data_2YMJ # _entry.id 2YMJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.371 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YMJ pdb_00002ymj 10.2210/pdb2ymj/pdb PDBE EBI-54399 ? ? WWPDB D_1290054399 ? ? BMRB 18782 ? ? # _pdbx_database_related.db_id 18782 _pdbx_database_related.details . _pdbx_database_related.db_name BMRB _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YMJ _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.SG_entry . _pdbx_database_status.recvd_initial_deposition_date 2012-10-09 _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.status_code_cs REL _pdbx_database_status.status_code_nmr_data REL # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ali, M.' 1 'Broadhurst, R.W.' 2 # _citation.id primary _citation.title 'Solution Structure of the Qua1 Dimerization Domain of Pxqua, the Xenopus Ortholog of Quaking.' _citation.journal_abbrev 'Plos One' _citation.journal_volume 8 _citation.page_first 57345 _citation.page_last ? _citation.year 2013 _citation.journal_id_ASTM ? _citation.country US _citation.journal_id_ISSN 1932-6203 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23520467 _citation.pdbx_database_id_DOI 10.1371/JOURNAL.PONE.0057345 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ali, M.' 1 ? primary 'Broadhurst, R.W.' 2 ? # _cell.entry_id 2YMJ _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 2YMJ _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'PROTEIN QUAKING-A' _entity.formula_weight 6139.150 _entity.pdbx_number_of_molecules 2 _entity.pdbx_ec ? _entity.pdbx_mutation YES _entity.pdbx_fragment 'QUA1 DOMAIN, RESIDUES 8-57' _entity.details 'CONTAINS AN EXTRA GS CLONING ARTEFACT AT THE N-TERMINUS' # _entity_name_com.entity_id 1 _entity_name_com.name 'PXQUA, XQUA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSKEKPKPTPDYLMQLMNDKKLMSSLPNFSGIFTHLERLLDEEISRVRKDMY _entity_poly.pdbx_seq_one_letter_code_can GSKEKPKPTPDYLMQLMNDKKLMSSLPNFSGIFTHLERLLDEEISRVRKDMY _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LYS n 1 4 GLU n 1 5 LYS n 1 6 PRO n 1 7 LYS n 1 8 PRO n 1 9 THR n 1 10 PRO n 1 11 ASP n 1 12 TYR n 1 13 LEU n 1 14 MET n 1 15 GLN n 1 16 LEU n 1 17 MET n 1 18 ASN n 1 19 ASP n 1 20 LYS n 1 21 LYS n 1 22 LEU n 1 23 MET n 1 24 SER n 1 25 SER n 1 26 LEU n 1 27 PRO n 1 28 ASN n 1 29 PHE n 1 30 SER n 1 31 GLY n 1 32 ILE n 1 33 PHE n 1 34 THR n 1 35 HIS n 1 36 LEU n 1 37 GLU n 1 38 ARG n 1 39 LEU n 1 40 LEU n 1 41 ASP n 1 42 GLU n 1 43 GLU n 1 44 ILE n 1 45 SER n 1 46 ARG n 1 47 VAL n 1 48 ARG n 1 49 LYS n 1 50 ASP n 1 51 MET n 1 52 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'AFRICAN CLAWED FROG' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'XENOPUS LAEVIS' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 8355 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant PLYSS _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PMAT10-QUA1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code QKIA_XENLA _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_db_accession Q32NN2 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 2YMJ A 3 ? 52 ? Q32NN2 8 ? 57 ? 32 81 2 1 2YMJ B 3 ? 52 ? Q32NN2 8 ? 57 ? 32 81 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YMJ GLY A 1 ? UNP Q32NN2 ? ? 'expression tag' -2 1 1 2YMJ SER A 2 ? UNP Q32NN2 ? ? 'expression tag' -1 2 1 2YMJ SER A 30 ? UNP Q32NN2 CYS 35 'engineered mutation' 59 3 2 2YMJ GLY B 1 ? UNP Q32NN2 ? ? 'expression tag' -2 4 2 2YMJ SER B 2 ? UNP Q32NN2 ? ? 'expression tag' -1 5 2 2YMJ SER B 30 ? UNP Q32NN2 CYS 35 'engineered mutation' 59 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 '[1H' 1 2 1 '15N]-HSQC' 1 3 1 '15N-TOCSY- HSQC' 1 4 1 15N-NOESY-HSQC 1 5 1 '13C- NOESY-HSQC' 1 6 1 HNCA 1 7 1 'HN(CO)CA' 1 8 1 HNCACB 1 9 1 'CBCA(CO)NH' 1 10 1 HNCO 1 11 1 'HBHA(CO)NH' 1 12 1 HCCH-TOCSY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298.0 _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.pressure 1.0 _pdbx_nmr_exptl_sample_conditions.pH 6.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 150 _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90% WATER / 10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 500 # _pdbx_nmr_refine.entry_id 2YMJ _pdbx_nmr_refine.method 'ARIA VERSION 2.3' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2YMJ _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON A UNIFORMLY 15N AND 13C LABELLED PXQUA QUA1 DOMAIN SAMPLE.' # _pdbx_nmr_ensemble.entry_id 2YMJ _pdbx_nmr_ensemble.conformers_calculated_total_number 40 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY PLUS NO NOE VIOLATIONS >0.5 ANGSTROMS AND NO DIHEDRAL ANGLE VIOLATIONS > 5 DEGREES' # _pdbx_nmr_representative.entry_id 2YMJ _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria ? # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement ARIA/CNS ? 'NILGES ET AL' 1 'structure solution' 'CcpNmr Analysis' ANALYSIS ? 2 # _exptl.entry_id 2YMJ _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2YMJ _struct.title 'Solution structure of the QUA1 dimerization domain of pXqua, the Xenopus ortholog of Quaking.' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YMJ _struct_keywords.pdbx_keywords TRANSLATION _struct_keywords.text 'TRANSLATION, HAIRPIN, QKI, STAR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 9 ? SER A 25 ? THR A 38 SER A 54 1 ? 17 HELX_P HELX_P2 2 ASN A 28 ? PHE A 33 ? ASN A 57 PHE A 62 1 ? 6 HELX_P HELX_P3 3 HIS A 35 ? ASP A 50 ? HIS A 64 ASP A 79 1 ? 16 HELX_P HELX_P4 4 THR B 9 ? SER B 25 ? THR B 38 SER B 54 1 ? 17 HELX_P HELX_P5 5 ASN B 28 ? PHE B 33 ? ASN B 57 PHE B 62 1 ? 6 HELX_P HELX_P6 6 HIS B 35 ? ASP B 50 ? HIS B 64 ASP B 79 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2YMJ _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2YMJ _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 -2 GLY GLY A . n A 1 2 SER 2 -1 -1 SER SER A . n A 1 3 LYS 3 32 32 LYS LYS A . n A 1 4 GLU 4 33 33 GLU GLU A . n A 1 5 LYS 5 34 34 LYS LYS A . n A 1 6 PRO 6 35 35 PRO PRO A . n A 1 7 LYS 7 36 36 LYS LYS A . n A 1 8 PRO 8 37 37 PRO PRO A . n A 1 9 THR 9 38 38 THR THR A . n A 1 10 PRO 10 39 39 PRO PRO A . n A 1 11 ASP 11 40 40 ASP ASP A . n A 1 12 TYR 12 41 41 TYR TYR A . n A 1 13 LEU 13 42 42 LEU LEU A . n A 1 14 MET 14 43 43 MET MET A . n A 1 15 GLN 15 44 44 GLN GLN A . n A 1 16 LEU 16 45 45 LEU LEU A . n A 1 17 MET 17 46 46 MET MET A . n A 1 18 ASN 18 47 47 ASN ASN A . n A 1 19 ASP 19 48 48 ASP ASP A . n A 1 20 LYS 20 49 49 LYS LYS A . n A 1 21 LYS 21 50 50 LYS LYS A . n A 1 22 LEU 22 51 51 LEU LEU A . n A 1 23 MET 23 52 52 MET MET A . n A 1 24 SER 24 53 53 SER SER A . n A 1 25 SER 25 54 54 SER SER A . n A 1 26 LEU 26 55 55 LEU LEU A . n A 1 27 PRO 27 56 56 PRO PRO A . n A 1 28 ASN 28 57 57 ASN ASN A . n A 1 29 PHE 29 58 58 PHE PHE A . n A 1 30 SER 30 59 59 SER SER A . n A 1 31 GLY 31 60 60 GLY GLY A . n A 1 32 ILE 32 61 61 ILE ILE A . n A 1 33 PHE 33 62 62 PHE PHE A . n A 1 34 THR 34 63 63 THR THR A . n A 1 35 HIS 35 64 64 HIS HIS A . n A 1 36 LEU 36 65 65 LEU LEU A . n A 1 37 GLU 37 66 66 GLU GLU A . n A 1 38 ARG 38 67 67 ARG ARG A . n A 1 39 LEU 39 68 68 LEU LEU A . n A 1 40 LEU 40 69 69 LEU LEU A . n A 1 41 ASP 41 70 70 ASP ASP A . n A 1 42 GLU 42 71 71 GLU GLU A . n A 1 43 GLU 43 72 72 GLU GLU A . n A 1 44 ILE 44 73 73 ILE ILE A . n A 1 45 SER 45 74 74 SER SER A . n A 1 46 ARG 46 75 75 ARG ARG A . n A 1 47 VAL 47 76 76 VAL VAL A . n A 1 48 ARG 48 77 77 ARG ARG A . n A 1 49 LYS 49 78 78 LYS LYS A . n A 1 50 ASP 50 79 79 ASP ASP A . n A 1 51 MET 51 80 80 MET MET A . n A 1 52 TYR 52 81 81 TYR TYR A . n B 1 1 GLY 1 -2 -2 GLY GLY B . n B 1 2 SER 2 -1 -1 SER SER B . n B 1 3 LYS 3 32 32 LYS LYS B . n B 1 4 GLU 4 33 33 GLU GLU B . n B 1 5 LYS 5 34 34 LYS LYS B . n B 1 6 PRO 6 35 35 PRO PRO B . n B 1 7 LYS 7 36 36 LYS LYS B . n B 1 8 PRO 8 37 37 PRO PRO B . n B 1 9 THR 9 38 38 THR THR B . n B 1 10 PRO 10 39 39 PRO PRO B . n B 1 11 ASP 11 40 40 ASP ASP B . n B 1 12 TYR 12 41 41 TYR TYR B . n B 1 13 LEU 13 42 42 LEU LEU B . n B 1 14 MET 14 43 43 MET MET B . n B 1 15 GLN 15 44 44 GLN GLN B . n B 1 16 LEU 16 45 45 LEU LEU B . n B 1 17 MET 17 46 46 MET MET B . n B 1 18 ASN 18 47 47 ASN ASN B . n B 1 19 ASP 19 48 48 ASP ASP B . n B 1 20 LYS 20 49 49 LYS LYS B . n B 1 21 LYS 21 50 50 LYS LYS B . n B 1 22 LEU 22 51 51 LEU LEU B . n B 1 23 MET 23 52 52 MET MET B . n B 1 24 SER 24 53 53 SER SER B . n B 1 25 SER 25 54 54 SER SER B . n B 1 26 LEU 26 55 55 LEU LEU B . n B 1 27 PRO 27 56 56 PRO PRO B . n B 1 28 ASN 28 57 57 ASN ASN B . n B 1 29 PHE 29 58 58 PHE PHE B . n B 1 30 SER 30 59 59 SER SER B . n B 1 31 GLY 31 60 60 GLY GLY B . n B 1 32 ILE 32 61 61 ILE ILE B . n B 1 33 PHE 33 62 62 PHE PHE B . n B 1 34 THR 34 63 63 THR THR B . n B 1 35 HIS 35 64 64 HIS HIS B . n B 1 36 LEU 36 65 65 LEU LEU B . n B 1 37 GLU 37 66 66 GLU GLU B . n B 1 38 ARG 38 67 67 ARG ARG B . n B 1 39 LEU 39 68 68 LEU LEU B . n B 1 40 LEU 40 69 69 LEU LEU B . n B 1 41 ASP 41 70 70 ASP ASP B . n B 1 42 GLU 42 71 71 GLU GLU B . n B 1 43 GLU 43 72 72 GLU GLU B . n B 1 44 ILE 44 73 73 ILE ILE B . n B 1 45 SER 45 74 74 SER SER B . n B 1 46 ARG 46 75 75 ARG ARG B . n B 1 47 VAL 47 76 76 VAL VAL B . n B 1 48 ARG 48 77 77 ARG ARG B . n B 1 49 LYS 49 78 78 LYS LYS B . n B 1 50 ASP 50 79 79 ASP ASP B . n B 1 51 MET 51 80 80 MET MET B . n B 1 52 TYR 52 81 81 TYR TYR B . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PQS _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-10-30 2 'Structure model' 1 1 2016-05-04 3 'Structure model' 1 2 2019-09-25 4 'Structure model' 1 3 2023-06-14 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other 5 2 'Structure model' 'Structure summary' 6 3 'Structure model' 'Data collection' 7 3 'Structure model' Other 8 4 'Structure model' 'Database references' 9 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_database_status 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_database_status # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_database_status.status_code_cs' 2 3 'Structure model' '_pdbx_database_status.status_code_mr' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 4 'Structure model' '_database_2.pdbx_DOI' 6 4 'Structure model' '_database_2.pdbx_database_accession' 7 4 'Structure model' '_pdbx_database_status.status_code_nmr_data' # _pdbx_entry_details.entry_id 2YMJ _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;CONSTRUCT CORRESPONDS TO RESIDUES 32 TO 81 OF PXQUA, WITH AN ADDITION GS CLONING ARTEFACT AT THE N-TERMINUS, PLUS A C59S POINT MUTATION. ; _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 3 OE2 A GLU 71 ? ? HZ3 B LYS 32 ? ? 1.58 2 3 HZ3 A LYS 32 ? ? OE2 B GLU 71 ? ? 1.58 3 5 OD1 A ASP 70 ? ? HZ2 B LYS 32 ? ? 1.59 4 10 OD2 A ASP 70 ? ? HZ3 B LYS 32 ? ? 1.60 5 11 HZ3 A LYS 32 ? ? OD1 B ASP 70 ? ? 1.59 6 11 OD1 A ASP 70 ? ? HZ3 B LYS 32 ? ? 1.60 7 11 OE1 B GLU 72 ? ? HE B ARG 75 ? ? 1.60 8 13 HZ1 A LYS 32 ? ? OE1 B GLU 71 ? ? 1.58 9 13 OE1 A GLU 71 ? ? HZ1 B LYS 32 ? ? 1.59 10 17 HH21 B ARG 67 ? ? OE2 B GLU 71 ? ? 1.57 11 17 HH21 A ARG 67 ? ? OE2 A GLU 71 ? ? 1.57 12 18 O B ASP 70 ? ? HG B SER 74 ? ? 1.58 13 18 HZ2 A LYS 32 ? ? OD1 B ASP 70 ? ? 1.59 14 18 OD1 A ASP 70 ? ? HZ2 B LYS 32 ? ? 1.59 15 18 O A ASP 70 ? ? HG A SER 74 ? ? 1.59 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 32 ? ? 71.07 135.26 2 1 LYS B 32 ? ? 70.69 135.34 3 2 LYS A 32 ? ? 71.81 136.17 4 2 PHE A 58 ? ? -87.41 -151.48 5 2 SER A 59 ? ? 25.86 60.61 6 2 LYS B 32 ? ? 71.79 135.84 7 2 PHE B 58 ? ? -87.55 -152.08 8 2 SER B 59 ? ? 26.30 60.17 9 3 PRO A 37 ? ? -59.50 109.03 10 3 SER A 59 ? ? -167.62 -43.71 11 3 THR A 63 ? ? -90.60 -61.81 12 3 ASP A 79 ? ? -59.20 -8.47 13 3 PRO B 37 ? ? -59.37 109.19 14 3 SER B 59 ? ? -167.64 -43.53 15 3 THR B 63 ? ? -90.48 -62.06 16 3 ASP B 79 ? ? -59.07 -8.89 17 4 SER A 59 ? ? -172.62 -39.59 18 4 ASP A 79 ? ? -64.20 0.78 19 4 SER B 59 ? ? -172.75 -39.31 20 4 ASP B 79 ? ? -64.06 0.68 21 5 LYS A 32 ? ? 66.96 142.53 22 5 SER A 59 ? ? -165.94 53.90 23 5 THR A 63 ? ? -90.16 -65.08 24 5 LYS B 32 ? ? 67.12 142.24 25 5 SER B 59 ? ? -165.62 54.39 26 5 THR B 63 ? ? -90.21 -64.99 27 6 LYS A 32 ? ? 57.98 70.44 28 6 SER A 59 ? ? -69.59 72.39 29 6 THR A 63 ? ? -91.79 -60.53 30 6 ASP A 79 ? ? -78.79 -88.05 31 6 MET A 80 ? ? 37.45 36.79 32 6 LYS B 32 ? ? 58.10 70.55 33 6 SER B 59 ? ? -69.52 72.33 34 6 THR B 63 ? ? -91.83 -60.18 35 6 ASP B 79 ? ? -78.98 -88.10 36 6 MET B 80 ? ? 37.59 36.62 37 7 PHE A 62 ? ? 65.58 76.47 38 7 ASP A 79 ? ? -76.68 42.74 39 7 PHE B 62 ? ? 65.56 76.58 40 7 ASP B 79 ? ? -76.83 43.23 41 8 SER A -1 ? ? -148.19 -67.39 42 8 SER A 59 ? ? -65.74 62.49 43 8 PHE A 62 ? ? 62.35 91.27 44 8 SER B -1 ? ? -148.44 -67.75 45 8 SER B 59 ? ? -65.45 62.16 46 8 PHE B 62 ? ? 62.57 91.31 47 9 SER A -1 ? ? -86.01 -89.50 48 9 LYS A 32 ? ? 64.01 132.24 49 9 SER A 59 ? ? -67.96 68.71 50 9 SER B -1 ? ? -85.83 -89.34 51 9 LYS B 32 ? ? 64.09 132.36 52 9 SER B 59 ? ? -67.95 68.99 53 10 PHE A 62 ? ? 68.71 106.04 54 10 PHE B 62 ? ? 68.78 106.20 55 11 SER A 59 ? ? -143.20 -31.08 56 11 SER B 59 ? ? -143.47 -31.09 57 12 SER A -1 ? ? -164.89 -66.87 58 12 LYS A 32 ? ? 70.82 134.09 59 12 PHE A 62 ? ? 62.28 66.26 60 12 ASP A 79 ? ? -67.16 0.77 61 12 SER B -1 ? ? -165.01 -66.74 62 12 LYS B 32 ? ? 70.54 134.38 63 12 PHE B 62 ? ? 62.11 66.50 64 12 ASP B 79 ? ? -67.52 1.06 65 13 SER A 59 ? ? -178.04 -50.42 66 13 SER B 59 ? ? -177.55 -50.41 67 14 ASP A 79 ? ? -64.56 -78.62 68 14 ASP B 79 ? ? -64.94 -78.20 69 15 PRO A 56 ? ? -100.51 74.05 70 15 ASN A 57 ? ? 158.12 -4.82 71 15 SER A 59 ? ? -68.98 68.00 72 15 PHE A 62 ? ? 66.79 93.18 73 15 PRO B 56 ? ? -100.30 73.85 74 15 ASN B 57 ? ? 158.29 -4.58 75 15 SER B 59 ? ? -69.03 67.92 76 15 PHE B 62 ? ? 66.90 93.49 77 15 ASP B 79 ? ? -59.67 -8.92 78 16 LYS A 34 ? ? 33.48 55.34 79 16 PHE A 58 ? ? -69.44 79.22 80 16 SER A 59 ? ? -169.39 -43.04 81 16 PHE A 62 ? ? 64.55 82.01 82 16 LYS B 34 ? ? 33.74 55.29 83 16 PHE B 58 ? ? -69.30 79.07 84 16 SER B 59 ? ? -169.12 -43.02 85 16 PHE B 62 ? ? 64.89 81.80 86 17 SER A 59 ? ? -168.61 -39.31 87 17 ASP A 79 ? ? -68.96 5.87 88 17 SER B 59 ? ? -169.14 -39.17 89 17 ASP B 79 ? ? -69.02 5.33 90 18 SER A 59 ? ? -66.89 71.18 91 18 SER B 59 ? ? -67.08 71.32 92 19 PHE A 62 ? ? 61.98 76.64 93 19 PHE B 62 ? ? 62.19 76.82 94 20 SER A 59 ? ? -66.49 78.90 95 20 SER B 59 ? ? -66.50 79.20 #