data_2YSR # _entry.id 2YSR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YSR pdb_00002ysr 10.2210/pdb2ysr/pdb RCSB RCSB027087 ? ? WWPDB D_1000027087 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hss001104035.1 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 2YSR _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-04-03 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Zhang, H.P.' 1 'Hayahsi, F.' 2 'Yokoyama, S.' 3 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 4 # _citation.id primary _citation.title 'Solution structure of the DEP domain from human DEP domain-containing protein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Zhang, H.P.' 1 ? primary 'Hayashi, F.' 2 ? primary 'Yokoyama, S.' 3 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'DEP domain-containing protein 1' _entity.formula_weight 12182.655 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'DEP domain' _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSSGSSGYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQQTIQLLRKFLKNH VIEDIKGRWGSENVDDNNQLFRFPA ; _entity_poly.pdbx_seq_one_letter_code_can ;GSSGSSGYRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQQTIQLLRKFLKNH VIEDIKGRWGSENVDDNNQLFRFPA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hss001104035.1 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 TYR n 1 9 ARG n 1 10 ALA n 1 11 THR n 1 12 LYS n 1 13 LEU n 1 14 TRP n 1 15 ASN n 1 16 GLU n 1 17 VAL n 1 18 THR n 1 19 THR n 1 20 SER n 1 21 PHE n 1 22 ARG n 1 23 ALA n 1 24 GLY n 1 25 MET n 1 26 PRO n 1 27 LEU n 1 28 ARG n 1 29 LYS n 1 30 HIS n 1 31 ARG n 1 32 GLN n 1 33 HIS n 1 34 PHE n 1 35 LYS n 1 36 LYS n 1 37 TYR n 1 38 GLY n 1 39 ASN n 1 40 CYS n 1 41 PHE n 1 42 THR n 1 43 ALA n 1 44 GLY n 1 45 GLU n 1 46 ALA n 1 47 VAL n 1 48 ASP n 1 49 TRP n 1 50 LEU n 1 51 TYR n 1 52 ASP n 1 53 LEU n 1 54 LEU n 1 55 ARG n 1 56 ASN n 1 57 ASN n 1 58 SER n 1 59 ASN n 1 60 PHE n 1 61 GLY n 1 62 PRO n 1 63 GLU n 1 64 VAL n 1 65 THR n 1 66 ARG n 1 67 GLN n 1 68 GLN n 1 69 THR n 1 70 ILE n 1 71 GLN n 1 72 LEU n 1 73 LEU n 1 74 ARG n 1 75 LYS n 1 76 PHE n 1 77 LEU n 1 78 LYS n 1 79 ASN n 1 80 HIS n 1 81 VAL n 1 82 ILE n 1 83 GLU n 1 84 ASP n 1 85 ILE n 1 86 LYS n 1 87 GLY n 1 88 ARG n 1 89 TRP n 1 90 GLY n 1 91 SER n 1 92 GLU n 1 93 ASN n 1 94 VAL n 1 95 ASP n 1 96 ASP n 1 97 ASN n 1 98 ASN n 1 99 GLN n 1 100 LEU n 1 101 PHE n 1 102 ARG n 1 103 PHE n 1 104 PRO n 1 105 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene DEPDC1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060904-15 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5TB30_HUMAN _struct_ref.pdbx_db_accession Q5TB30 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;YRATKLWNEVTTSFRAGMPLRKHRQHFKKYGNCFTAGEAVDWLYDLLRNNSNFGPEVTRQQTIQLLRKFLKNHVIEDIKG RWGSENVDDNNQLFRFPA ; _struct_ref.pdbx_align_begin 11 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YSR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 105 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5TB30 _struct_ref_seq.db_align_beg 11 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 105 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YSR GLY A 1 ? UNP Q5TB30 ? ? 'expression tag' 1 1 1 2YSR SER A 2 ? UNP Q5TB30 ? ? 'expression tag' 2 2 1 2YSR SER A 3 ? UNP Q5TB30 ? ? 'expression tag' 3 3 1 2YSR GLY A 4 ? UNP Q5TB30 ? ? 'expression tag' 4 4 1 2YSR SER A 5 ? UNP Q5TB30 ? ? 'expression tag' 5 5 1 2YSR SER A 6 ? UNP Q5TB30 ? ? 'expression tag' 6 6 1 2YSR GLY A 7 ? UNP Q5TB30 ? ? 'expression tag' 7 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '0.65mM 13C, 15N-labeled protein; 20mM d-Tris-HCl(pH7.0); 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.type 1 Varian INOVA 800 ? 2 Varian INOVA 900 ? # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YSR _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_details.entry_id 2YSR _pdbx_nmr_details.text 'spectrometer_id for 3D_15N_deparated_NOESY; spectrometer_id 2 for 3D_13C_separated_NOESY' # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,structures with the lowest energy,target function' _pdbx_nmr_ensemble.entry_id 2YSR _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YSR # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection VNMR 6.1C Varian 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9818 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2YSR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2YSR _struct.title 'Solution structure of the DEP domain from human DEP domain-containing protein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YSR _struct_keywords.text ;DEP domain; DEP domain containing 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN ; _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 7 ? GLY A 24 ? GLY A 7 GLY A 24 1 ? 18 HELX_P HELX_P2 2 ALA A 43 ? ASN A 57 ? ALA A 43 ASN A 57 1 ? 15 HELX_P HELX_P3 3 THR A 65 ? ASN A 79 ? THR A 65 ASN A 79 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 PHE A 41 ? THR A 42 ? PHE A 41 THR A 42 A 2 LEU A 100 ? ARG A 102 ? LEU A 100 ARG A 102 A 3 GLU A 83 ? ASP A 84 ? GLU A 83 ASP A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 41 ? N PHE A 41 O PHE A 101 ? O PHE A 101 A 2 3 O ARG A 102 ? O ARG A 102 N GLU A 83 ? N GLU A 83 # _atom_sites.entry_id 2YSR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 TYR 8 8 8 TYR TYR A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 ASN 15 15 15 ASN ASN A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 VAL 17 17 17 VAL VAL A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 SER 20 20 20 SER SER A . n A 1 21 PHE 21 21 21 PHE PHE A . n A 1 22 ARG 22 22 22 ARG ARG A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 HIS 30 30 30 HIS HIS A . n A 1 31 ARG 31 31 31 ARG ARG A . n A 1 32 GLN 32 32 32 GLN GLN A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 PHE 34 34 34 PHE PHE A . n A 1 35 LYS 35 35 35 LYS LYS A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 TYR 37 37 37 TYR TYR A . n A 1 38 GLY 38 38 38 GLY GLY A . n A 1 39 ASN 39 39 39 ASN ASN A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 PHE 41 41 41 PHE PHE A . n A 1 42 THR 42 42 42 THR THR A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 GLU 45 45 45 GLU GLU A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 TRP 49 49 49 TRP TRP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 ASN 56 56 56 ASN ASN A . n A 1 57 ASN 57 57 57 ASN ASN A . n A 1 58 SER 58 58 58 SER SER A . n A 1 59 ASN 59 59 59 ASN ASN A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 PRO 62 62 62 PRO PRO A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 GLN 67 67 67 GLN GLN A . n A 1 68 GLN 68 68 68 GLN GLN A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ARG 74 74 74 ARG ARG A . n A 1 75 LYS 75 75 75 LYS LYS A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 HIS 80 80 80 HIS HIS A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 GLU 83 83 83 GLU GLU A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 TRP 89 89 89 TRP TRP A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 ASP 96 96 96 ASP ASP A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 PHE 101 101 101 PHE PHE A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 PRO 104 104 104 PRO PRO A . n A 1 105 ALA 105 105 105 ALA ALA A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_struct_assembly 4 3 'Structure model' pdbx_struct_oper_list 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 104 ? ? -69.69 -174.93 2 2 PRO A 26 ? ? -69.74 -178.16 3 2 ASN A 97 ? ? -57.21 177.17 4 3 GLN A 32 ? ? -55.85 102.07 5 4 PRO A 26 ? ? -69.78 -176.80 6 5 PRO A 26 ? ? -69.71 6.24 7 5 ARG A 28 ? ? -97.92 -67.55 8 5 PRO A 62 ? ? -69.80 2.96 9 5 ILE A 85 ? ? -39.76 -34.29 10 5 ASN A 97 ? ? -54.16 178.58 11 6 GLN A 99 ? ? -55.05 102.91 12 7 ASN A 93 ? ? -58.26 102.98 13 7 ASN A 97 ? ? -56.47 178.86 14 8 ASN A 39 ? ? -58.06 106.79 15 8 PRO A 62 ? ? -69.82 3.03 16 8 ASP A 96 ? ? -52.12 101.98 17 8 GLN A 99 ? ? -53.64 102.46 18 8 PRO A 104 ? ? -69.76 -177.78 19 9 PRO A 26 ? ? -69.79 -175.40 20 9 HIS A 30 ? ? -91.47 -63.84 21 9 PHE A 34 ? ? -59.75 178.46 22 9 LYS A 36 ? ? -52.02 175.02 23 9 ASN A 97 ? ? -53.57 178.12 24 10 PRO A 104 ? ? -69.76 -172.39 25 11 ILE A 85 ? ? -38.72 -34.76 26 12 MET A 25 ? ? -52.06 107.35 27 12 PRO A 26 ? ? -69.75 6.85 28 12 LYS A 35 ? ? -59.95 102.30 29 12 ASN A 57 ? ? -56.95 174.16 30 13 PRO A 62 ? ? -69.74 3.02 31 13 ASN A 97 ? ? -57.47 172.77 32 13 GLN A 99 ? ? -58.41 108.16 33 14 GLN A 32 ? ? -54.29 109.10 34 14 PHE A 34 ? ? -53.35 175.79 35 14 ASN A 39 ? ? -52.22 103.96 36 14 PRO A 62 ? ? -69.74 2.92 37 15 LYS A 35 ? ? -52.17 102.04 38 15 TRP A 89 ? ? -57.97 104.85 39 15 ASN A 97 ? ? -56.81 178.28 40 16 PRO A 26 ? ? -69.70 3.55 41 16 LYS A 35 ? ? -56.67 101.97 42 16 ASN A 97 ? ? -58.40 178.09 43 17 PRO A 26 ? ? -69.74 -175.14 44 17 LEU A 73 ? ? -38.99 -37.76 45 17 ASN A 97 ? ? -54.55 178.81 46 18 ASN A 93 ? ? -52.08 103.88 47 18 PRO A 104 ? ? -69.82 -173.57 48 19 LYS A 36 ? ? -52.31 179.96 49 19 ILE A 85 ? ? -39.97 -34.81 50 19 PRO A 104 ? ? -69.80 -172.67 51 20 GLN A 32 ? ? -58.49 171.78 52 20 ASP A 84 ? ? -54.90 177.68 53 20 ASN A 93 ? ? -53.54 101.98 54 20 ASN A 97 ? ? -91.68 -64.78 #