data_2Y0O # _entry.id 2Y0O # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2Y0O PDBE EBI-46571 WWPDB D_1290046571 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2Y0O _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2010-12-07 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Marles-Wright, J.' 1 'Lewis, R.J.' 2 # _citation.id primary _citation.title 'The Structure of a D-Lyxose Isomerase from the Sigmab Regulon of Bacillus Subtilis' _citation.journal_abbrev Proteins _citation.journal_volume 79 _citation.page_first 2015 _citation.page_last ? _citation.year 2011 _citation.journal_id_ASTM PSFGEY _citation.country US _citation.journal_id_ISSN 0887-3585 _citation.journal_id_CSD 0867 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 21520290 _citation.pdbx_database_id_DOI 10.1002/PROT.23028 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Marles-Wright, J.' 1 primary 'Lewis, R.J.' 2 # _cell.entry_id 2Y0O _cell.length_a 74.716 _cell.length_b 42.619 _cell.length_c 65.881 _cell.angle_alpha 90.00 _cell.angle_beta 121.30 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2Y0O _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROBABLE D-LYXOSE KETOL-ISOMERASE' 20487.422 1 5.3.1.15 ? ? 'ZINC AND ARSENIC COORDINATION IN ACTIVE SITE' 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 4 non-polymer syn ARSENIC 74.922 1 ? ? ? ? 5 water nat water 18.015 268 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GITKEEVNSYYQKAGIVLTDEEVDQIQL(MSE)DYGLGKERKVGLQLFVYVNTDRYCSKELVLFPGQTCPEHRHP PVDGQEGKQETFRCRYGKVYLYVEGEKTPLPKVLPPQEDREHYTVWHEIELEPGGQYTIPPNTKHWFQAGEEGAVVTE (MSE)SSTSTDKHDIFTDPRILEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLFVYVNTDRYCSKELVLFPGQTCPEHRHPPVDGQEGK QETFRCRYGKVYLYVEGEKTPLPKVLPPQEDREHYTVWHEIELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHD IFTDPRILEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 ILE n 1 4 THR n 1 5 LYS n 1 6 GLU n 1 7 GLU n 1 8 VAL n 1 9 ASN n 1 10 SER n 1 11 TYR n 1 12 TYR n 1 13 GLN n 1 14 LYS n 1 15 ALA n 1 16 GLY n 1 17 ILE n 1 18 VAL n 1 19 LEU n 1 20 THR n 1 21 ASP n 1 22 GLU n 1 23 GLU n 1 24 VAL n 1 25 ASP n 1 26 GLN n 1 27 ILE n 1 28 GLN n 1 29 LEU n 1 30 MSE n 1 31 ASP n 1 32 TYR n 1 33 GLY n 1 34 LEU n 1 35 GLY n 1 36 LYS n 1 37 GLU n 1 38 ARG n 1 39 LYS n 1 40 VAL n 1 41 GLY n 1 42 LEU n 1 43 GLN n 1 44 LEU n 1 45 PHE n 1 46 VAL n 1 47 TYR n 1 48 VAL n 1 49 ASN n 1 50 THR n 1 51 ASP n 1 52 ARG n 1 53 TYR n 1 54 CYS n 1 55 SER n 1 56 LYS n 1 57 GLU n 1 58 LEU n 1 59 VAL n 1 60 LEU n 1 61 PHE n 1 62 PRO n 1 63 GLY n 1 64 GLN n 1 65 THR n 1 66 CYS n 1 67 PRO n 1 68 GLU n 1 69 HIS n 1 70 ARG n 1 71 HIS n 1 72 PRO n 1 73 PRO n 1 74 VAL n 1 75 ASP n 1 76 GLY n 1 77 GLN n 1 78 GLU n 1 79 GLY n 1 80 LYS n 1 81 GLN n 1 82 GLU n 1 83 THR n 1 84 PHE n 1 85 ARG n 1 86 CYS n 1 87 ARG n 1 88 TYR n 1 89 GLY n 1 90 LYS n 1 91 VAL n 1 92 TYR n 1 93 LEU n 1 94 TYR n 1 95 VAL n 1 96 GLU n 1 97 GLY n 1 98 GLU n 1 99 LYS n 1 100 THR n 1 101 PRO n 1 102 LEU n 1 103 PRO n 1 104 LYS n 1 105 VAL n 1 106 LEU n 1 107 PRO n 1 108 PRO n 1 109 GLN n 1 110 GLU n 1 111 ASP n 1 112 ARG n 1 113 GLU n 1 114 HIS n 1 115 TYR n 1 116 THR n 1 117 VAL n 1 118 TRP n 1 119 HIS n 1 120 GLU n 1 121 ILE n 1 122 GLU n 1 123 LEU n 1 124 GLU n 1 125 PRO n 1 126 GLY n 1 127 GLY n 1 128 GLN n 1 129 TYR n 1 130 THR n 1 131 ILE n 1 132 PRO n 1 133 PRO n 1 134 ASN n 1 135 THR n 1 136 LYS n 1 137 HIS n 1 138 TRP n 1 139 PHE n 1 140 GLN n 1 141 ALA n 1 142 GLY n 1 143 GLU n 1 144 GLU n 1 145 GLY n 1 146 ALA n 1 147 VAL n 1 148 VAL n 1 149 THR n 1 150 GLU n 1 151 MSE n 1 152 SER n 1 153 SER n 1 154 THR n 1 155 SER n 1 156 THR n 1 157 ASP n 1 158 LYS n 1 159 HIS n 1 160 ASP n 1 161 ILE n 1 162 PHE n 1 163 THR n 1 164 ASP n 1 165 PRO n 1 166 ARG n 1 167 ILE n 1 168 LEU n 1 169 GLU n 1 170 HIS n 1 171 HIS n 1 172 HIS n 1 173 HIS n 1 174 HIS n 1 175 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 168 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'BACILLUS SUBTILIS SUBSP. SUBTILIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain B834 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PET28B _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DLYKI_BACSU _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession P96578 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2Y0O _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 167 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P96578 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 167 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 167 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2Y0O LEU A 168 ? UNP P96578 ? ? 'expression tag' 168 1 1 2Y0O GLU A 169 ? UNP P96578 ? ? 'expression tag' 169 2 1 2Y0O HIS A 170 ? UNP P96578 ? ? 'expression tag' 170 3 1 2Y0O HIS A 171 ? UNP P96578 ? ? 'expression tag' 171 4 1 2Y0O HIS A 172 ? UNP P96578 ? ? 'expression tag' 172 5 1 2Y0O HIS A 173 ? UNP P96578 ? ? 'expression tag' 173 6 1 2Y0O HIS A 174 ? UNP P96578 ? ? 'expression tag' 174 7 1 2Y0O HIS A 175 ? UNP P96578 ? ? 'expression tag' 175 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ARS non-polymer . ARSENIC ? As 74.922 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 2Y0O _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.21 _exptl_crystal.density_percent_sol 44.4 _exptl_crystal.description NONE # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '0.1 M SODIUM CACODYLATE PH 6.5 0.2 M NACL 2.0 M AMMONIUM SULFATE 1UL:1UL DROPS WITH PROTEIN IN WATER AT 11.5 MG/ML' # _diffrn.id 1 _diffrn.ambient_temp 93 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC CCD' _diffrn_detector.pdbx_collection_date 2010-04-24 _diffrn_detector.details MIRRORS # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9793 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.pdbx_synchrotron_site ESRF _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_wavelength 0.9793 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 2Y0O _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 35.45 _reflns.d_resolution_high 1.23 _reflns.number_obs 51297 _reflns.number_all ? _reflns.percent_possible_obs 99.4 _reflns.pdbx_Rmerge_I_obs 0.08 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 13.80 _reflns.B_iso_Wilson_estimate 12.90 _reflns.pdbx_redundancy 8.9 # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 1.23 _reflns_shell.d_res_low 1.30 _reflns_shell.percent_possible_all 98.9 _reflns_shell.Rmerge_I_obs 0.37 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 2.60 _reflns_shell.pdbx_redundancy 2.6 # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 2Y0O _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 51279 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 34.872 _refine.ls_d_res_high 1.229 _refine.ls_percent_reflns_obs 99.32 _refine.ls_R_factor_obs 0.1470 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1453 _refine.ls_R_factor_R_free 0.1782 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 2586 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 18.91 _refine.aniso_B[1][1] 5.0148 _refine.aniso_B[2][2] -0.6054 _refine.aniso_B[3][3] -4.4094 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.5039 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.375 _refine.solvent_model_param_bsol 40.657 _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.83 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model NONE _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.17 _refine.pdbx_overall_phase_error 16.14 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1395 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 12 _refine_hist.number_atoms_solvent 268 _refine_hist.number_atoms_total 1675 _refine_hist.d_res_high 1.229 _refine_hist.d_res_low 34.872 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.014 ? ? 1465 'X-RAY DIFFRACTION' ? f_angle_d 1.559 ? ? 1996 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.225 ? ? 557 'X-RAY DIFFRACTION' ? f_chiral_restr 0.107 ? ? 207 'X-RAY DIFFRACTION' ? f_plane_restr 0.008 ? ? 263 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all 'X-RAY DIFFRACTION' . 1.2291 1.2730 4763 0.2724 98.00 0.3101 . . 227 . . 'X-RAY DIFFRACTION' . 1.2730 1.3240 4827 0.2032 99.00 0.2364 . . 251 . . 'X-RAY DIFFRACTION' . 1.3240 1.3843 4832 0.1645 99.00 0.2053 . . 269 . . 'X-RAY DIFFRACTION' . 1.3843 1.4572 4809 0.1402 99.00 0.2015 . . 266 . . 'X-RAY DIFFRACTION' . 1.4572 1.5485 4820 0.1115 99.00 0.1484 . . 280 . . 'X-RAY DIFFRACTION' . 1.5485 1.6681 4900 0.1097 100.00 0.1641 . . 236 . . 'X-RAY DIFFRACTION' . 1.6681 1.8360 4875 0.1156 100.00 0.1684 . . 252 . . 'X-RAY DIFFRACTION' . 1.8360 2.1016 4915 0.1261 100.00 0.1503 . . 261 . . 'X-RAY DIFFRACTION' . 2.1016 2.6477 4949 0.1423 100.00 0.1820 . . 261 . . 'X-RAY DIFFRACTION' . 2.6477 34.8856 5003 0.1557 100.00 0.1776 . . 283 . . # _struct.entry_id 2Y0O _struct.title 'The structure of a D-lyxose isomerase from the sigmaB regulon of Bacillus subtilis' _struct.pdbx_descriptor 'PROBABLE D-LYXOSE KETOL-ISOMERASE (E.C.5.3.1.15)' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2Y0O _struct_keywords.pdbx_keywords ISOMERASE _struct_keywords.text 'ISOMERASE, CARBOHYDRATE METABOLISM, METAL-BINDING, SUGAR ISOMERASE, STRESS RESPONSE' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 4 ? ALA A 15 ? THR A 4 ALA A 15 1 ? 12 HELX_P HELX_P2 2 THR A 20 ? ASP A 25 ? THR A 20 ASP A 25 1 ? 6 HELX_P HELX_P3 3 PRO A 108 ? TYR A 115 ? PRO A 108 TYR A 115 5 ? 8 HELX_P HELX_P4 4 THR A 156 ? ASP A 160 ? THR A 156 ASP A 160 5 ? 5 HELX_P HELX_P5 5 LEU A 168 ? HIS A 172 ? LEU A 168 HIS A 172 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A LEU 29 C ? ? ? 1_555 A MSE 30 N ? ? A LEU 29 A MSE 30 1_555 ? ? ? ? ? ? ? 1.334 ? covale2 covale ? ? A MSE 30 C ? ? ? 1_555 A ASP 31 N ? ? A MSE 30 A ASP 31 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale ? ? A GLU 150 C ? ? ? 1_555 A MSE 151 N ? ? A GLU 150 A MSE 151 1_555 ? ? ? ? ? ? ? 1.319 ? covale4 covale ? ? A MSE 151 C ? ? ? 1_555 A SER 152 N ? ? A MSE 151 A SER 152 1_555 ? ? ? ? ? ? ? 1.333 ? metalc1 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 1173 A HOH 2262 1_555 ? ? ? ? ? ? ? 1.871 ? metalc2 metalc ? ? B ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 1173 A HOH 2263 1_555 ? ? ? ? ? ? ? 2.029 ? metalc3 metalc ? ? B ZN . ZN ? ? ? 1_555 A GLU 82 OE2 ? ? A ZN 1173 A GLU 82 1_555 ? ? ? ? ? ? ? 2.073 ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 137 NE2 ? ? A ZN 1173 A HIS 137 1_555 ? ? ? ? ? ? ? 2.170 ? metalc5 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 71 NE2 ? ? A ZN 1173 A HIS 71 1_555 ? ? ? ? ? ? ? 2.183 ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 A HIS 69 NE2 ? ? A ZN 1173 A HIS 69 1_555 ? ? ? ? ? ? ? 2.408 ? metalc7 metalc ? ? E ARS . AS ? ? ? 1_555 F HOH . O ? ? A ARS 1176 A HOH 2234 1_555 ? ? ? ? ? ? ? 2.204 ? metalc8 metalc ? ? E ARS . AS ? ? ? 1_555 F HOH . O ? ? A ARS 1176 A HOH 2263 1_555 ? ? ? ? ? ? ? 1.975 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA ? 6 ? AB ? 6 ? AC ? 6 ? AD ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA 1 2 ? anti-parallel AA 2 3 ? anti-parallel AA 3 4 ? anti-parallel AA 4 5 ? anti-parallel AA 5 6 ? anti-parallel AB 1 2 ? anti-parallel AB 2 3 ? anti-parallel AB 3 4 ? anti-parallel AB 4 5 ? parallel AB 5 6 ? anti-parallel AC 1 2 ? anti-parallel AC 2 3 ? anti-parallel AC 3 4 ? anti-parallel AC 4 5 ? anti-parallel AC 5 6 ? anti-parallel AD 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA 1 GLN A 28 ? MSE A 30 ? GLN A 28 MSE A 30 AA 2 LEU A 42 ? ASN A 49 ? LEU A 42 ASN A 49 AA 3 TYR A 53 ? LEU A 60 ? TYR A 53 LEU A 60 AA 4 HIS A 137 ? SER A 153 ? HIS A 137 SER A 153 AA 5 GLU A 82 ? VAL A 95 ? GLU A 82 VAL A 95 AA 6 HIS A 119 ? LEU A 123 ? HIS A 119 LEU A 123 AB 1 GLN A 28 ? MSE A 30 ? GLN A 28 MSE A 30 AB 2 LEU A 42 ? ASN A 49 ? LEU A 42 ASN A 49 AB 3 TYR A 53 ? LEU A 60 ? TYR A 53 LEU A 60 AB 4 HIS A 137 ? SER A 153 ? HIS A 137 SER A 153 AB 5 THR A 65 ? ARG A 70 ? THR A 65 ARG A 70 AB 6 ILE A 161 ? PHE A 162 ? ILE A 161 PHE A 162 AC 1 GLN A 28 ? MSE A 30 ? GLN A 28 MSE A 30 AC 2 LEU A 42 ? ASN A 49 ? LEU A 42 ASN A 49 AC 3 TYR A 53 ? LEU A 60 ? TYR A 53 LEU A 60 AC 4 HIS A 137 ? SER A 153 ? HIS A 137 SER A 153 AC 5 GLU A 82 ? VAL A 95 ? GLU A 82 VAL A 95 AC 6 GLN A 128 ? ILE A 131 ? GLN A 128 ILE A 131 AD 1 HIS A 119 ? LEU A 123 ? HIS A 119 LEU A 123 AD 2 GLU A 82 ? VAL A 95 ? GLU A 82 VAL A 95 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA 1 2 N MSE A 30 ? N MSE A 30 O LEU A 42 ? O LEU A 42 AA 2 3 N TYR A 47 ? N TYR A 47 O SER A 55 ? O SER A 55 AA 3 4 N LEU A 60 ? N LEU A 60 O ALA A 146 ? O ALA A 146 AA 4 5 N MSE A 151 ? N MSE A 151 O THR A 83 ? O THR A 83 AA 5 6 N VAL A 95 ? N VAL A 95 O HIS A 119 ? O HIS A 119 AB 1 2 N MSE A 30 ? N MSE A 30 O LEU A 42 ? O LEU A 42 AB 2 3 N TYR A 47 ? N TYR A 47 O SER A 55 ? O SER A 55 AB 3 4 N LEU A 60 ? N LEU A 60 O ALA A 146 ? O ALA A 146 AB 4 5 N PHE A 139 ? N PHE A 139 O CYS A 66 ? O CYS A 66 AB 5 6 N ARG A 70 ? N ARG A 70 O ILE A 161 ? O ILE A 161 AC 1 2 N MSE A 30 ? N MSE A 30 O LEU A 42 ? O LEU A 42 AC 2 3 N TYR A 47 ? N TYR A 47 O SER A 55 ? O SER A 55 AC 3 4 N LEU A 60 ? N LEU A 60 O ALA A 146 ? O ALA A 146 AC 4 5 N MSE A 151 ? N MSE A 151 O THR A 83 ? O THR A 83 AC 5 6 N PHE A 84 ? N PHE A 84 O TYR A 129 ? O TYR A 129 AD 1 2 N LEU A 123 ? N LEU A 123 O VAL A 91 ? O VAL A 91 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE ZN A 1173' AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 1174' AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 A 1175' AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ARS A 1176' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 7 HIS A 69 ? HIS A 69 . ? 1_555 ? 2 AC1 7 HIS A 71 ? HIS A 71 . ? 1_555 ? 3 AC1 7 GLU A 82 ? GLU A 82 . ? 1_555 ? 4 AC1 7 HIS A 137 ? HIS A 137 . ? 1_555 ? 5 AC1 7 ARS E . ? ARS A 1176 . ? 1_555 ? 6 AC1 7 HOH F . ? HOH A 2262 . ? 1_555 ? 7 AC1 7 HOH F . ? HOH A 2263 . ? 1_555 ? 8 AC2 7 LYS A 90 ? LYS A 90 . ? 1_555 ? 9 AC2 7 TYR A 92 ? TYR A 92 . ? 1_555 ? 10 AC2 7 GLY A 142 ? GLY A 142 . ? 1_555 ? 11 AC2 7 GLU A 143 ? GLU A 143 . ? 1_555 ? 12 AC2 7 HOH F . ? HOH A 2264 . ? 1_555 ? 13 AC2 7 HOH F . ? HOH A 2265 . ? 1_555 ? 14 AC2 7 HOH F . ? HOH A 2266 . ? 1_555 ? 15 AC3 6 THR A 50 ? THR A 50 . ? 1_555 ? 16 AC3 6 ASP A 51 ? ASP A 51 . ? 1_555 ? 17 AC3 6 GLN A 81 ? GLN A 81 . ? 2_656 ? 18 AC3 6 HOH F . ? HOH A 2116 . ? 1_555 ? 19 AC3 6 HOH F . ? HOH A 2267 . ? 1_555 ? 20 AC3 6 HOH F . ? HOH A 2268 . ? 1_555 ? 21 AC4 4 GLU A 150 ? GLU A 150 . ? 1_555 ? 22 AC4 4 ZN B . ? ZN A 1173 . ? 1_555 ? 23 AC4 4 HOH F . ? HOH A 2234 . ? 1_555 ? 24 AC4 4 HOH F . ? HOH A 2263 . ? 1_555 ? # _database_PDB_matrix.entry_id 2Y0O _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2Y0O _atom_sites.fract_transf_matrix[1][1] 0.013384 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.008138 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.023464 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017764 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol AS C N O S SE ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLU 7 7 7 GLU GLU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 SER 10 10 10 SER SER A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 THR 20 20 20 THR THR A . n A 1 21 ASP 21 21 21 ASP ASP A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 MSE 30 30 30 MSE MSE A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 LEU 34 34 34 LEU LEU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 VAL 40 40 40 VAL VAL A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 GLN 43 43 43 GLN GLN A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 PHE 45 45 45 PHE PHE A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 TYR 47 47 47 TYR TYR A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASN 49 49 49 ASN ASN A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 CYS 54 54 54 CYS CYS A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLY 63 63 63 GLY GLY A . n A 1 64 GLN 64 64 64 GLN GLN A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 CYS 66 66 66 CYS CYS A . n A 1 67 PRO 67 67 67 PRO PRO A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 GLN 77 77 77 GLN GLN A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 GLN 81 81 81 GLN GLN A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 THR 83 83 83 THR THR A . n A 1 84 PHE 84 84 84 PHE PHE A . n A 1 85 ARG 85 85 85 ARG ARG A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 TYR 88 88 88 TYR TYR A . n A 1 89 GLY 89 89 89 GLY GLY A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 VAL 91 91 91 VAL VAL A . n A 1 92 TYR 92 92 92 TYR TYR A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 VAL 95 95 95 VAL VAL A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 GLU 98 98 98 GLU GLU A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 THR 100 100 100 THR THR A . n A 1 101 PRO 101 101 101 PRO PRO A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 PRO 103 103 103 PRO PRO A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 VAL 105 105 105 VAL VAL A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PRO 107 107 107 PRO PRO A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 HIS 114 114 114 HIS HIS A . n A 1 115 TYR 115 115 115 TYR TYR A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 TRP 118 118 118 TRP TRP A . n A 1 119 HIS 119 119 119 HIS HIS A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 GLU 124 124 124 GLU GLU A . n A 1 125 PRO 125 125 125 PRO PRO A . n A 1 126 GLY 126 126 126 GLY GLY A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 THR 135 135 135 THR THR A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 HIS 137 137 137 HIS HIS A . n A 1 138 TRP 138 138 138 TRP TRP A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 GLN 140 140 140 GLN GLN A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 GLY 145 145 145 GLY GLY A . n A 1 146 ALA 146 146 146 ALA ALA A . n A 1 147 VAL 147 147 147 VAL VAL A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 THR 149 149 149 THR THR A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 MSE 151 151 151 MSE MSE A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 THR 154 154 154 THR THR A . n A 1 155 SER 155 155 155 SER SER A . n A 1 156 THR 156 156 156 THR THR A . n A 1 157 ASP 157 157 157 ASP ASP A . n A 1 158 LYS 158 158 158 LYS LYS A . n A 1 159 HIS 159 159 159 HIS HIS A . n A 1 160 ASP 160 160 160 ASP ASP A . n A 1 161 ILE 161 161 161 ILE ILE A . n A 1 162 PHE 162 162 162 PHE PHE A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 ASP 164 164 164 ASP ASP A . n A 1 165 PRO 165 165 165 PRO PRO A . n A 1 166 ARG 166 166 166 ARG ARG A . n A 1 167 ILE 167 167 167 ILE ILE A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 HIS 171 171 171 HIS HIS A . n A 1 172 HIS 172 172 172 HIS HIS A . n A 1 173 HIS 173 173 ? ? ? A . n A 1 174 HIS 174 174 ? ? ? A . n A 1 175 HIS 175 175 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 1173 1173 ZN ZN A . C 3 SO4 1 1174 1174 SO4 SO4 A . D 3 SO4 1 1175 1175 SO4 SO4 A . E 4 ARS 1 1176 1176 ARS ARS A . F 5 HOH 1 2001 2001 HOH HOH A . F 5 HOH 2 2002 2002 HOH HOH A . F 5 HOH 3 2003 2003 HOH HOH A . F 5 HOH 4 2004 2004 HOH HOH A . F 5 HOH 5 2005 2005 HOH HOH A . F 5 HOH 6 2006 2006 HOH HOH A . F 5 HOH 7 2007 2007 HOH HOH A . F 5 HOH 8 2008 2008 HOH HOH A . F 5 HOH 9 2009 2009 HOH HOH A . F 5 HOH 10 2010 2010 HOH HOH A . F 5 HOH 11 2011 2011 HOH HOH A . F 5 HOH 12 2012 2012 HOH HOH A . F 5 HOH 13 2013 2013 HOH HOH A . F 5 HOH 14 2014 2014 HOH HOH A . F 5 HOH 15 2015 2015 HOH HOH A . F 5 HOH 16 2016 2016 HOH HOH A . F 5 HOH 17 2017 2017 HOH HOH A . F 5 HOH 18 2018 2018 HOH HOH A . F 5 HOH 19 2019 2019 HOH HOH A . F 5 HOH 20 2020 2020 HOH HOH A . F 5 HOH 21 2021 2021 HOH HOH A . F 5 HOH 22 2022 2022 HOH HOH A . F 5 HOH 23 2023 2023 HOH HOH A . F 5 HOH 24 2024 2024 HOH HOH A . F 5 HOH 25 2025 2025 HOH HOH A . F 5 HOH 26 2026 2026 HOH HOH A . F 5 HOH 27 2027 2027 HOH HOH A . F 5 HOH 28 2028 2028 HOH HOH A . F 5 HOH 29 2029 2029 HOH HOH A . F 5 HOH 30 2030 2030 HOH HOH A . F 5 HOH 31 2031 2031 HOH HOH A . F 5 HOH 32 2032 2032 HOH HOH A . F 5 HOH 33 2033 2033 HOH HOH A . F 5 HOH 34 2034 2034 HOH HOH A . F 5 HOH 35 2035 2035 HOH HOH A . F 5 HOH 36 2036 2036 HOH HOH A . F 5 HOH 37 2037 2037 HOH HOH A . F 5 HOH 38 2038 2038 HOH HOH A . F 5 HOH 39 2039 2039 HOH HOH A . F 5 HOH 40 2040 2040 HOH HOH A . F 5 HOH 41 2041 2041 HOH HOH A . F 5 HOH 42 2042 2042 HOH HOH A . F 5 HOH 43 2043 2043 HOH HOH A . F 5 HOH 44 2044 2044 HOH HOH A . F 5 HOH 45 2045 2045 HOH HOH A . F 5 HOH 46 2046 2046 HOH HOH A . F 5 HOH 47 2047 2047 HOH HOH A . F 5 HOH 48 2048 2048 HOH HOH A . F 5 HOH 49 2049 2049 HOH HOH A . F 5 HOH 50 2050 2050 HOH HOH A . F 5 HOH 51 2051 2051 HOH HOH A . F 5 HOH 52 2052 2052 HOH HOH A . F 5 HOH 53 2053 2053 HOH HOH A . F 5 HOH 54 2054 2054 HOH HOH A . F 5 HOH 55 2055 2055 HOH HOH A . F 5 HOH 56 2056 2056 HOH HOH A . F 5 HOH 57 2057 2057 HOH HOH A . F 5 HOH 58 2058 2058 HOH HOH A . F 5 HOH 59 2059 2059 HOH HOH A . F 5 HOH 60 2060 2060 HOH HOH A . F 5 HOH 61 2061 2061 HOH HOH A . F 5 HOH 62 2062 2062 HOH HOH A . F 5 HOH 63 2063 2063 HOH HOH A . F 5 HOH 64 2064 2064 HOH HOH A . F 5 HOH 65 2065 2065 HOH HOH A . F 5 HOH 66 2066 2066 HOH HOH A . F 5 HOH 67 2067 2067 HOH HOH A . F 5 HOH 68 2068 2068 HOH HOH A . F 5 HOH 69 2069 2069 HOH HOH A . F 5 HOH 70 2070 2070 HOH HOH A . F 5 HOH 71 2071 2071 HOH HOH A . F 5 HOH 72 2072 2072 HOH HOH A . F 5 HOH 73 2073 2073 HOH HOH A . F 5 HOH 74 2074 2074 HOH HOH A . F 5 HOH 75 2075 2075 HOH HOH A . F 5 HOH 76 2076 2076 HOH HOH A . F 5 HOH 77 2077 2077 HOH HOH A . F 5 HOH 78 2078 2078 HOH HOH A . F 5 HOH 79 2079 2079 HOH HOH A . F 5 HOH 80 2080 2080 HOH HOH A . F 5 HOH 81 2081 2081 HOH HOH A . F 5 HOH 82 2082 2082 HOH HOH A . F 5 HOH 83 2083 2083 HOH HOH A . F 5 HOH 84 2084 2084 HOH HOH A . F 5 HOH 85 2085 2085 HOH HOH A . F 5 HOH 86 2086 2086 HOH HOH A . F 5 HOH 87 2087 2087 HOH HOH A . F 5 HOH 88 2088 2088 HOH HOH A . F 5 HOH 89 2089 2089 HOH HOH A . F 5 HOH 90 2090 2090 HOH HOH A . F 5 HOH 91 2091 2091 HOH HOH A . F 5 HOH 92 2092 2092 HOH HOH A . F 5 HOH 93 2093 2093 HOH HOH A . F 5 HOH 94 2094 2094 HOH HOH A . F 5 HOH 95 2095 2095 HOH HOH A . F 5 HOH 96 2096 2096 HOH HOH A . F 5 HOH 97 2097 2097 HOH HOH A . F 5 HOH 98 2098 2098 HOH HOH A . F 5 HOH 99 2099 2099 HOH HOH A . F 5 HOH 100 2100 2100 HOH HOH A . F 5 HOH 101 2101 2101 HOH HOH A . F 5 HOH 102 2102 2102 HOH HOH A . F 5 HOH 103 2103 2103 HOH HOH A . F 5 HOH 104 2104 2104 HOH HOH A . F 5 HOH 105 2105 2105 HOH HOH A . F 5 HOH 106 2106 2106 HOH HOH A . F 5 HOH 107 2107 2107 HOH HOH A . F 5 HOH 108 2108 2108 HOH HOH A . F 5 HOH 109 2109 2109 HOH HOH A . F 5 HOH 110 2110 2110 HOH HOH A . F 5 HOH 111 2111 2111 HOH HOH A . F 5 HOH 112 2112 2112 HOH HOH A . F 5 HOH 113 2113 2113 HOH HOH A . F 5 HOH 114 2114 2114 HOH HOH A . F 5 HOH 115 2115 2115 HOH HOH A . F 5 HOH 116 2116 2116 HOH HOH A . F 5 HOH 117 2117 2117 HOH HOH A . F 5 HOH 118 2118 2118 HOH HOH A . F 5 HOH 119 2119 2119 HOH HOH A . F 5 HOH 120 2120 2120 HOH HOH A . F 5 HOH 121 2121 2121 HOH HOH A . F 5 HOH 122 2122 2122 HOH HOH A . F 5 HOH 123 2123 2123 HOH HOH A . F 5 HOH 124 2124 2124 HOH HOH A . F 5 HOH 125 2125 2125 HOH HOH A . F 5 HOH 126 2126 2126 HOH HOH A . F 5 HOH 127 2127 2127 HOH HOH A . F 5 HOH 128 2128 2128 HOH HOH A . F 5 HOH 129 2129 2129 HOH HOH A . F 5 HOH 130 2130 2130 HOH HOH A . F 5 HOH 131 2131 2131 HOH HOH A . F 5 HOH 132 2132 2132 HOH HOH A . F 5 HOH 133 2133 2133 HOH HOH A . F 5 HOH 134 2134 2134 HOH HOH A . F 5 HOH 135 2135 2135 HOH HOH A . F 5 HOH 136 2136 2136 HOH HOH A . F 5 HOH 137 2137 2137 HOH HOH A . F 5 HOH 138 2138 2138 HOH HOH A . F 5 HOH 139 2139 2139 HOH HOH A . F 5 HOH 140 2140 2140 HOH HOH A . F 5 HOH 141 2141 2141 HOH HOH A . F 5 HOH 142 2142 2142 HOH HOH A . F 5 HOH 143 2143 2143 HOH HOH A . F 5 HOH 144 2144 2144 HOH HOH A . F 5 HOH 145 2145 2145 HOH HOH A . F 5 HOH 146 2146 2146 HOH HOH A . F 5 HOH 147 2147 2147 HOH HOH A . F 5 HOH 148 2148 2148 HOH HOH A . F 5 HOH 149 2149 2149 HOH HOH A . F 5 HOH 150 2150 2150 HOH HOH A . F 5 HOH 151 2151 2151 HOH HOH A . F 5 HOH 152 2152 2152 HOH HOH A . F 5 HOH 153 2153 2153 HOH HOH A . F 5 HOH 154 2154 2154 HOH HOH A . F 5 HOH 155 2155 2155 HOH HOH A . F 5 HOH 156 2156 2156 HOH HOH A . F 5 HOH 157 2157 2157 HOH HOH A . F 5 HOH 158 2158 2158 HOH HOH A . F 5 HOH 159 2159 2159 HOH HOH A . F 5 HOH 160 2160 2160 HOH HOH A . F 5 HOH 161 2161 2161 HOH HOH A . F 5 HOH 162 2162 2162 HOH HOH A . F 5 HOH 163 2163 2163 HOH HOH A . F 5 HOH 164 2164 2164 HOH HOH A . F 5 HOH 165 2165 2165 HOH HOH A . F 5 HOH 166 2166 2166 HOH HOH A . F 5 HOH 167 2167 2167 HOH HOH A . F 5 HOH 168 2168 2168 HOH HOH A . F 5 HOH 169 2169 2169 HOH HOH A . F 5 HOH 170 2170 2170 HOH HOH A . F 5 HOH 171 2171 2171 HOH HOH A . F 5 HOH 172 2172 2172 HOH HOH A . F 5 HOH 173 2173 2173 HOH HOH A . F 5 HOH 174 2174 2174 HOH HOH A . F 5 HOH 175 2175 2175 HOH HOH A . F 5 HOH 176 2176 2176 HOH HOH A . F 5 HOH 177 2177 2177 HOH HOH A . F 5 HOH 178 2178 2178 HOH HOH A . F 5 HOH 179 2179 2179 HOH HOH A . F 5 HOH 180 2180 2180 HOH HOH A . F 5 HOH 181 2181 2181 HOH HOH A . F 5 HOH 182 2182 2182 HOH HOH A . F 5 HOH 183 2183 2183 HOH HOH A . F 5 HOH 184 2184 2184 HOH HOH A . F 5 HOH 185 2185 2185 HOH HOH A . F 5 HOH 186 2186 2186 HOH HOH A . F 5 HOH 187 2187 2187 HOH HOH A . F 5 HOH 188 2188 2188 HOH HOH A . F 5 HOH 189 2189 2189 HOH HOH A . F 5 HOH 190 2190 2190 HOH HOH A . F 5 HOH 191 2191 2191 HOH HOH A . F 5 HOH 192 2192 2192 HOH HOH A . F 5 HOH 193 2193 2193 HOH HOH A . F 5 HOH 194 2194 2194 HOH HOH A . F 5 HOH 195 2195 2195 HOH HOH A . F 5 HOH 196 2196 2196 HOH HOH A . F 5 HOH 197 2197 2197 HOH HOH A . F 5 HOH 198 2198 2198 HOH HOH A . F 5 HOH 199 2199 2199 HOH HOH A . F 5 HOH 200 2200 2200 HOH HOH A . F 5 HOH 201 2201 2201 HOH HOH A . F 5 HOH 202 2202 2202 HOH HOH A . F 5 HOH 203 2203 2203 HOH HOH A . F 5 HOH 204 2204 2204 HOH HOH A . F 5 HOH 205 2205 2205 HOH HOH A . F 5 HOH 206 2206 2206 HOH HOH A . F 5 HOH 207 2207 2207 HOH HOH A . F 5 HOH 208 2208 2208 HOH HOH A . F 5 HOH 209 2209 2209 HOH HOH A . F 5 HOH 210 2210 2210 HOH HOH A . F 5 HOH 211 2211 2211 HOH HOH A . F 5 HOH 212 2212 2212 HOH HOH A . F 5 HOH 213 2213 2213 HOH HOH A . F 5 HOH 214 2214 2214 HOH HOH A . F 5 HOH 215 2215 2215 HOH HOH A . F 5 HOH 216 2216 2216 HOH HOH A . F 5 HOH 217 2217 2217 HOH HOH A . F 5 HOH 218 2218 2218 HOH HOH A . F 5 HOH 219 2219 2219 HOH HOH A . F 5 HOH 220 2220 2220 HOH HOH A . F 5 HOH 221 2221 2221 HOH HOH A . F 5 HOH 222 2222 2222 HOH HOH A . F 5 HOH 223 2223 2223 HOH HOH A . F 5 HOH 224 2224 2224 HOH HOH A . F 5 HOH 225 2225 2225 HOH HOH A . F 5 HOH 226 2226 2226 HOH HOH A . F 5 HOH 227 2227 2227 HOH HOH A . F 5 HOH 228 2228 2228 HOH HOH A . F 5 HOH 229 2229 2229 HOH HOH A . F 5 HOH 230 2230 2230 HOH HOH A . F 5 HOH 231 2231 2231 HOH HOH A . F 5 HOH 232 2232 2232 HOH HOH A . F 5 HOH 233 2233 2233 HOH HOH A . F 5 HOH 234 2234 2234 HOH HOH A . F 5 HOH 235 2235 2235 HOH HOH A . F 5 HOH 236 2236 2236 HOH HOH A . F 5 HOH 237 2237 2237 HOH HOH A . F 5 HOH 238 2238 2238 HOH HOH A . F 5 HOH 239 2239 2239 HOH HOH A . F 5 HOH 240 2240 2240 HOH HOH A . F 5 HOH 241 2241 2241 HOH HOH A . F 5 HOH 242 2242 2242 HOH HOH A . F 5 HOH 243 2243 2243 HOH HOH A . F 5 HOH 244 2244 2244 HOH HOH A . F 5 HOH 245 2245 2245 HOH HOH A . F 5 HOH 246 2246 2246 HOH HOH A . F 5 HOH 247 2247 2247 HOH HOH A . F 5 HOH 248 2248 2248 HOH HOH A . F 5 HOH 249 2249 2249 HOH HOH A . F 5 HOH 250 2250 2250 HOH HOH A . F 5 HOH 251 2251 2251 HOH HOH A . F 5 HOH 252 2252 2252 HOH HOH A . F 5 HOH 253 2253 2253 HOH HOH A . F 5 HOH 254 2254 2254 HOH HOH A . F 5 HOH 255 2255 2255 HOH HOH A . F 5 HOH 256 2256 2256 HOH HOH A . F 5 HOH 257 2257 2257 HOH HOH A . F 5 HOH 258 2258 2258 HOH HOH A . F 5 HOH 259 2259 2259 HOH HOH A . F 5 HOH 260 2260 2260 HOH HOH A . F 5 HOH 261 2261 2261 HOH HOH A . F 5 HOH 262 2262 2262 HOH HOH A . F 5 HOH 263 2263 2263 HOH HOH A . F 5 HOH 264 2264 2264 HOH HOH A . F 5 HOH 265 2265 2265 HOH HOH A . F 5 HOH 266 2266 2266 HOH HOH A . F 5 HOH 267 2267 2267 HOH HOH A . F 5 HOH 268 2268 2268 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 30 A MSE 30 ? MET SELENOMETHIONINE 2 A MSE 151 A MSE 151 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3540 ? 1 MORE -132.8 ? 1 'SSA (A^2)' 14600 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 40.4895613903 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 56.2926021880 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 2042 ? F HOH . 2 1 A HOH 2051 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? F HOH . ? A HOH 2262 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 O ? F HOH . ? A HOH 2263 ? 1_555 83.4 ? 2 O ? F HOH . ? A HOH 2262 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 OE2 ? A GLU 82 ? A GLU 82 ? 1_555 90.7 ? 3 O ? F HOH . ? A HOH 2263 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 OE2 ? A GLU 82 ? A GLU 82 ? 1_555 84.1 ? 4 O ? F HOH . ? A HOH 2262 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 137 ? A HIS 137 ? 1_555 93.4 ? 5 O ? F HOH . ? A HOH 2263 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 137 ? A HIS 137 ? 1_555 172.6 ? 6 OE2 ? A GLU 82 ? A GLU 82 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 137 ? A HIS 137 ? 1_555 89.2 ? 7 O ? F HOH . ? A HOH 2262 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 71 ? A HIS 71 ? 1_555 162.0 ? 8 O ? F HOH . ? A HOH 2263 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 71 ? A HIS 71 ? 1_555 78.6 ? 9 OE2 ? A GLU 82 ? A GLU 82 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 71 ? A HIS 71 ? 1_555 87.4 ? 10 NE2 ? A HIS 137 ? A HIS 137 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 71 ? A HIS 71 ? 1_555 104.5 ? 11 O ? F HOH . ? A HOH 2262 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 88.8 ? 12 O ? F HOH . ? A HOH 2263 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 103.5 ? 13 OE2 ? A GLU 82 ? A GLU 82 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 172.2 ? 14 NE2 ? A HIS 137 ? A HIS 137 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 83.1 ? 15 NE2 ? A HIS 71 ? A HIS 71 ? 1_555 ZN ? B ZN . ? A ZN 1173 ? 1_555 NE2 ? A HIS 69 ? A HIS 69 ? 1_555 95.4 ? 16 O ? F HOH . ? A HOH 2234 ? 1_555 AS ? E ARS . ? A ARS 1176 ? 1_555 O ? F HOH . ? A HOH 2263 ? 1_555 95.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2011-05-25 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal PHENIX refinement '(PHENIX.REFINE)' ? 1 MOSFLM 'data reduction' . ? 2 SCALA 'data scaling' . ? 3 SOLVE phasing . ? 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE1 A GLN 81 ? ? O A HOH 2147 ? ? 1.78 2 1 OE2 A GLU 82 ? ? O A HOH 2149 ? ? 2.10 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id TRP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 118 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -145.53 _pdbx_validate_torsion.psi 15.22 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 2007 ? 6.59 . 2 1 O ? A HOH 2038 ? 6.91 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A HIS 173 ? A HIS 173 3 1 Y 1 A HIS 174 ? A HIS 174 4 1 Y 1 A HIS 175 ? A HIS 175 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'SULFATE ION' SO4 4 ARSENIC ARS 5 water HOH #