data_2XS2 # _entry.id 2XS2 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.294 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2XS2 PDBE EBI-45494 WWPDB D_1290045494 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.content_type _pdbx_database_related.details PDB 2XS5 unspecified 'CRYSTAL STRUCTURE OF THE RRM DOMAIN OF MOUSE DELETED IN AZOOSPERMIA-LIKE IN COMPLEX WITH MVH RNA, UGUUC' PDB 2XSF unspecified 'CRYSTAL STRUCTURE OF THE RRM DOMAIN OF MOUSE DELETED IN AZOOSPERMIA-LIKE' PDB 2XS7 unspecified 'CRYSTAL STRUCTURE OF THE RRM DOMAIN OF MOUSE DELETED IN AZOOSPERMIA-LIKE IN COMPLEX WITH SYCP3 RNA, UUGUUU' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2XS2 _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-09-24 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Jenkins, H.T.' 1 ? 'Edwards, T.A.' 2 ? # _citation.id primary _citation.title 'Kinked beta-strands mediate high-affinity recognition of mRNA targets by the germ-cell regulator DAZL.' _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_volume 108 _citation.page_first 18266 _citation.page_last 18271 _citation.year 2011 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 1091-6490 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 22021443 _citation.pdbx_database_id_DOI 10.1073/pnas.1105211108 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Jenkins, H.T.' 1 primary 'Malkova, B.' 2 primary 'Edwards, T.A.' 3 # _cell.entry_id 2XS2 _cell.length_a 38.100 _cell.length_b 52.060 _cell.length_c 60.490 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2XS2 _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DELETED IN AZOOSPERMIA-LIKE' 11580.338 1 ? YES 'RESIDUES 32-132' ? 2 polymer syn "5'-R(*UP*UP*GP*UP*UP*CP*UP*U)-3'" 2442.425 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 4 water nat water 18.015 129 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DAZ-LIKE AUTOSOMAL, DELETED IN AZOOSPERMIA-LIKE 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SLPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKL GPAIRKQNLSTYHVQPRPLIFN ; ;SLPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKL GPAIRKQNLSTYHVQPRPLIFN ; A ? 2 polyribonucleotide no no UUGUUCUU UUGUUCUU B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 LEU n 1 3 PRO n 1 4 GLU n 1 5 GLY n 1 6 LYS n 1 7 ILE n 1 8 MET n 1 9 PRO n 1 10 ASN n 1 11 THR n 1 12 VAL n 1 13 PHE n 1 14 VAL n 1 15 GLY n 1 16 GLY n 1 17 ILE n 1 18 ASP n 1 19 VAL n 1 20 ARG n 1 21 MET n 1 22 ASP n 1 23 GLU n 1 24 THR n 1 25 GLU n 1 26 ILE n 1 27 ARG n 1 28 SER n 1 29 PHE n 1 30 PHE n 1 31 ALA n 1 32 ARG n 1 33 TYR n 1 34 GLY n 1 35 SER n 1 36 VAL n 1 37 LYS n 1 38 GLU n 1 39 VAL n 1 40 LYS n 1 41 ILE n 1 42 ILE n 1 43 THR n 1 44 ASP n 1 45 ARG n 1 46 THR n 1 47 GLY n 1 48 VAL n 1 49 SER n 1 50 LYS n 1 51 GLY n 1 52 TYR n 1 53 GLY n 1 54 PHE n 1 55 VAL n 1 56 SER n 1 57 PHE n 1 58 TYR n 1 59 ASN n 1 60 ASP n 1 61 VAL n 1 62 ASP n 1 63 VAL n 1 64 GLN n 1 65 LYS n 1 66 ILE n 1 67 VAL n 1 68 GLU n 1 69 SER n 1 70 GLN n 1 71 ILE n 1 72 ASN n 1 73 PHE n 1 74 HIS n 1 75 GLY n 1 76 LYS n 1 77 LYS n 1 78 LEU n 1 79 LYS n 1 80 LEU n 1 81 GLY n 1 82 PRO n 1 83 ALA n 1 84 ILE n 1 85 ARG n 1 86 LYS n 1 87 GLN n 1 88 ASN n 1 89 LEU n 1 90 SER n 1 91 THR n 1 92 TYR n 1 93 HIS n 1 94 VAL n 1 95 GLN n 1 96 PRO n 1 97 ARG n 1 98 PRO n 1 99 LEU n 1 100 ILE n 1 101 PHE n 1 102 ASN n 2 1 U n 2 2 U n 2 3 G n 2 4 U n 2 5 U n 2 6 C n 2 7 U n 2 8 U n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'HOUSE MOUSE' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'MUS MUSCULUS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant 'ROSETTA-2 PLYSS' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET-SUMO-28A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'MUS MUSCULUS' _pdbx_entity_src_syn.organism_common_name 'HOUSE MOUSE' _pdbx_entity_src_syn.ncbi_taxonomy_id 10090 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform 1 UNP DAZL_MOUSE 1 ? ? Q64368 ? 2 PDB 2XS2 2 ? ? 2XS2 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2XS2 A 2 ? 102 ? Q64368 32 ? 132 ? 32 132 2 2 2XS2 B 1 ? 8 ? 2XS2 1 ? 8 ? 1 8 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2XS2 SER A 1 ? UNP Q64368 ? ? 'expression tag' 31 1 1 2XS2 SER A 90 ? UNP Q64368 CYS 120 'engineered mutation' 120 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C 'RNA linking' y "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 G 'RNA linking' y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 U 'RNA linking' y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 2XS2 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.73 _exptl_crystal.density_percent_sol 55 _exptl_crystal.description NONE _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '10 MM MAGNESIUM FORMATE, 20 % (W/V) PEG 3350, 0.1 MM ZINC ACETATE' # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2010-04-14 _diffrn_detector.details 'KIRKPATRICK BAEZ BIMORPH MIRROR PAIR FOR HORIZONTAL AND VERTICAL FOCUSSING' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'DOUBLE CRYSTAL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_wavelength 0.9763 _diffrn_source.pdbx_wavelength_list 0.9763 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2XS2 _reflns.observed_criterion_sigma_I 6.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 27.41 _reflns.d_resolution_high 1.35 _reflns.number_obs 26034 _reflns.number_all ? _reflns.percent_possible_obs 96.0 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 15.00 _reflns.B_iso_Wilson_estimate 16.33 _reflns.pdbx_redundancy 5.4 _reflns.pdbx_CC_half ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_Rrim_I_all ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.35 _reflns_shell.d_res_low 1.42 _reflns_shell.percent_possible_all 87.3 _reflns_shell.Rmerge_I_obs 0.65 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.40 _reflns_shell.pdbx_redundancy 5.1 _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2XS2 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 24721 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F . _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.41 _refine.ls_d_res_high 1.35 _refine.ls_percent_reflns_obs 96.05 _refine.ls_R_factor_obs 0.16292 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.16131 _refine.ls_R_factor_R_free 0.19267 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 1313 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.970 _refine.correlation_coeff_Fo_to_Fc_free 0.963 _refine.B_iso_mean 19.382 _refine.aniso_B[1][1] -0.08 _refine.aniso_B[2][2] 0.23 _refine.aniso_B[3][3] -0.16 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.055 _refine.pdbx_overall_ESU_R_Free 0.053 _refine.overall_SU_ML 0.031 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.679 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 679 _refine_hist.pdbx_number_atoms_nucleic_acid 124 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 129 _refine_hist.number_atoms_total 933 _refine_hist.d_res_high 1.35 _refine_hist.d_res_low 27.41 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.017 0.022 ? 870 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.642 2.133 ? 1203 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.297 5.000 ? 96 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 33.729 22.857 ? 35 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 10.858 15.000 ? 134 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 26.313 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.110 0.200 ? 137 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.010 0.021 ? 622 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined 0.198 0.200 ? 306 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.313 0.200 ? 573 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.109 0.200 ? 73 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined 0.030 0.200 ? 2 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.171 0.200 ? 45 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.118 0.200 ? 17 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined 0.062 0.200 ? 2 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.830 1.500 ? 448 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it 2.864 2.000 ? 728 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it 3.807 3.000 ? 422 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it 5.342 4.500 ? 470 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr 1.971 3.000 ? 870 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.350 _refine_ls_shell.d_res_low 1.385 _refine_ls_shell.number_reflns_R_work 1445 _refine_ls_shell.R_factor_R_work 0.325 _refine_ls_shell.percent_reflns_obs 77.22 _refine_ls_shell.R_factor_R_free 0.321 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 67 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 2XS2 _struct.title 'Crystal structure of the RRM domain of mouse Deleted in azoospermia-like in complex with RNA, UUGUUCUU' _struct.pdbx_descriptor 'DELETED IN AZOOSPERMIA-LIKE' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2XS2 _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN/RNA' _struct_keywords.text 'RNA BINDING PROTEIN-RNA COMPLEX' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 22 ? ALA A 31 ? ASP A 52 ALA A 61 1 ? 10 HELX_P HELX_P2 2 ARG A 32 ? GLY A 34 ? ARG A 62 GLY A 64 5 ? 3 HELX_P HELX_P3 3 ASP A 62 ? VAL A 67 ? ASP A 92 VAL A 97 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 74 NE2 ? ? B ZN 1009 A HIS 104 3_554 ? ? ? ? ? ? ? 1.982 ? metalc2 metalc ? ? C ZN . ZN ? ? ? 1_555 A GLU 25 OE1 ? ? B ZN 1009 A GLU 55 3_554 ? ? ? ? ? ? ? 1.982 ? metalc3 metalc ? ? C ZN . ZN ? ? ? 1_555 A HIS 93 ND1 ? ? B ZN 1009 A HIS 123 1_555 ? ? ? ? ? ? ? 2.051 ? metalc4 metalc ? ? C ZN . ZN ? ? ? 1_555 B C 6 N3 ? ? B ZN 1009 B C 6 1_555 ? ? ? ? ? ? ? 2.018 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 4 ? AB ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AB 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 VAL A 36 ? THR A 43 ? VAL A 66 THR A 73 AA 2 SER A 49 ? PHE A 57 ? SER A 79 PHE A 87 AA 3 LYS A 6 ? GLY A 15 ? LYS A 36 GLY A 45 AA 4 LYS A 79 ? ARG A 85 ? LYS A 109 ARG A 115 AB 1 ASN A 72 ? PHE A 73 ? ASN A 102 PHE A 103 AB 2 LYS A 76 ? LYS A 77 ? LYS A 106 LYS A 107 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 O ILE A 42 ? O ILE A 72 N LYS A 50 ? N LYS A 80 AA 2 3 N PHE A 57 ? N PHE A 87 O ASN A 10 ? O ASN A 40 AA 3 4 N GLY A 15 ? N GLY A 45 O LYS A 79 ? O LYS A 109 AB 1 2 N PHE A 73 ? N PHE A 103 O LYS A 76 ? O LYS A 106 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id ? _struct_site.pdbx_auth_comp_id ? _struct_site.pdbx_auth_seq_id ? _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN B 1009' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 GLU A 25 ? GLU A 55 . ? 3_554 ? 2 AC1 4 HIS A 74 ? HIS A 104 . ? 3_554 ? 3 AC1 4 HIS A 93 ? HIS A 123 . ? 1_555 ? 4 AC1 4 C B 6 ? C B 6 . ? 1_555 ? # _database_PDB_matrix.entry_id 2XS2 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2XS2 _atom_sites.fract_transf_matrix[1][1] 0.026247 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.019209 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016532 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 31 ? ? ? A . n A 1 2 LEU 2 32 32 LEU LEU A . n A 1 3 PRO 3 33 33 PRO PRO A . n A 1 4 GLU 4 34 34 GLU GLU A . n A 1 5 GLY 5 35 35 GLY GLY A . n A 1 6 LYS 6 36 36 LYS LYS A . n A 1 7 ILE 7 37 37 ILE ILE A . n A 1 8 MET 8 38 38 MET MET A . n A 1 9 PRO 9 39 39 PRO PRO A . n A 1 10 ASN 10 40 40 ASN ASN A . n A 1 11 THR 11 41 41 THR THR A . n A 1 12 VAL 12 42 42 VAL VAL A . n A 1 13 PHE 13 43 43 PHE PHE A . n A 1 14 VAL 14 44 44 VAL VAL A . n A 1 15 GLY 15 45 45 GLY GLY A . n A 1 16 GLY 16 46 46 GLY GLY A . n A 1 17 ILE 17 47 47 ILE ILE A . n A 1 18 ASP 18 48 48 ASP ASP A . n A 1 19 VAL 19 49 49 VAL VAL A . n A 1 20 ARG 20 50 50 ARG ARG A . n A 1 21 MET 21 51 51 MET MET A . n A 1 22 ASP 22 52 52 ASP ASP A . n A 1 23 GLU 23 53 53 GLU GLU A . n A 1 24 THR 24 54 54 THR THR A . n A 1 25 GLU 25 55 55 GLU GLU A . n A 1 26 ILE 26 56 56 ILE ILE A . n A 1 27 ARG 27 57 57 ARG ARG A . n A 1 28 SER 28 58 58 SER SER A . n A 1 29 PHE 29 59 59 PHE PHE A . n A 1 30 PHE 30 60 60 PHE PHE A . n A 1 31 ALA 31 61 61 ALA ALA A . n A 1 32 ARG 32 62 62 ARG ARG A . n A 1 33 TYR 33 63 63 TYR TYR A . n A 1 34 GLY 34 64 64 GLY GLY A . n A 1 35 SER 35 65 65 SER SER A . n A 1 36 VAL 36 66 66 VAL VAL A . n A 1 37 LYS 37 67 67 LYS LYS A . n A 1 38 GLU 38 68 68 GLU GLU A . n A 1 39 VAL 39 69 69 VAL VAL A . n A 1 40 LYS 40 70 70 LYS LYS A . n A 1 41 ILE 41 71 71 ILE ILE A . n A 1 42 ILE 42 72 72 ILE ILE A . n A 1 43 THR 43 73 73 THR THR A . n A 1 44 ASP 44 74 74 ASP ASP A . n A 1 45 ARG 45 75 75 ARG ARG A . n A 1 46 THR 46 76 76 THR THR A . n A 1 47 GLY 47 77 77 GLY GLY A . n A 1 48 VAL 48 78 78 VAL VAL A . n A 1 49 SER 49 79 79 SER SER A . n A 1 50 LYS 50 80 80 LYS LYS A . n A 1 51 GLY 51 81 81 GLY GLY A . n A 1 52 TYR 52 82 82 TYR TYR A . n A 1 53 GLY 53 83 83 GLY GLY A . n A 1 54 PHE 54 84 84 PHE PHE A . n A 1 55 VAL 55 85 85 VAL VAL A . n A 1 56 SER 56 86 86 SER SER A . n A 1 57 PHE 57 87 87 PHE PHE A . n A 1 58 TYR 58 88 88 TYR TYR A . n A 1 59 ASN 59 89 89 ASN ASN A . n A 1 60 ASP 60 90 90 ASP ASP A . n A 1 61 VAL 61 91 91 VAL VAL A . n A 1 62 ASP 62 92 92 ASP ASP A . n A 1 63 VAL 63 93 93 VAL VAL A . n A 1 64 GLN 64 94 94 GLN GLN A . n A 1 65 LYS 65 95 95 LYS LYS A . n A 1 66 ILE 66 96 96 ILE ILE A . n A 1 67 VAL 67 97 97 VAL VAL A . n A 1 68 GLU 68 98 98 GLU GLU A . n A 1 69 SER 69 99 99 SER SER A . n A 1 70 GLN 70 100 100 GLN GLN A . n A 1 71 ILE 71 101 101 ILE ILE A . n A 1 72 ASN 72 102 102 ASN ASN A . n A 1 73 PHE 73 103 103 PHE PHE A . n A 1 74 HIS 74 104 104 HIS HIS A . n A 1 75 GLY 75 105 105 GLY GLY A . n A 1 76 LYS 76 106 106 LYS LYS A . n A 1 77 LYS 77 107 107 LYS LYS A . n A 1 78 LEU 78 108 108 LEU LEU A . n A 1 79 LYS 79 109 109 LYS LYS A . n A 1 80 LEU 80 110 110 LEU LEU A . n A 1 81 GLY 81 111 111 GLY GLY A . n A 1 82 PRO 82 112 112 PRO PRO A . n A 1 83 ALA 83 113 113 ALA ALA A . n A 1 84 ILE 84 114 114 ILE ILE A . n A 1 85 ARG 85 115 115 ARG ARG A . n A 1 86 LYS 86 116 116 LYS LYS A . n A 1 87 GLN 87 117 117 GLN GLN A . n A 1 88 ASN 88 118 ? ? ? A . n A 1 89 LEU 89 119 ? ? ? A . n A 1 90 SER 90 120 ? ? ? A . n A 1 91 THR 91 121 ? ? ? A . n A 1 92 TYR 92 122 ? ? ? A . n A 1 93 HIS 93 123 123 HIS HIS A . n A 1 94 VAL 94 124 124 VAL VAL A . n A 1 95 GLN 95 125 ? ? ? A . n A 1 96 PRO 96 126 ? ? ? A . n A 1 97 ARG 97 127 ? ? ? A . n A 1 98 PRO 98 128 ? ? ? A . n A 1 99 LEU 99 129 ? ? ? A . n A 1 100 ILE 100 130 ? ? ? A . n A 1 101 PHE 101 131 ? ? ? A . n A 1 102 ASN 102 132 ? ? ? A . n B 2 1 U 1 1 ? ? ? B . n B 2 2 U 2 2 2 U U B . n B 2 3 G 3 3 3 G G B . n B 2 4 U 4 4 4 U U B . n B 2 5 U 5 5 5 U U B . n B 2 6 C 6 6 6 C C B . n B 2 7 U 7 7 7 U U B . n B 2 8 U 8 8 8 U U B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 ZN 1 1009 1009 ZN ZN B . D 4 HOH 1 2001 2001 HOH HOH A . D 4 HOH 2 2002 2002 HOH HOH A . D 4 HOH 3 2003 2003 HOH HOH A . D 4 HOH 4 2004 2004 HOH HOH A . D 4 HOH 5 2005 2005 HOH HOH A . D 4 HOH 6 2006 2006 HOH HOH A . D 4 HOH 7 2007 2007 HOH HOH A . D 4 HOH 8 2008 2008 HOH HOH A . D 4 HOH 9 2009 2009 HOH HOH A . D 4 HOH 10 2010 2010 HOH HOH A . D 4 HOH 11 2011 2011 HOH HOH A . D 4 HOH 12 2012 2012 HOH HOH A . D 4 HOH 13 2013 2013 HOH HOH A . D 4 HOH 14 2014 2014 HOH HOH A . D 4 HOH 15 2015 2015 HOH HOH A . D 4 HOH 16 2016 2016 HOH HOH A . D 4 HOH 17 2017 2017 HOH HOH A . D 4 HOH 18 2018 2018 HOH HOH A . D 4 HOH 19 2019 2019 HOH HOH A . D 4 HOH 20 2020 2020 HOH HOH A . D 4 HOH 21 2021 2021 HOH HOH A . D 4 HOH 22 2022 2022 HOH HOH A . D 4 HOH 23 2023 2023 HOH HOH A . D 4 HOH 24 2024 2024 HOH HOH A . D 4 HOH 25 2025 2025 HOH HOH A . D 4 HOH 26 2026 2026 HOH HOH A . D 4 HOH 27 2027 2027 HOH HOH A . D 4 HOH 28 2028 2028 HOH HOH A . D 4 HOH 29 2029 2029 HOH HOH A . D 4 HOH 30 2030 2030 HOH HOH A . D 4 HOH 31 2031 2031 HOH HOH A . D 4 HOH 32 2032 2032 HOH HOH A . D 4 HOH 33 2033 2033 HOH HOH A . D 4 HOH 34 2034 2034 HOH HOH A . D 4 HOH 35 2035 2035 HOH HOH A . D 4 HOH 36 2036 2036 HOH HOH A . D 4 HOH 37 2037 2037 HOH HOH A . D 4 HOH 38 2038 2038 HOH HOH A . D 4 HOH 39 2039 2039 HOH HOH A . D 4 HOH 40 2040 2040 HOH HOH A . D 4 HOH 41 2041 2041 HOH HOH A . D 4 HOH 42 2042 2042 HOH HOH A . D 4 HOH 43 2043 2043 HOH HOH A . D 4 HOH 44 2044 2044 HOH HOH A . D 4 HOH 45 2045 2045 HOH HOH A . D 4 HOH 46 2046 2046 HOH HOH A . D 4 HOH 47 2047 2047 HOH HOH A . D 4 HOH 48 2048 2048 HOH HOH A . D 4 HOH 49 2049 2049 HOH HOH A . D 4 HOH 50 2050 2050 HOH HOH A . D 4 HOH 51 2051 2051 HOH HOH A . D 4 HOH 52 2052 2052 HOH HOH A . D 4 HOH 53 2053 2053 HOH HOH A . D 4 HOH 54 2054 2054 HOH HOH A . D 4 HOH 55 2055 2055 HOH HOH A . D 4 HOH 56 2056 2056 HOH HOH A . D 4 HOH 57 2057 2057 HOH HOH A . D 4 HOH 58 2058 2058 HOH HOH A . D 4 HOH 59 2059 2059 HOH HOH A . D 4 HOH 60 2060 2060 HOH HOH A . D 4 HOH 61 2061 2061 HOH HOH A . D 4 HOH 62 2062 2062 HOH HOH A . D 4 HOH 63 2063 2063 HOH HOH A . D 4 HOH 64 2064 2064 HOH HOH A . D 4 HOH 65 2065 2065 HOH HOH A . D 4 HOH 66 2066 2066 HOH HOH A . D 4 HOH 67 2067 2067 HOH HOH A . D 4 HOH 68 2068 2068 HOH HOH A . D 4 HOH 69 2069 2069 HOH HOH A . D 4 HOH 70 2070 2070 HOH HOH A . D 4 HOH 71 2071 2071 HOH HOH A . D 4 HOH 72 2072 2072 HOH HOH A . D 4 HOH 73 2073 2073 HOH HOH A . D 4 HOH 74 2074 2074 HOH HOH A . D 4 HOH 75 2075 2075 HOH HOH A . D 4 HOH 76 2076 2076 HOH HOH A . D 4 HOH 77 2077 2077 HOH HOH A . D 4 HOH 78 2078 2078 HOH HOH A . D 4 HOH 79 2079 2079 HOH HOH A . D 4 HOH 80 2080 2080 HOH HOH A . D 4 HOH 81 2081 2081 HOH HOH A . D 4 HOH 82 2082 2082 HOH HOH A . D 4 HOH 83 2083 2083 HOH HOH A . D 4 HOH 84 2084 2084 HOH HOH A . D 4 HOH 85 2085 2085 HOH HOH A . D 4 HOH 86 2086 2086 HOH HOH A . D 4 HOH 87 2087 2087 HOH HOH A . D 4 HOH 88 2088 2088 HOH HOH A . D 4 HOH 89 2089 2089 HOH HOH A . D 4 HOH 90 2090 2090 HOH HOH A . D 4 HOH 91 2091 2091 HOH HOH A . D 4 HOH 92 2092 2092 HOH HOH A . D 4 HOH 93 2093 2093 HOH HOH A . D 4 HOH 94 2094 2094 HOH HOH A . D 4 HOH 95 2095 2095 HOH HOH A . D 4 HOH 96 2096 2096 HOH HOH A . D 4 HOH 97 2097 2097 HOH HOH A . D 4 HOH 98 2098 2098 HOH HOH A . E 4 HOH 1 2001 2001 HOH HOH B . E 4 HOH 2 2002 2002 HOH HOH B . E 4 HOH 3 2003 2003 HOH HOH B . E 4 HOH 4 2004 2004 HOH HOH B . E 4 HOH 5 2005 2005 HOH HOH B . E 4 HOH 6 2006 2006 HOH HOH B . E 4 HOH 7 2007 2007 HOH HOH B . E 4 HOH 8 2008 2008 HOH HOH B . E 4 HOH 9 2009 2009 HOH HOH B . E 4 HOH 10 2010 2010 HOH HOH B . E 4 HOH 11 2011 2011 HOH HOH B . E 4 HOH 12 2012 2012 HOH HOH B . E 4 HOH 13 2013 2013 HOH HOH B . E 4 HOH 14 2014 2014 HOH HOH B . E 4 HOH 15 2015 2015 HOH HOH B . E 4 HOH 16 2016 2016 HOH HOH B . E 4 HOH 17 2017 2017 HOH HOH B . E 4 HOH 18 2018 2018 HOH HOH B . E 4 HOH 19 2019 2019 HOH HOH B . E 4 HOH 20 2020 2020 HOH HOH B . E 4 HOH 21 2021 2021 HOH HOH B . E 4 HOH 22 2022 2022 HOH HOH B . E 4 HOH 23 2023 2023 HOH HOH B . E 4 HOH 24 2024 2024 HOH HOH B . E 4 HOH 25 2025 2025 HOH HOH B . E 4 HOH 26 2026 2026 HOH HOH B . E 4 HOH 27 2027 2027 HOH HOH B . E 4 HOH 28 2028 2028 HOH HOH B . E 4 HOH 29 2029 2029 HOH HOH B . E 4 HOH 30 2030 2030 HOH HOH B . E 4 HOH 31 2031 2031 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1350 ? 1 MORE -25.9 ? 1 'SSA (A^2)' 6640 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 74 ? A HIS 104 ? 3_554 ZN ? C ZN . ? B ZN 1009 ? 1_555 OE1 ? A GLU 25 ? A GLU 55 ? 3_554 114.9 ? 2 NE2 ? A HIS 74 ? A HIS 104 ? 3_554 ZN ? C ZN . ? B ZN 1009 ? 1_555 ND1 ? A HIS 93 ? A HIS 123 ? 1_555 103.7 ? 3 OE1 ? A GLU 25 ? A GLU 55 ? 3_554 ZN ? C ZN . ? B ZN 1009 ? 1_555 ND1 ? A HIS 93 ? A HIS 123 ? 1_555 106.0 ? 4 NE2 ? A HIS 74 ? A HIS 104 ? 3_554 ZN ? C ZN . ? B ZN 1009 ? 1_555 N3 ? B C 6 ? B C 6 ? 1_555 113.9 ? 5 OE1 ? A GLU 25 ? A GLU 55 ? 3_554 ZN ? C ZN . ? B ZN 1009 ? 1_555 N3 ? B C 6 ? B C 6 ? 1_555 97.0 ? 6 ND1 ? A HIS 93 ? A HIS 123 ? 1_555 ZN ? C ZN . ? B ZN 1009 ? 1_555 N3 ? B C 6 ? B C 6 ? 1_555 121.6 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-10-05 2 'Structure model' 1 1 2011-11-02 3 'Structure model' 1 2 2011-11-23 4 'Structure model' 1 3 2018-06-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' citation_author 3 4 'Structure model' diffrn_radiation 4 4 'Structure model' diffrn_source # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_abbrev' 2 4 'Structure model' '_citation.journal_id_ISSN' 3 4 'Structure model' '_citation.page_last' 4 4 'Structure model' '_citation.pdbx_database_id_DOI' 5 4 'Structure model' '_citation.title' 6 4 'Structure model' '_diffrn_radiation.pdbx_diffrn_protocol' 7 4 'Structure model' '_diffrn_source.pdbx_wavelength_list' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal _software.date _software.type _software.location _software.language REFMAC refinement 5.5.0102 ? 1 ? ? ? ? MOSFLM 'data reduction' . ? 2 ? ? ? ? SCALA 'data scaling' . ? 3 ? ? ? ? SHELX phasing . ? 4 ? ? ? ? # _pdbx_entry_details.entry_id 2XS2 _pdbx_entry_details.compound_details 'ENGINEERED RESIDUE IN CHAIN A, CYS 120 TO SER' _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id A _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 2040 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.40 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LEU 32 ? CG ? A LEU 2 CG 2 1 Y 1 A LEU 32 ? CD1 ? A LEU 2 CD1 3 1 Y 1 A LEU 32 ? CD2 ? A LEU 2 CD2 4 1 Y 1 A GLU 34 ? CG ? A GLU 4 CG 5 1 Y 1 A GLU 34 ? CD ? A GLU 4 CD 6 1 Y 1 A GLU 34 ? OE1 ? A GLU 4 OE1 7 1 Y 1 A GLU 34 ? OE2 ? A GLU 4 OE2 8 1 Y 1 A LYS 36 ? CG ? A LYS 6 CG 9 1 Y 1 A LYS 36 ? CD ? A LYS 6 CD 10 1 Y 1 A LYS 36 ? CE ? A LYS 6 CE 11 1 Y 1 A LYS 36 ? NZ ? A LYS 6 NZ 12 1 Y 1 A GLN 117 ? CG ? A GLN 87 CG 13 1 Y 1 A GLN 117 ? CD ? A GLN 87 CD 14 1 Y 1 A GLN 117 ? OE1 ? A GLN 87 OE1 15 1 Y 1 A GLN 117 ? NE2 ? A GLN 87 NE2 16 1 Y 1 A VAL 124 ? CA ? A VAL 94 CA 17 1 Y 1 A VAL 124 ? C ? A VAL 94 C 18 1 Y 1 A VAL 124 ? O ? A VAL 94 O 19 1 Y 1 A VAL 124 ? CB ? A VAL 94 CB 20 1 Y 1 A VAL 124 ? CG1 ? A VAL 94 CG1 21 1 Y 1 A VAL 124 ? CG2 ? A VAL 94 CG2 22 1 Y 1 B U 2 ? P ? B U 2 P 23 1 Y 1 B U 2 ? OP1 ? B U 2 OP1 24 1 Y 1 B U 2 ? OP2 ? B U 2 OP2 25 1 Y 1 B U 2 ? "O5'" ? B U 2 "O5'" 26 1 Y 1 B U 2 ? "C5'" ? B U 2 "C5'" 27 1 Y 1 B U 2 ? "C4'" ? B U 2 "C4'" 28 1 Y 1 B U 2 ? "O4'" ? B U 2 "O4'" 29 1 Y 1 B U 2 ? "C3'" ? B U 2 "C3'" 30 1 Y 1 B U 2 ? "C2'" ? B U 2 "C2'" 31 1 Y 1 B U 2 ? "O2'" ? B U 2 "O2'" 32 1 Y 1 B U 2 ? "C1'" ? B U 2 "C1'" 33 1 Y 1 B U 2 ? N1 ? B U 2 N1 34 1 Y 1 B U 2 ? C2 ? B U 2 C2 35 1 Y 1 B U 2 ? O2 ? B U 2 O2 36 1 Y 1 B U 2 ? N3 ? B U 2 N3 37 1 Y 1 B U 2 ? C4 ? B U 2 C4 38 1 Y 1 B U 2 ? O4 ? B U 2 O4 39 1 Y 1 B U 2 ? C5 ? B U 2 C5 40 1 Y 1 B U 2 ? C6 ? B U 2 C6 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 31 ? A SER 1 2 1 Y 1 A ASN 118 ? A ASN 88 3 1 Y 1 A LEU 119 ? A LEU 89 4 1 Y 1 A SER 120 ? A SER 90 5 1 Y 1 A THR 121 ? A THR 91 6 1 Y 1 A TYR 122 ? A TYR 92 7 1 Y 1 A GLN 125 ? A GLN 95 8 1 Y 1 A PRO 126 ? A PRO 96 9 1 Y 1 A ARG 127 ? A ARG 97 10 1 Y 1 A PRO 128 ? A PRO 98 11 1 Y 1 A LEU 129 ? A LEU 99 12 1 Y 1 A ILE 130 ? A ILE 100 13 1 Y 1 A PHE 131 ? A PHE 101 14 1 Y 1 A ASN 132 ? A ASN 102 15 1 Y 1 B U 1 ? B U 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'ZINC ION' ZN 4 water HOH #