validate_torsion.psi 0.40 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 792 ? ? 0.295 'SIDE CHAIN' 2 1 ARG A 982 ? ? 0.123 'SIDE CHAIN' # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 1026 ? CA ? A LYS 244 CA 2 1 Y 1 A LYS 1026 ? C ? A LYS 244 C 3 1 Y 1 A LYS 1026 ? O ? A LYS 244 O 4 1 Y 1 A LYS 1026 ? CB ? A LYS 244 CB 5 1 Y 1 A LYS 1026 ? CG ? A LYS 244 CG 6 1 Y 1 A LYS 1026 ? CD ? A LYS 244 CD 7 1 Y 1 A LYS 1026 ? CE ? A LYS 244 CE 8 1 Y 1 A LYS 1026 ? NZ ? A LYS 244 NZ # _pdbx_unobs_or_zero_occ_residues.id 1 _pdbx_unobs_or_zero_occ_residues.PDB_model_num 1 _pdbx_unobs_or_zero_occ_residues.polymer_flag Y _pdbx_unobs_or_zero_occ_residues.occupancy_flag 1 _pdbx_unobs_or_zero_occ_residues.auth_asym_id A _pdbx_unobs_or_zero_occ_residues.auth_comp_id GLY _pdbx_unobs_or_zero_occ_residues.auth_seq_id 1027 _pdbx_unobs_or_zero_occ_residues.PDB_ins_code ? _pdbx_unobs_or_zero_occ_residues.label_asym_id A _pdbx_unobs_or_zero_occ_residues.label_comp_id GLY _pdbx_unobs_or_zero_occ_residues.label_seq_id 245 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #