data_2YRK # _entry.id 2YRK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YRK pdb_00002yrk 10.2210/pdb2yrk/pdb RCSB RCSB027044 ? ? WWPDB D_1000027044 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-02 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 4 'Structure model' chem_comp_atom 8 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_status.entry_id 2YRK _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-04-02 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id ar_001000691.1 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tanabe, W.' 1 'Suzuki, S.' 2 'Muto, Y.' 3 'Inoue, M.' 4 'Kigawa, T.' 5 'Shirouzu, M.' 6 'Tarada, T.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the zf-C2H2 domain in zinc finger homeodomain 4' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tanabe, W.' 1 ? primary 'Suzuki, S.' 2 ? primary 'Muto, Y.' 3 ? primary 'Inoue, M.' 4 ? primary 'Kigawa, T.' 5 ? primary 'Shirouzu, M.' 6 ? primary 'Tarada, T.' 7 ? primary 'Yokoyama, S.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger homeobox protein 4' 5921.575 1 ? ? 'zf-C2H2 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Zinc finger homeodomain protein 4, ZFH-4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGGTDGTKPECTLCGVKYSARLSIRDHIFSKQHISKVRETVGSQLDREKD _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGGTDGTKPECTLCGVKYSARLSIRDHIFSKQHISKVRETVGSQLDREKD _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ar_001000691.1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLY n 1 9 THR n 1 10 ASP n 1 11 GLY n 1 12 THR n 1 13 LYS n 1 14 PRO n 1 15 GLU n 1 16 CYS n 1 17 THR n 1 18 LEU n 1 19 CYS n 1 20 GLY n 1 21 VAL n 1 22 LYS n 1 23 TYR n 1 24 SER n 1 25 ALA n 1 26 ARG n 1 27 LEU n 1 28 SER n 1 29 ILE n 1 30 ARG n 1 31 ASP n 1 32 HIS n 1 33 ILE n 1 34 PHE n 1 35 SER n 1 36 LYS n 1 37 GLN n 1 38 HIS n 1 39 ILE n 1 40 SER n 1 41 LYS n 1 42 VAL n 1 43 ARG n 1 44 GLU n 1 45 THR n 1 46 VAL n 1 47 GLY n 1 48 SER n 1 49 GLN n 1 50 LEU n 1 51 ASP n 1 52 ARG n 1 53 GLU n 1 54 LYS n 1 55 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name 'house mouse' _entity_src_gen.gene_src_genus Mus _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060718-14 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 THR 9 9 9 THR THR A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 GLY 11 11 11 GLY GLY A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 PRO 14 14 14 PRO PRO A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 CYS 16 16 16 CYS CYS A . n A 1 17 THR 17 17 17 THR THR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 CYS 19 19 19 CYS CYS A . n A 1 20 GLY 20 20 20 GLY GLY A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 TYR 23 23 23 TYR TYR A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 ILE 29 29 29 ILE ILE A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 SER 35 35 35 SER SER A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 LYS 41 41 41 LYS LYS A . n A 1 42 VAL 42 42 42 VAL VAL A . n A 1 43 ARG 43 43 43 ARG ARG A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 SER 48 48 48 SER SER A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 ARG 52 52 52 ARG ARG A . n A 1 53 GLU 53 53 53 GLU GLU A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 ASP 55 55 55 ASP ASP A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2YRK _exptl.crystals_number ? # _struct.entry_id 2YRK _struct.title 'Solution structure of the zf-C2H2 domain in zinc finger homeodomain 4' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YRK _struct_keywords.text ;structure genomics, zf-C2H2 domain, ZFH-4, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZFHX4_MOUSE _struct_ref.pdbx_db_accession Q9JJN2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code GTDGTKPECTLCGVKYSARLSIRDHIFSKQHISKVRETVGSQLDREKD _struct_ref.pdbx_align_begin 2937 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YRK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 55 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9JJN2 _struct_ref_seq.db_align_beg 2937 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2984 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 55 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YRK GLY A 1 ? UNP Q9JJN2 ? ? 'expression tag' 1 1 1 2YRK SER A 2 ? UNP Q9JJN2 ? ? 'expression tag' 2 2 1 2YRK SER A 3 ? UNP Q9JJN2 ? ? 'expression tag' 3 3 1 2YRK GLY A 4 ? UNP Q9JJN2 ? ? 'expression tag' 4 4 1 2YRK SER A 5 ? UNP Q9JJN2 ? ? 'expression tag' 5 5 1 2YRK SER A 6 ? UNP Q9JJN2 ? ? 'expression tag' 6 6 1 2YRK GLY A 7 ? UNP Q9JJN2 ? ? 'expression tag' 7 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 29 ? ILE A 33 ? ILE A 29 ILE A 33 1 ? 5 HELX_P HELX_P2 2 LYS A 36 ? GLU A 44 ? LYS A 36 GLU A 44 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 16 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 16 A ZN 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc2 metalc ? ? A CYS 19 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 19 A ZN 201 1_555 ? ? ? ? ? ? ? 2.247 ? ? metalc3 metalc ? ? A HIS 32 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 32 A ZN 201 1_555 ? ? ? ? ? ? ? 2.086 ? ? metalc4 metalc ? ? A HIS 38 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 38 A ZN 201 1_555 ? ? ? ? ? ? ? 2.055 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 19 ? A CYS 19 ? 1_555 102.3 ? 2 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 97.8 ? 3 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 118.1 ? 4 SG ? A CYS 16 ? A CYS 16 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 111.0 ? 5 SG ? A CYS 19 ? A CYS 19 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 116.1 ? 6 NE2 ? A HIS 32 ? A HIS 32 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 ND1 ? A HIS 38 ? A HIS 38 ? 1_555 109.5 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 15 ? CYS A 16 ? GLU A 15 CYS A 16 A 2 VAL A 21 ? LYS A 22 ? VAL A 21 LYS A 22 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 12 ? ? -92.16 37.51 2 1 PRO A 14 ? ? -69.80 92.59 3 1 ALA A 25 ? ? -34.96 -32.07 4 1 LEU A 27 ? ? -44.77 167.51 5 1 PHE A 34 ? ? -93.25 33.83 6 1 THR A 45 ? ? -34.09 -38.31 7 2 SER A 3 ? ? -120.57 -55.37 8 2 PRO A 14 ? ? -69.74 92.62 9 2 ALA A 25 ? ? -34.75 -32.29 10 2 LEU A 27 ? ? -46.99 159.66 11 2 ASP A 31 ? ? -39.95 -26.51 12 2 THR A 45 ? ? -37.23 -37.57 13 2 SER A 48 ? ? -34.75 124.22 14 2 ARG A 52 ? ? -35.03 114.27 15 3 PRO A 14 ? ? -69.80 92.61 16 3 LEU A 27 ? ? -34.31 146.12 17 3 ILE A 29 ? ? -37.57 -38.30 18 3 HIS A 32 ? ? -80.99 -70.07 19 3 PHE A 34 ? ? -91.95 33.00 20 4 PRO A 14 ? ? -69.73 92.61 21 4 ALA A 25 ? ? -35.29 -31.44 22 4 LEU A 27 ? ? -43.97 167.18 23 4 ASP A 31 ? ? -34.56 -36.23 24 4 LEU A 50 ? ? -63.05 95.91 25 5 SER A 6 ? ? -44.40 150.15 26 5 THR A 12 ? ? -130.90 -31.19 27 5 PRO A 14 ? ? -69.72 92.48 28 5 ALA A 25 ? ? -34.56 -38.57 29 5 LEU A 27 ? ? -39.90 160.81 30 5 PHE A 34 ? ? -90.70 32.22 31 5 VAL A 46 ? ? -127.91 -50.71 32 6 PRO A 14 ? ? -69.74 92.60 33 6 ALA A 25 ? ? -34.41 -32.75 34 6 ASP A 31 ? ? -38.81 -26.82 35 6 GLN A 49 ? ? -48.95 160.49 36 7 SER A 3 ? ? -174.90 135.29 37 7 THR A 9 ? ? -58.25 98.43 38 7 PRO A 14 ? ? -69.77 92.52 39 7 ALA A 25 ? ? -34.07 -34.85 40 7 ARG A 30 ? ? -57.83 -73.44 41 7 ASP A 31 ? ? -34.95 -34.10 42 8 SER A 6 ? ? -173.68 141.64 43 8 PRO A 14 ? ? -69.75 92.53 44 8 LEU A 27 ? ? -44.89 157.33 45 8 ARG A 30 ? ? -62.65 -72.50 46 8 ASP A 31 ? ? -36.11 -37.26 47 8 ILE A 33 ? ? -48.91 -19.99 48 8 PHE A 34 ? ? -93.86 30.34 49 8 ASP A 51 ? ? -63.77 99.27 50 8 GLU A 53 ? ? -38.60 98.14 51 9 THR A 9 ? ? -89.04 36.49 52 9 PRO A 14 ? ? -69.74 92.55 53 9 ALA A 25 ? ? -38.12 -31.47 54 9 LEU A 27 ? ? -40.77 162.48 55 9 ARG A 30 ? ? -64.35 -70.39 56 9 ASP A 31 ? ? -34.67 -37.88 57 9 HIS A 32 ? ? -66.79 -70.03 58 9 LYS A 36 ? ? -34.42 -37.87 59 9 THR A 45 ? ? -34.70 -32.54 60 9 GLN A 49 ? ? -36.74 98.69 61 10 THR A 9 ? ? -82.81 39.71 62 10 PRO A 14 ? ? -69.72 92.53 63 10 THR A 17 ? ? -39.77 -27.74 64 10 ALA A 25 ? ? -38.57 -26.24 65 10 ARG A 26 ? ? -91.06 -61.63 66 10 LEU A 27 ? ? -40.11 155.56 67 10 ASP A 31 ? ? -39.51 -32.96 68 10 HIS A 32 ? ? -73.57 -70.02 69 10 ILE A 33 ? ? -48.42 -19.88 70 10 PHE A 34 ? ? -92.74 31.27 71 10 ASP A 51 ? ? -34.91 116.71 72 10 LYS A 54 ? ? -93.10 -67.30 73 11 PRO A 14 ? ? -69.70 92.47 74 11 ALA A 25 ? ? -35.99 -30.54 75 11 LEU A 27 ? ? -35.89 149.54 76 11 GLN A 49 ? ? -90.27 51.88 77 11 GLU A 53 ? ? -101.76 78.39 78 12 PRO A 14 ? ? -69.74 92.56 79 12 ALA A 25 ? ? -34.10 -37.69 80 12 PHE A 34 ? ? -93.18 33.04 81 12 THR A 45 ? ? -36.67 -32.65 82 12 GLN A 49 ? ? -57.26 97.59 83 13 ASP A 10 ? ? -84.00 44.96 84 13 PRO A 14 ? ? -69.77 92.60 85 13 ALA A 25 ? ? -34.04 -38.39 86 13 LEU A 27 ? ? -41.16 159.79 87 13 HIS A 32 ? ? -65.05 -70.03 88 13 PHE A 34 ? ? -86.22 30.32 89 13 THR A 45 ? ? -35.00 -37.57 90 13 GLN A 49 ? ? -34.64 100.12 91 13 GLU A 53 ? ? -37.07 145.77 92 14 SER A 6 ? ? -174.56 139.72 93 14 PRO A 14 ? ? -69.76 92.63 94 14 ALA A 25 ? ? -35.33 -31.23 95 14 LEU A 27 ? ? -41.39 162.78 96 14 ARG A 30 ? ? -60.69 -71.95 97 14 ASP A 31 ? ? -36.38 -34.98 98 14 ILE A 33 ? ? -49.09 -19.56 99 14 ASP A 51 ? ? -83.88 46.86 100 15 PRO A 14 ? ? -69.74 92.72 101 15 HIS A 32 ? ? -73.35 -70.13 102 15 GLU A 53 ? ? -123.37 -60.83 103 16 PRO A 14 ? ? -69.80 92.61 104 16 LEU A 27 ? ? -44.85 166.94 105 16 ILE A 29 ? ? -39.40 -39.15 106 16 ASP A 31 ? ? -37.41 -39.82 107 17 PRO A 14 ? ? -69.77 92.86 108 17 ALA A 25 ? ? -38.39 -30.93 109 17 LEU A 27 ? ? -37.11 155.03 110 17 HIS A 32 ? ? -71.34 -70.02 111 17 GLN A 49 ? ? -39.29 127.00 112 18 PRO A 14 ? ? -69.81 93.86 113 18 ALA A 25 ? ? -49.67 -17.98 114 18 ARG A 26 ? ? -100.77 -62.85 115 18 LEU A 27 ? ? -41.95 164.96 116 18 ASP A 31 ? ? -38.79 -30.49 117 18 HIS A 32 ? ? -77.46 -70.12 118 18 SER A 48 ? ? -107.67 42.95 119 18 GLN A 49 ? ? -35.10 126.76 120 19 SER A 5 ? ? 35.39 41.97 121 19 PRO A 14 ? ? -69.73 92.59 122 19 ALA A 25 ? ? -37.37 -28.10 123 19 LEU A 27 ? ? -38.98 159.34 124 19 ASP A 31 ? ? -38.68 -28.67 125 19 HIS A 32 ? ? -77.12 -70.04 126 19 SER A 48 ? ? -104.04 41.73 127 19 GLU A 53 ? ? -123.92 -52.40 128 20 PRO A 14 ? ? -69.72 96.08 129 20 ARG A 26 ? ? -98.58 -60.96 130 20 LEU A 27 ? ? -45.34 154.84 131 20 HIS A 32 ? ? -67.32 -70.66 132 20 THR A 45 ? ? -39.95 -32.00 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # loop_ _pdbx_database_remark.id _pdbx_database_remark.text 650 ;HELIX Determination method: Author determined ; 700 ;SHEET Determination method: Author determined ; # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2YRK _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YRK # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH 7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YRK _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASP N N N N 41 ASP CA C N S 42 ASP C C N N 43 ASP O O N N 44 ASP CB C N N 45 ASP CG C N N 46 ASP OD1 O N N 47 ASP OD2 O N N 48 ASP OXT O N N 49 ASP H H N N 50 ASP H2 H N N 51 ASP HA H N N 52 ASP HB2 H N N 53 ASP HB3 H N N 54 ASP HD2 H N N 55 ASP HXT H N N 56 CYS N N N N 57 CYS CA C N R 58 CYS C C N N 59 CYS O O N N 60 CYS CB C N N 61 CYS SG S N N 62 CYS OXT O N N 63 CYS H H N N 64 CYS H2 H N N 65 CYS HA H N N 66 CYS HB2 H N N 67 CYS HB3 H N N 68 CYS HG H N N 69 CYS HXT H N N 70 GLN N N N N 71 GLN CA C N S 72 GLN C C N N 73 GLN O O N N 74 GLN CB C N N 75 GLN CG C N N 76 GLN CD C N N 77 GLN OE1 O N N 78 GLN NE2 N N N 79 GLN OXT O N N 80 GLN H H N N 81 GLN H2 H N N 82 GLN HA H N N 83 GLN HB2 H N N 84 GLN HB3 H N N 85 GLN HG2 H N N 86 GLN HG3 H N N 87 GLN HE21 H N N 88 GLN HE22 H N N 89 GLN HXT H N N 90 GLU N N N N 91 GLU CA C N S 92 GLU C C N N 93 GLU O O N N 94 GLU CB C N N 95 GLU CG C N N 96 GLU CD C N N 97 GLU OE1 O N N 98 GLU OE2 O N N 99 GLU OXT O N N 100 GLU H H N N 101 GLU H2 H N N 102 GLU HA H N N 103 GLU HB2 H N N 104 GLU HB3 H N N 105 GLU HG2 H N N 106 GLU HG3 H N N 107 GLU HE2 H N N 108 GLU HXT H N N 109 GLY N N N N 110 GLY CA C N N 111 GLY C C N N 112 GLY O O N N 113 GLY OXT O N N 114 GLY H H N N 115 GLY H2 H N N 116 GLY HA2 H N N 117 GLY HA3 H N N 118 GLY HXT H N N 119 HIS N N N N 120 HIS CA C N S 121 HIS C C N N 122 HIS O O N N 123 HIS CB C N N 124 HIS CG C Y N 125 HIS ND1 N Y N 126 HIS CD2 C Y N 127 HIS CE1 C Y N 128 HIS NE2 N Y N 129 HIS OXT O N N 130 HIS H H N N 131 HIS H2 H N N 132 HIS HA H N N 133 HIS HB2 H N N 134 HIS HB3 H N N 135 HIS HD1 H N N 136 HIS HD2 H N N 137 HIS HE1 H N N 138 HIS HE2 H N N 139 HIS HXT H N N 140 ILE N N N N 141 ILE CA C N S 142 ILE C C N N 143 ILE O O N N 144 ILE CB C N S 145 ILE CG1 C N N 146 ILE CG2 C N N 147 ILE CD1 C N N 148 ILE OXT O N N 149 ILE H H N N 150 ILE H2 H N N 151 ILE HA H N N 152 ILE HB H N N 153 ILE HG12 H N N 154 ILE HG13 H N N 155 ILE HG21 H N N 156 ILE HG22 H N N 157 ILE HG23 H N N 158 ILE HD11 H N N 159 ILE HD12 H N N 160 ILE HD13 H N N 161 ILE HXT H N N 162 LEU N N N N 163 LEU CA C N S 164 LEU C C N N 165 LEU O O N N 166 LEU CB C N N 167 LEU CG C N N 168 LEU CD1 C N N 169 LEU CD2 C N N 170 LEU OXT O N N 171 LEU H H N N 172 LEU H2 H N N 173 LEU HA H N N 174 LEU HB2 H N N 175 LEU HB3 H N N 176 LEU HG H N N 177 LEU HD11 H N N 178 LEU HD12 H N N 179 LEU HD13 H N N 180 LEU HD21 H N N 181 LEU HD22 H N N 182 LEU HD23 H N N 183 LEU HXT H N N 184 LYS N N N N 185 LYS CA C N S 186 LYS C C N N 187 LYS O O N N 188 LYS CB C N N 189 LYS CG C N N 190 LYS CD C N N 191 LYS CE C N N 192 LYS NZ N N N 193 LYS OXT O N N 194 LYS H H N N 195 LYS H2 H N N 196 LYS HA H N N 197 LYS HB2 H N N 198 LYS HB3 H N N 199 LYS HG2 H N N 200 LYS HG3 H N N 201 LYS HD2 H N N 202 LYS HD3 H N N 203 LYS HE2 H N N 204 LYS HE3 H N N 205 LYS HZ1 H N N 206 LYS HZ2 H N N 207 LYS HZ3 H N N 208 LYS HXT H N N 209 PHE N N N N 210 PHE CA C N S 211 PHE C C N N 212 PHE O O N N 213 PHE CB C N N 214 PHE CG C Y N 215 PHE CD1 C Y N 216 PHE CD2 C Y N 217 PHE CE1 C Y N 218 PHE CE2 C Y N 219 PHE CZ C Y N 220 PHE OXT O N N 221 PHE H H N N 222 PHE H2 H N N 223 PHE HA H N N 224 PHE HB2 H N N 225 PHE HB3 H N N 226 PHE HD1 H N N 227 PHE HD2 H N N 228 PHE HE1 H N N 229 PHE HE2 H N N 230 PHE HZ H N N 231 PHE HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 ZN ZN ZN N N 324 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASP N CA sing N N 39 ASP N H sing N N 40 ASP N H2 sing N N 41 ASP CA C sing N N 42 ASP CA CB sing N N 43 ASP CA HA sing N N 44 ASP C O doub N N 45 ASP C OXT sing N N 46 ASP CB CG sing N N 47 ASP CB HB2 sing N N 48 ASP CB HB3 sing N N 49 ASP CG OD1 doub N N 50 ASP CG OD2 sing N N 51 ASP OD2 HD2 sing N N 52 ASP OXT HXT sing N N 53 CYS N CA sing N N 54 CYS N H sing N N 55 CYS N H2 sing N N 56 CYS CA C sing N N 57 CYS CA CB sing N N 58 CYS CA HA sing N N 59 CYS C O doub N N 60 CYS C OXT sing N N 61 CYS CB SG sing N N 62 CYS CB HB2 sing N N 63 CYS CB HB3 sing N N 64 CYS SG HG sing N N 65 CYS OXT HXT sing N N 66 GLN N CA sing N N 67 GLN N H sing N N 68 GLN N H2 sing N N 69 GLN CA C sing N N 70 GLN CA CB sing N N 71 GLN CA HA sing N N 72 GLN C O doub N N 73 GLN C OXT sing N N 74 GLN CB CG sing N N 75 GLN CB HB2 sing N N 76 GLN CB HB3 sing N N 77 GLN CG CD sing N N 78 GLN CG HG2 sing N N 79 GLN CG HG3 sing N N 80 GLN CD OE1 doub N N 81 GLN CD NE2 sing N N 82 GLN NE2 HE21 sing N N 83 GLN NE2 HE22 sing N N 84 GLN OXT HXT sing N N 85 GLU N CA sing N N 86 GLU N H sing N N 87 GLU N H2 sing N N 88 GLU CA C sing N N 89 GLU CA CB sing N N 90 GLU CA HA sing N N 91 GLU C O doub N N 92 GLU C OXT sing N N 93 GLU CB CG sing N N 94 GLU CB HB2 sing N N 95 GLU CB HB3 sing N N 96 GLU CG CD sing N N 97 GLU CG HG2 sing N N 98 GLU CG HG3 sing N N 99 GLU CD OE1 doub N N 100 GLU CD OE2 sing N N 101 GLU OE2 HE2 sing N N 102 GLU OXT HXT sing N N 103 GLY N CA sing N N 104 GLY N H sing N N 105 GLY N H2 sing N N 106 GLY CA C sing N N 107 GLY CA HA2 sing N N 108 GLY CA HA3 sing N N 109 GLY C O doub N N 110 GLY C OXT sing N N 111 GLY OXT HXT sing N N 112 HIS N CA sing N N 113 HIS N H sing N N 114 HIS N H2 sing N N 115 HIS CA C sing N N 116 HIS CA CB sing N N 117 HIS CA HA sing N N 118 HIS C O doub N N 119 HIS C OXT sing N N 120 HIS CB CG sing N N 121 HIS CB HB2 sing N N 122 HIS CB HB3 sing N N 123 HIS CG ND1 sing Y N 124 HIS CG CD2 doub Y N 125 HIS ND1 CE1 doub Y N 126 HIS ND1 HD1 sing N N 127 HIS CD2 NE2 sing Y N 128 HIS CD2 HD2 sing N N 129 HIS CE1 NE2 sing Y N 130 HIS CE1 HE1 sing N N 131 HIS NE2 HE2 sing N N 132 HIS OXT HXT sing N N 133 ILE N CA sing N N 134 ILE N H sing N N 135 ILE N H2 sing N N 136 ILE CA C sing N N 137 ILE CA CB sing N N 138 ILE CA HA sing N N 139 ILE C O doub N N 140 ILE C OXT sing N N 141 ILE CB CG1 sing N N 142 ILE CB CG2 sing N N 143 ILE CB HB sing N N 144 ILE CG1 CD1 sing N N 145 ILE CG1 HG12 sing N N 146 ILE CG1 HG13 sing N N 147 ILE CG2 HG21 sing N N 148 ILE CG2 HG22 sing N N 149 ILE CG2 HG23 sing N N 150 ILE CD1 HD11 sing N N 151 ILE CD1 HD12 sing N N 152 ILE CD1 HD13 sing N N 153 ILE OXT HXT sing N N 154 LEU N CA sing N N 155 LEU N H sing N N 156 LEU N H2 sing N N 157 LEU CA C sing N N 158 LEU CA CB sing N N 159 LEU CA HA sing N N 160 LEU C O doub N N 161 LEU C OXT sing N N 162 LEU CB CG sing N N 163 LEU CB HB2 sing N N 164 LEU CB HB3 sing N N 165 LEU CG CD1 sing N N 166 LEU CG CD2 sing N N 167 LEU CG HG sing N N 168 LEU CD1 HD11 sing N N 169 LEU CD1 HD12 sing N N 170 LEU CD1 HD13 sing N N 171 LEU CD2 HD21 sing N N 172 LEU CD2 HD22 sing N N 173 LEU CD2 HD23 sing N N 174 LEU OXT HXT sing N N 175 LYS N CA sing N N 176 LYS N H sing N N 177 LYS N H2 sing N N 178 LYS CA C sing N N 179 LYS CA CB sing N N 180 LYS CA HA sing N N 181 LYS C O doub N N 182 LYS C OXT sing N N 183 LYS CB CG sing N N 184 LYS CB HB2 sing N N 185 LYS CB HB3 sing N N 186 LYS CG CD sing N N 187 LYS CG HG2 sing N N 188 LYS CG HG3 sing N N 189 LYS CD CE sing N N 190 LYS CD HD2 sing N N 191 LYS CD HD3 sing N N 192 LYS CE NZ sing N N 193 LYS CE HE2 sing N N 194 LYS CE HE3 sing N N 195 LYS NZ HZ1 sing N N 196 LYS NZ HZ2 sing N N 197 LYS NZ HZ3 sing N N 198 LYS OXT HXT sing N N 199 PHE N CA sing N N 200 PHE N H sing N N 201 PHE N H2 sing N N 202 PHE CA C sing N N 203 PHE CA CB sing N N 204 PHE CA HA sing N N 205 PHE C O doub N N 206 PHE C OXT sing N N 207 PHE CB CG sing N N 208 PHE CB HB2 sing N N 209 PHE CB HB3 sing N N 210 PHE CG CD1 doub Y N 211 PHE CG CD2 sing Y N 212 PHE CD1 CE1 sing Y N 213 PHE CD1 HD1 sing N N 214 PHE CD2 CE2 doub Y N 215 PHE CD2 HD2 sing N N 216 PHE CE1 CZ doub Y N 217 PHE CE1 HE1 sing N N 218 PHE CE2 CZ sing Y N 219 PHE CE2 HE2 sing N N 220 PHE CZ HZ sing N N 221 PHE OXT HXT sing N N 222 PRO N CA sing N N 223 PRO N CD sing N N 224 PRO N H sing N N 225 PRO CA C sing N N 226 PRO CA CB sing N N 227 PRO CA HA sing N N 228 PRO C O doub N N 229 PRO C OXT sing N N 230 PRO CB CG sing N N 231 PRO CB HB2 sing N N 232 PRO CB HB3 sing N N 233 PRO CG CD sing N N 234 PRO CG HG2 sing N N 235 PRO CG HG3 sing N N 236 PRO CD HD2 sing N N 237 PRO CD HD3 sing N N 238 PRO OXT HXT sing N N 239 SER N CA sing N N 240 SER N H sing N N 241 SER N H2 sing N N 242 SER CA C sing N N 243 SER CA CB sing N N 244 SER CA HA sing N N 245 SER C O doub N N 246 SER C OXT sing N N 247 SER CB OG sing N N 248 SER CB HB2 sing N N 249 SER CB HB3 sing N N 250 SER OG HG sing N N 251 SER OXT HXT sing N N 252 THR N CA sing N N 253 THR N H sing N N 254 THR N H2 sing N N 255 THR CA C sing N N 256 THR CA CB sing N N 257 THR CA HA sing N N 258 THR C O doub N N 259 THR C OXT sing N N 260 THR CB OG1 sing N N 261 THR CB CG2 sing N N 262 THR CB HB sing N N 263 THR OG1 HG1 sing N N 264 THR CG2 HG21 sing N N 265 THR CG2 HG22 sing N N 266 THR CG2 HG23 sing N N 267 THR OXT HXT sing N N 268 TYR N CA sing N N 269 TYR N H sing N N 270 TYR N H2 sing N N 271 TYR CA C sing N N 272 TYR CA CB sing N N 273 TYR CA HA sing N N 274 TYR C O doub N N 275 TYR C OXT sing N N 276 TYR CB CG sing N N 277 TYR CB HB2 sing N N 278 TYR CB HB3 sing N N 279 TYR CG CD1 doub Y N 280 TYR CG CD2 sing Y N 281 TYR CD1 CE1 sing Y N 282 TYR CD1 HD1 sing N N 283 TYR CD2 CE2 doub Y N 284 TYR CD2 HD2 sing N N 285 TYR CE1 CZ doub Y N 286 TYR CE1 HE1 sing N N 287 TYR CE2 CZ sing Y N 288 TYR CE2 HE2 sing N N 289 TYR CZ OH sing N N 290 TYR OH HH sing N N 291 TYR OXT HXT sing N N 292 VAL N CA sing N N 293 VAL N H sing N N 294 VAL N H2 sing N N 295 VAL CA C sing N N 296 VAL CA CB sing N N 297 VAL CA HA sing N N 298 VAL C O doub N N 299 VAL C OXT sing N N 300 VAL CB CG1 sing N N 301 VAL CB CG2 sing N N 302 VAL CB HB sing N N 303 VAL CG1 HG11 sing N N 304 VAL CG1 HG12 sing N N 305 VAL CG1 HG13 sing N N 306 VAL CG2 HG21 sing N N 307 VAL CG2 HG22 sing N N 308 VAL CG2 HG23 sing N N 309 VAL OXT HXT sing N N 310 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2YRK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_