data_2YS8 # _entry.id 2YS8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YS8 pdb_00002ys8 10.2210/pdb2ys8/pdb RCSB RCSB027068 ? ? WWPDB D_1000027068 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002022234.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2YS8 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-04-03 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Ohnishi, S.' 1 'Sato, M.' 2 'Koshiba, S.' 3 'Harada, T.' 4 'Watanabe, S.' 5 'Kigawa, T.' 6 'Yokoyama, S.' 7 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 8 # _citation.id primary _citation.title 'Solution structure of the DnaJ-like domain from human ras-associated protein Rap1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Ohnishi, S.' 1 ? primary 'Sato, M.' 2 ? primary 'Koshiba, S.' 3 ? primary 'Harada, T.' 4 ? primary 'Wanatabe, S.' 5 ? primary 'Kigawa, T.' 6 ? primary 'Yokoyama, S.' 7 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Rab-related GTP-binding protein RabJ' _entity.formula_weight 9463.651 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'DnaJ domain' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'RBJ protein, Ras-associated protein Rap1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALL KNIKSGPSSG ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGSSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALL KNIKSGPSSG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002022234.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 SER n 1 9 SER n 1 10 ALA n 1 11 SER n 1 12 PHE n 1 13 THR n 1 14 LYS n 1 15 GLU n 1 16 GLN n 1 17 ALA n 1 18 ASP n 1 19 ALA n 1 20 ILE n 1 21 ARG n 1 22 ARG n 1 23 ILE n 1 24 ARG n 1 25 ASN n 1 26 SER n 1 27 LYS n 1 28 ASP n 1 29 SER n 1 30 TRP n 1 31 ASP n 1 32 MET n 1 33 LEU n 1 34 GLY n 1 35 VAL n 1 36 LYS n 1 37 PRO n 1 38 GLY n 1 39 ALA n 1 40 SER n 1 41 ARG n 1 42 ASP n 1 43 GLU n 1 44 VAL n 1 45 ASN n 1 46 LYS n 1 47 ALA n 1 48 TYR n 1 49 ARG n 1 50 LYS n 1 51 LEU n 1 52 ALA n 1 53 VAL n 1 54 LEU n 1 55 LEU n 1 56 HIS n 1 57 PRO n 1 58 ASP n 1 59 LYS n 1 60 CYS n 1 61 VAL n 1 62 ALA n 1 63 PRO n 1 64 GLY n 1 65 SER n 1 66 GLU n 1 67 ASP n 1 68 ALA n 1 69 PHE n 1 70 LYS n 1 71 ALA n 1 72 VAL n 1 73 VAL n 1 74 ASN n 1 75 ALA n 1 76 ARG n 1 77 THR n 1 78 ALA n 1 79 LEU n 1 80 LEU n 1 81 LYS n 1 82 ASN n 1 83 ILE n 1 84 LYS n 1 85 SER n 1 86 GLY n 1 87 PRO n 1 88 SER n 1 89 SER n 1 90 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene RBJ _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050704-17 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9NZQ0_HUMAN _struct_ref.pdbx_db_accession Q9NZQ0 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SSASFTKEQADAIRRIRNSKDSWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKAVVNARTALLKNIK _struct_ref.pdbx_align_begin 197 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YS8 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 84 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9NZQ0 _struct_ref_seq.db_align_beg 197 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 273 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 84 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YS8 GLY A 1 ? UNP Q9NZQ0 ? ? 'expression tag' 1 1 1 2YS8 SER A 2 ? UNP Q9NZQ0 ? ? 'expression tag' 2 2 1 2YS8 SER A 3 ? UNP Q9NZQ0 ? ? 'expression tag' 3 3 1 2YS8 GLY A 4 ? UNP Q9NZQ0 ? ? 'expression tag' 4 4 1 2YS8 SER A 5 ? UNP Q9NZQ0 ? ? 'expression tag' 5 5 1 2YS8 SER A 6 ? UNP Q9NZQ0 ? ? 'expression tag' 6 6 1 2YS8 GLY A 7 ? UNP Q9NZQ0 ? ? 'expression tag' 7 7 1 2YS8 SER A 85 ? UNP Q9NZQ0 ? ? 'expression tag' 85 8 1 2YS8 GLY A 86 ? UNP Q9NZQ0 ? ? 'expression tag' 86 9 1 2YS8 PRO A 87 ? UNP Q9NZQ0 ? ? 'expression tag' 87 10 1 2YS8 SER A 88 ? UNP Q9NZQ0 ? ? 'expression tag' 88 11 1 2YS8 SER A 89 ? UNP Q9NZQ0 ? ? 'expression tag' 89 12 1 2YS8 GLY A 90 ? UNP Q9NZQ0 ? ? 'expression tag' 90 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.0mM sample U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 700 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YS8 _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,target function' _pdbx_nmr_ensemble.entry_id 2YS8 _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YS8 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2YS8 _exptl.crystals_number ? # _struct.entry_id 2YS8 _struct.title 'Solution structure of the DnaJ-like domain from human ras-associated protein Rap1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag N _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YS8 _struct_keywords.text ;DnaJ domain, Ras-associated protein Rap1, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING ; _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 13 ? ASN A 25 ? THR A 13 ASN A 25 1 ? 13 HELX_P HELX_P2 2 ASP A 28 ? GLY A 34 ? ASP A 28 GLY A 34 1 ? 7 HELX_P HELX_P3 3 SER A 40 ? HIS A 56 ? SER A 40 HIS A 56 1 ? 17 HELX_P HELX_P4 4 GLY A 64 ? LYS A 84 ? GLY A 64 LYS A 84 1 ? 21 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 2YS8 _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 ARG 21 21 21 ARG ARG A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 LYS 27 27 27 LYS LYS A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 TRP 30 30 30 TRP TRP A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 MET 32 32 32 MET MET A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 PRO 37 37 37 PRO PRO A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 SER 40 40 40 SER SER A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 TYR 48 48 48 TYR TYR A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 LYS 59 59 59 LYS LYS A . n A 1 60 CYS 60 60 60 CYS CYS A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 GLY 64 64 64 GLY GLY A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 ALA 68 68 68 ALA ALA A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 VAL 72 72 72 VAL VAL A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 ALA 75 75 75 ALA ALA A . n A 1 76 ARG 76 76 76 ARG ARG A . n A 1 77 THR 77 77 77 THR THR A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ASN 82 82 82 ASN ASN A . n A 1 83 ILE 83 83 83 ILE ILE A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 SER 88 88 88 SER SER A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLY 90 90 90 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 37 ? ? -69.74 3.14 2 2 PRO A 37 ? ? -69.72 3.68 3 2 LYS A 84 ? ? -37.24 -37.78 4 2 PRO A 87 ? ? -69.75 2.62 5 3 ALA A 10 ? ? -90.03 -61.20 6 3 PRO A 37 ? ? -69.79 0.47 7 3 LYS A 81 ? ? -39.56 -39.83 8 3 ILE A 83 ? ? -49.66 -18.08 9 3 SER A 85 ? ? -52.08 176.76 10 3 PRO A 87 ? ? -69.83 83.95 11 4 LYS A 81 ? ? -38.69 -38.74 12 4 PRO A 87 ? ? -69.76 2.30 13 5 PRO A 37 ? ? -69.71 3.56 14 6 SER A 9 ? ? -95.57 -60.30 15 6 SER A 65 ? ? -38.79 -39.35 16 7 PRO A 37 ? ? -69.74 2.46 17 8 SER A 11 ? ? -52.12 178.02 18 8 ALA A 39 ? ? -56.29 178.02 19 8 PRO A 87 ? ? -69.81 94.59 20 9 PRO A 37 ? ? -69.82 3.01 21 9 PRO A 57 ? ? -69.77 1.26 22 9 ILE A 83 ? ? -58.97 109.64 23 11 PRO A 37 ? ? -69.75 0.10 24 11 LYS A 81 ? ? -39.62 -39.69 25 12 PRO A 87 ? ? -69.68 2.84 26 13 SER A 85 ? ? -92.93 -62.54 27 13 PRO A 87 ? ? -69.75 1.34 28 14 PRO A 37 ? ? -69.77 3.02 29 14 PRO A 87 ? ? -69.76 87.60 30 15 ALA A 39 ? ? -54.90 177.49 31 17 PRO A 87 ? ? -69.79 -173.64 32 18 SER A 11 ? ? -52.10 178.03 33 18 ALA A 39 ? ? -57.50 172.23 34 20 ALA A 39 ? ? -53.49 179.04 35 20 PRO A 87 ? ? -69.75 98.22 #