data_2YQR # _entry.id 2YQR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YQR pdb_00002yqr 10.2210/pdb2yqr/pdb RCSB RCSB027015 ? ? WWPDB D_1000027015 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsk002100884.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2YQR _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-03-30 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kadirvel, S.' 1 'He, F.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Shirouzu, M.' 6 'Tarada, T.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the KH domain in KIAA0907 protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kadirvel, S.' 1 ? primary 'He, F.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Shirouzu, M.' 6 ? primary 'Tarada, T.' 7 ? primary 'Yokoyama, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'KIAA0907 protein' _entity.formula_weight 12833.610 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'KH domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISH PKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISH PKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsk002100884.3 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLY n 1 9 MET n 1 10 HIS n 1 11 TYR n 1 12 VAL n 1 13 GLN n 1 14 ASP n 1 15 LYS n 1 16 LEU n 1 17 PHE n 1 18 VAL n 1 19 GLY n 1 20 LEU n 1 21 GLU n 1 22 HIS n 1 23 ALA n 1 24 VAL n 1 25 PRO n 1 26 THR n 1 27 PHE n 1 28 ASN n 1 29 VAL n 1 30 LYS n 1 31 GLU n 1 32 LYS n 1 33 VAL n 1 34 GLU n 1 35 GLY n 1 36 PRO n 1 37 GLY n 1 38 CYS n 1 39 SER n 1 40 TYR n 1 41 LEU n 1 42 GLN n 1 43 HIS n 1 44 ILE n 1 45 GLN n 1 46 ILE n 1 47 GLU n 1 48 THR n 1 49 GLY n 1 50 ALA n 1 51 LYS n 1 52 VAL n 1 53 PHE n 1 54 LEU n 1 55 ARG n 1 56 GLY n 1 57 LYS n 1 58 GLY n 1 59 SER n 1 60 GLY n 1 61 CYS n 1 62 ILE n 1 63 GLU n 1 64 PRO n 1 65 ALA n 1 66 SER n 1 67 GLY n 1 68 ARG n 1 69 GLU n 1 70 ALA n 1 71 PHE n 1 72 GLU n 1 73 PRO n 1 74 MET n 1 75 TYR n 1 76 ILE n 1 77 TYR n 1 78 ILE n 1 79 SER n 1 80 HIS n 1 81 PRO n 1 82 LYS n 1 83 PRO n 1 84 GLU n 1 85 GLY n 1 86 LEU n 1 87 ALA n 1 88 ALA n 1 89 ALA n 1 90 LYS n 1 91 LYS n 1 92 LEU n 1 93 CYS n 1 94 GLU n 1 95 ASN n 1 96 LEU n 1 97 LEU n 1 98 GLN n 1 99 THR n 1 100 VAL n 1 101 HIS n 1 102 ALA n 1 103 GLU n 1 104 TYR n 1 105 SER n 1 106 ARG n 1 107 PHE n 1 108 VAL n 1 109 ASN n 1 110 GLN n 1 111 ILE n 1 112 ASN n 1 113 THR n 1 114 ALA n 1 115 VAL n 1 116 PRO n 1 117 LEU n 1 118 PRO n 1 119 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene KIAA0907 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060320-05 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code O94981_HUMAN _struct_ref.pdbx_db_accession O94981 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHPKPEGLA AAKKLCENLLQTVHAEYSRFVNQINTAVPLPG ; _struct_ref.pdbx_align_begin 232 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YQR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 119 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O94981 _struct_ref_seq.db_align_beg 232 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 343 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 119 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YQR GLY A 1 ? UNP O94981 ? ? 'expression tag' 1 1 1 2YQR SER A 2 ? UNP O94981 ? ? 'expression tag' 2 2 1 2YQR SER A 3 ? UNP O94981 ? ? 'expression tag' 3 3 1 2YQR GLY A 4 ? UNP O94981 ? ? 'expression tag' 4 4 1 2YQR SER A 5 ? UNP O94981 ? ? 'expression tag' 5 5 1 2YQR SER A 6 ? UNP O94981 ? ? 'expression tag' 6 6 1 2YQR GLY A 7 ? UNP O94981 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0mM 13C, 15N-labeled protein; 20mM d-Tris-HCl (pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YQR _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2YQR _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YQR # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.1 'Guntert, P.' 5 refinement CYANA 2.1 'Guntert, P.' 6 # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2YQR _exptl.crystals_number ? # _struct.entry_id 2YQR _struct.title 'Solution structure of the KH domain in KIAA0907 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YQR _struct_keywords.text ;structure genomics, KH domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN ; _struct_keywords.pdbx_keywords 'RNA BINDING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 VAL A 29 ? VAL A 33 ? VAL A 29 VAL A 33 1 ? 5 HELX_P HELX_P2 2 PRO A 36 ? CYS A 38 ? PRO A 36 CYS A 38 5 ? 3 HELX_P HELX_P3 3 SER A 39 ? GLU A 47 ? SER A 39 GLU A 47 1 ? 9 HELX_P HELX_P4 4 PRO A 83 ? ILE A 111 ? PRO A 83 ILE A 111 1 ? 29 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 12 ? PHE A 17 ? VAL A 12 PHE A 17 A 2 TYR A 75 ? HIS A 80 ? TYR A 75 HIS A 80 A 3 LYS A 51 ? ARG A 55 ? LYS A 51 ARG A 55 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 16 ? N LEU A 16 O ILE A 76 ? O ILE A 76 A 2 3 O TYR A 75 ? O TYR A 75 N ARG A 55 ? N ARG A 55 # _atom_sites.entry_id 2YQR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 MET 9 9 9 MET MET A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 TYR 11 11 11 TYR TYR A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 VAL 18 18 18 VAL VAL A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 HIS 22 22 22 HIS HIS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 VAL 24 24 24 VAL VAL A . n A 1 25 PRO 25 25 25 PRO PRO A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 PHE 27 27 27 PHE PHE A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 CYS 38 38 38 CYS CYS A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLN 42 42 42 GLN GLN A . n A 1 43 HIS 43 43 43 HIS HIS A . n A 1 44 ILE 44 44 44 ILE ILE A . n A 1 45 GLN 45 45 45 GLN GLN A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 CYS 61 61 61 CYS CYS A . n A 1 62 ILE 62 62 62 ILE ILE A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 SER 66 66 66 SER SER A . n A 1 67 GLY 67 67 67 GLY GLY A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 GLU 69 69 69 GLU GLU A . n A 1 70 ALA 70 70 70 ALA ALA A . n A 1 71 PHE 71 71 71 PHE PHE A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 MET 74 74 74 MET MET A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 TYR 77 77 77 TYR TYR A . n A 1 78 ILE 78 78 78 ILE ILE A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 LYS 82 82 82 LYS LYS A . n A 1 83 PRO 83 83 83 PRO PRO A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 ALA 87 87 87 ALA ALA A . n A 1 88 ALA 88 88 88 ALA ALA A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 GLU 94 94 94 GLU GLU A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 VAL 100 100 100 VAL VAL A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 TYR 104 104 104 TYR TYR A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 THR 113 113 113 THR THR A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 PRO 116 116 116 PRO PRO A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 PRO 118 118 118 PRO PRO A . n A 1 119 GLY 119 119 119 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 650 _pdbx_database_remark.text ;HELIX DETERMINATION METHOD: AUTHOR DETERMINED ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 2 ? ? 59.42 -178.90 2 1 SER A 3 ? ? -115.09 79.72 3 1 MET A 9 ? ? -94.20 -61.63 4 1 GLU A 63 ? ? 63.81 99.55 5 1 PRO A 116 ? ? -69.66 -174.90 6 2 SER A 2 ? ? -106.44 -72.50 7 2 SER A 3 ? ? 57.17 -178.36 8 2 CYS A 61 ? ? -63.45 93.60 9 2 GLU A 63 ? ? 64.13 99.50 10 2 GLU A 69 ? ? -52.40 170.15 11 2 ASN A 112 ? ? -92.54 -74.05 12 3 SER A 6 ? ? 56.15 -172.03 13 3 HIS A 10 ? ? 55.03 -173.48 14 3 CYS A 61 ? ? -62.81 94.37 15 3 GLU A 63 ? ? 63.81 99.53 16 3 ASN A 112 ? ? -167.72 -39.01 17 3 ALA A 114 ? ? 59.73 97.46 18 4 SER A 2 ? ? -53.69 105.57 19 4 SER A 3 ? ? -167.60 37.62 20 4 LEU A 20 ? ? -141.20 26.07 21 4 GLU A 63 ? ? 63.78 99.56 22 4 ALA A 114 ? ? 53.02 84.96 23 5 HIS A 10 ? ? 60.12 176.11 24 5 GLU A 63 ? ? 64.10 99.53 25 5 PRO A 116 ? ? -69.73 -171.35 26 6 GLU A 63 ? ? 63.78 99.57 27 6 PRO A 116 ? ? -69.77 -177.85 28 7 CYS A 61 ? ? -64.25 93.33 29 7 GLU A 63 ? ? 64.10 99.49 30 7 ALA A 70 ? ? -58.61 170.62 31 7 PRO A 116 ? ? -69.72 -175.70 32 8 GLU A 63 ? ? 63.92 99.54 33 9 SER A 6 ? ? 62.87 177.35 34 9 HIS A 10 ? ? 63.12 174.59 35 9 CYS A 61 ? ? -65.19 92.42 36 9 GLU A 63 ? ? 64.11 99.48 37 9 GLU A 69 ? ? -53.06 171.06 38 9 ILE A 111 ? ? -65.56 92.17 39 9 ALA A 114 ? ? -160.62 102.21 40 9 PRO A 116 ? ? -69.78 -174.07 41 10 SER A 3 ? ? -174.96 99.71 42 10 GLU A 63 ? ? 63.83 99.57 43 10 ILE A 111 ? ? -62.77 96.20 44 11 SER A 2 ? ? 57.21 76.38 45 11 SER A 6 ? ? -162.87 73.86 46 11 GLU A 63 ? ? 63.84 99.58 47 12 ASN A 28 ? ? 58.44 72.00 48 12 CYS A 61 ? ? -62.16 94.97 49 12 GLU A 63 ? ? 63.81 99.59 50 12 ALA A 70 ? ? -57.75 172.51 51 12 ILE A 111 ? ? -58.54 99.58 52 12 PRO A 118 ? ? -69.73 -177.14 53 13 SER A 2 ? ? 54.58 75.26 54 13 SER A 5 ? ? 52.65 73.11 55 13 GLU A 63 ? ? 64.07 99.54 56 13 GLU A 69 ? ? -52.65 170.12 57 13 ALA A 114 ? ? 53.84 83.33 58 14 SER A 3 ? ? 61.97 76.57 59 14 SER A 6 ? ? 61.08 -177.69 60 14 MET A 9 ? ? -108.13 48.13 61 14 HIS A 10 ? ? 60.42 173.38 62 14 GLU A 63 ? ? 63.78 99.57 63 14 ILE A 111 ? ? -57.59 -71.60 64 14 ASN A 112 ? ? -153.48 -71.54 65 14 PRO A 116 ? ? -69.75 -178.27 66 15 CYS A 61 ? ? -65.44 91.25 67 15 GLU A 63 ? ? 63.97 99.59 68 15 GLU A 69 ? ? -53.84 172.67 69 16 SER A 3 ? ? -173.63 123.04 70 16 SER A 5 ? ? -99.46 49.45 71 16 MET A 9 ? ? -163.76 111.17 72 16 HIS A 10 ? ? 58.70 -178.08 73 16 GLU A 63 ? ? 64.09 99.50 74 16 ASN A 112 ? ? -91.27 -65.66 75 17 SER A 5 ? ? 58.06 94.25 76 17 GLU A 63 ? ? 64.02 99.52 77 17 GLU A 69 ? ? -54.39 171.45 78 18 SER A 2 ? ? 52.45 77.61 79 18 SER A 3 ? ? -177.59 107.65 80 18 LEU A 20 ? ? -142.81 28.88 81 18 GLU A 63 ? ? 64.13 99.47 82 18 ALA A 114 ? ? -160.37 101.62 83 19 SER A 2 ? ? -58.93 178.89 84 19 SER A 3 ? ? -155.14 53.62 85 19 MET A 9 ? ? -159.81 -60.97 86 19 CYS A 61 ? ? -57.64 103.82 87 19 GLU A 63 ? ? 64.00 99.57 88 20 SER A 3 ? ? 62.74 162.75 89 20 SER A 5 ? ? 53.75 -170.49 90 20 CYS A 61 ? ? -63.57 94.35 91 20 GLU A 63 ? ? 63.82 99.52 #