data_2YTS # _entry.id 2YTS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YTS pdb_00002yts 10.2210/pdb2yts/pdb RCSB RCSB027124 ? ? WWPDB D_1000027124 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 2YTS _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.recvd_initial_deposition_date 2007-04-05 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso003006001.13 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tochio, N.' 1 'Tomizawa, T.' 2 'Abe, H.' 3 'Saito, K.' 4 'Li, H.' 5 'Sato, M.' 6 'Koshiba, S.' 7 'Kobayashi, N.' 8 'Kigawa, T.' 9 'Yokoyama, S.' 10 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 11 # _citation.id primary _citation.title 'Solution structure of the C2H2 type zinc finger (region 715-747) of human Zinc finger protein 484' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tochio, N.' 1 ? primary 'Tomizawa, T.' 2 ? primary 'Abe, H.' 3 ? primary 'Saito, K.' 4 ? primary 'Li, H.' 5 ? primary 'Sato, M.' 6 ? primary 'Koshiba, S.' 7 ? primary 'Kobayashi, N.' 8 ? primary 'Kigawa, T.' 9 ? primary 'Yokoyama, S.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Zinc finger protein 484' 4867.362 1 ? ? zf-C2H2 ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGTGEKPYICNECGKSFIQKSHLNRHRRIHTGEKPSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGTGEKPYICNECGKSFIQKSHLNRHRRIHTGEKPSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso003006001.13 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 THR n 1 9 GLY n 1 10 GLU n 1 11 LYS n 1 12 PRO n 1 13 TYR n 1 14 ILE n 1 15 CYS n 1 16 ASN n 1 17 GLU n 1 18 CYS n 1 19 GLY n 1 20 LYS n 1 21 SER n 1 22 PHE n 1 23 ILE n 1 24 GLN n 1 25 LYS n 1 26 SER n 1 27 HIS n 1 28 LEU n 1 29 ASN n 1 30 ARG n 1 31 HIS n 1 32 ARG n 1 33 ARG n 1 34 ILE n 1 35 HIS n 1 36 THR n 1 37 GLY n 1 38 GLU n 1 39 LYS n 1 40 PRO n 1 41 SER n 1 42 GLY n 1 43 PRO n 1 44 SER n 1 45 SER n 1 46 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZNF484 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P070207-02 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 PRO 12 12 12 PRO PRO A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 CYS 15 15 15 CYS CYS A . n A 1 16 ASN 16 16 16 ASN ASN A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 PHE 22 22 22 PHE PHE A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 LEU 28 28 28 LEU LEU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ARG 30 30 30 ARG ARG A . n A 1 31 HIS 31 31 31 HIS HIS A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 HIS 35 35 35 HIS HIS A . n A 1 36 THR 36 36 36 THR THR A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 LYS 39 39 39 LYS LYS A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 GLY 46 46 46 GLY GLY A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 201 _pdbx_nonpoly_scheme.auth_seq_num 201 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _exptl.method 'SOLUTION NMR' _exptl.entry_id 2YTS _exptl.crystals_number ? # _struct.entry_id 2YTS _struct.title 'Solution structure of the C2H2 type zinc finger (region 715-747) of human Zinc finger protein 484' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YTS _struct_keywords.text ;zf-C2H2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION ; _struct_keywords.pdbx_keywords TRANSCRIPTION # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZN484_HUMAN _struct_ref.pdbx_db_accession Q5JVG2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code TGEKPYICNECGKSFIQKSHLNRHRRIHTGEKP _struct_ref.pdbx_align_begin 715 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YTS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 40 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5JVG2 _struct_ref_seq.db_align_beg 715 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 747 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 40 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YTS GLY A 1 ? UNP Q5JVG2 ? ? 'expression tag' 1 1 1 2YTS SER A 2 ? UNP Q5JVG2 ? ? 'expression tag' 2 2 1 2YTS SER A 3 ? UNP Q5JVG2 ? ? 'expression tag' 3 3 1 2YTS GLY A 4 ? UNP Q5JVG2 ? ? 'expression tag' 4 4 1 2YTS SER A 5 ? UNP Q5JVG2 ? ? 'expression tag' 5 5 1 2YTS SER A 6 ? UNP Q5JVG2 ? ? 'expression tag' 6 6 1 2YTS GLY A 7 ? UNP Q5JVG2 ? ? 'expression tag' 7 7 1 2YTS SER A 41 ? UNP Q5JVG2 ? ? 'expression tag' 41 8 1 2YTS GLY A 42 ? UNP Q5JVG2 ? ? 'expression tag' 42 9 1 2YTS PRO A 43 ? UNP Q5JVG2 ? ? 'expression tag' 43 10 1 2YTS SER A 44 ? UNP Q5JVG2 ? ? 'expression tag' 44 11 1 2YTS SER A 45 ? UNP Q5JVG2 ? ? 'expression tag' 45 12 1 2YTS GLY A 46 ? UNP Q5JVG2 ? ? 'expression tag' 46 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLN A 24 ? ARG A 32 ? GLN A 24 ARG A 32 1 ? 9 HELX_P HELX_P2 2 ARG A 33 ? HIS A 35 ? ARG A 33 HIS A 35 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 15 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 15 A ZN 201 1_555 ? ? ? ? ? ? ? 2.387 ? ? metalc2 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.247 ? ? metalc3 metalc ? ? A HIS 31 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 31 A ZN 201 1_555 ? ? ? ? ? ? ? 2.098 ? ? metalc4 metalc ? ? A HIS 35 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 35 A ZN 201 1_555 ? ? ? ? ? ? ? 2.101 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 18 ? A CYS 18 ? 1_555 111.3 ? 2 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 108.5 ? 3 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 100.0 ? 4 SG ? A CYS 15 ? A CYS 15 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 105.1 ? 5 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 113.9 ? 6 NE2 ? A HIS 31 ? A HIS 31 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 35 ? A HIS 35 ? 1_555 118.1 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 TYR A 13 ? ILE A 14 ? TYR A 13 ILE A 14 A 2 SER A 21 ? PHE A 22 ? SER A 21 PHE A 22 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id TYR _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 13 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 13 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id PHE _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 22 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id PHE _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 22 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 15 ? CYS A 15 . ? 1_555 ? 2 AC1 4 CYS A 18 ? CYS A 18 . ? 1_555 ? 3 AC1 4 HIS A 31 ? HIS A 31 . ? 1_555 ? 4 AC1 4 HIS A 35 ? HIS A 35 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 44 ? ? 37.81 37.55 2 2 HIS A 35 ? ? -80.76 -70.77 3 2 THR A 36 ? ? -52.27 94.64 4 2 LYS A 39 ? ? -34.45 143.88 5 2 SER A 45 ? ? -85.54 48.60 6 3 GLU A 10 ? ? 34.43 44.16 7 3 PRO A 40 ? ? -69.76 -167.25 8 3 PRO A 43 ? ? -69.77 -172.38 9 4 GLU A 10 ? ? -107.83 44.87 10 4 HIS A 35 ? ? -98.10 -70.19 11 5 GLU A 10 ? ? -92.73 42.84 12 5 THR A 36 ? ? -39.12 119.01 13 5 PRO A 43 ? ? -69.74 85.98 14 5 SER A 45 ? ? -104.70 -60.12 15 6 SER A 6 ? ? -54.84 170.08 16 6 GLU A 38 ? ? -88.57 43.27 17 6 LYS A 39 ? ? -174.61 139.38 18 6 PRO A 40 ? ? -69.77 95.77 19 7 THR A 36 ? ? -47.36 151.80 20 8 GLU A 10 ? ? -87.83 39.67 21 8 ASN A 29 ? ? -39.94 -38.55 22 8 HIS A 35 ? ? -79.73 -71.36 23 8 GLU A 38 ? ? -44.09 99.23 24 8 PRO A 40 ? ? -69.74 2.77 25 9 SER A 5 ? ? 37.90 42.36 26 9 ILE A 34 ? ? -33.78 -36.09 27 9 THR A 36 ? ? -81.53 40.52 28 10 LYS A 11 ? ? -35.46 138.68 29 10 HIS A 35 ? ? -101.52 47.34 30 10 GLU A 38 ? ? -102.06 49.09 31 10 SER A 41 ? ? -95.16 -64.94 32 10 PRO A 43 ? ? -69.75 -178.67 33 11 PRO A 40 ? ? -69.77 2.69 34 11 SER A 41 ? ? -39.44 139.31 35 11 PRO A 43 ? ? -69.68 2.19 36 12 HIS A 35 ? ? -91.35 -61.62 37 12 THR A 36 ? ? -60.52 99.16 38 13 GLU A 10 ? ? -109.73 44.19 39 13 ARG A 32 ? ? -46.71 -19.62 40 13 ILE A 34 ? ? -35.30 -32.33 41 13 THR A 36 ? ? 36.53 37.99 42 13 LYS A 39 ? ? -118.22 79.49 43 13 PRO A 40 ? ? -69.77 89.82 44 14 CYS A 15 ? ? -44.32 157.26 45 14 HIS A 35 ? ? -98.05 48.46 46 14 LYS A 39 ? ? -172.98 139.82 47 15 SER A 6 ? ? -103.78 -61.44 48 15 ILE A 34 ? ? -35.01 -32.77 49 15 THR A 36 ? ? -56.66 105.78 50 15 GLU A 38 ? ? -108.77 43.20 51 16 SER A 3 ? ? -174.30 120.04 52 16 LYS A 25 ? ? -49.53 -19.14 53 16 SER A 41 ? ? -54.76 -70.60 54 16 SER A 44 ? ? -34.69 102.46 55 17 SER A 3 ? ? -46.52 163.38 56 17 CYS A 15 ? ? -49.13 165.15 57 17 ILE A 34 ? ? -35.30 -35.34 58 17 HIS A 35 ? ? -82.04 42.44 59 17 GLU A 38 ? ? 39.62 41.88 60 18 SER A 2 ? ? -85.60 46.68 61 18 SER A 3 ? ? 38.85 43.47 62 18 ILE A 34 ? ? -36.05 -30.69 63 18 HIS A 35 ? ? -92.57 44.17 64 18 PRO A 40 ? ? -69.78 85.27 65 18 SER A 41 ? ? 34.28 46.74 66 19 THR A 8 ? ? -38.53 107.87 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.entry_id 2YTS _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' _pdbx_nmr_representative.entry_id 2YTS # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents 'about 1.0mM sample U-15N,13C; 20mM d-Tris-HCl; 100mM NaCl; 0.05mM ZnCl2; 1mM IDA; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type 1 1 1 3D_13C-separated_NOESY 2 1 1 3D_15N-separated_NOESY # _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.entry_id 2YTS _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20030801 'Delaglio, F.' 2 'data analysis' NMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9820 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 CYS N N N N 45 CYS CA C N R 46 CYS C C N N 47 CYS O O N N 48 CYS CB C N N 49 CYS SG S N N 50 CYS OXT O N N 51 CYS H H N N 52 CYS H2 H N N 53 CYS HA H N N 54 CYS HB2 H N N 55 CYS HB3 H N N 56 CYS HG H N N 57 CYS HXT H N N 58 GLN N N N N 59 GLN CA C N S 60 GLN C C N N 61 GLN O O N N 62 GLN CB C N N 63 GLN CG C N N 64 GLN CD C N N 65 GLN OE1 O N N 66 GLN NE2 N N N 67 GLN OXT O N N 68 GLN H H N N 69 GLN H2 H N N 70 GLN HA H N N 71 GLN HB2 H N N 72 GLN HB3 H N N 73 GLN HG2 H N N 74 GLN HG3 H N N 75 GLN HE21 H N N 76 GLN HE22 H N N 77 GLN HXT H N N 78 GLU N N N N 79 GLU CA C N S 80 GLU C C N N 81 GLU O O N N 82 GLU CB C N N 83 GLU CG C N N 84 GLU CD C N N 85 GLU OE1 O N N 86 GLU OE2 O N N 87 GLU OXT O N N 88 GLU H H N N 89 GLU H2 H N N 90 GLU HA H N N 91 GLU HB2 H N N 92 GLU HB3 H N N 93 GLU HG2 H N N 94 GLU HG3 H N N 95 GLU HE2 H N N 96 GLU HXT H N N 97 GLY N N N N 98 GLY CA C N N 99 GLY C C N N 100 GLY O O N N 101 GLY OXT O N N 102 GLY H H N N 103 GLY H2 H N N 104 GLY HA2 H N N 105 GLY HA3 H N N 106 GLY HXT H N N 107 HIS N N N N 108 HIS CA C N S 109 HIS C C N N 110 HIS O O N N 111 HIS CB C N N 112 HIS CG C Y N 113 HIS ND1 N Y N 114 HIS CD2 C Y N 115 HIS CE1 C Y N 116 HIS NE2 N Y N 117 HIS OXT O N N 118 HIS H H N N 119 HIS H2 H N N 120 HIS HA H N N 121 HIS HB2 H N N 122 HIS HB3 H N N 123 HIS HD1 H N N 124 HIS HD2 H N N 125 HIS HE1 H N N 126 HIS HE2 H N N 127 HIS HXT H N N 128 ILE N N N N 129 ILE CA C N S 130 ILE C C N N 131 ILE O O N N 132 ILE CB C N S 133 ILE CG1 C N N 134 ILE CG2 C N N 135 ILE CD1 C N N 136 ILE OXT O N N 137 ILE H H N N 138 ILE H2 H N N 139 ILE HA H N N 140 ILE HB H N N 141 ILE HG12 H N N 142 ILE HG13 H N N 143 ILE HG21 H N N 144 ILE HG22 H N N 145 ILE HG23 H N N 146 ILE HD11 H N N 147 ILE HD12 H N N 148 ILE HD13 H N N 149 ILE HXT H N N 150 LEU N N N N 151 LEU CA C N S 152 LEU C C N N 153 LEU O O N N 154 LEU CB C N N 155 LEU CG C N N 156 LEU CD1 C N N 157 LEU CD2 C N N 158 LEU OXT O N N 159 LEU H H N N 160 LEU H2 H N N 161 LEU HA H N N 162 LEU HB2 H N N 163 LEU HB3 H N N 164 LEU HG H N N 165 LEU HD11 H N N 166 LEU HD12 H N N 167 LEU HD13 H N N 168 LEU HD21 H N N 169 LEU HD22 H N N 170 LEU HD23 H N N 171 LEU HXT H N N 172 LYS N N N N 173 LYS CA C N S 174 LYS C C N N 175 LYS O O N N 176 LYS CB C N N 177 LYS CG C N N 178 LYS CD C N N 179 LYS CE C N N 180 LYS NZ N N N 181 LYS OXT O N N 182 LYS H H N N 183 LYS H2 H N N 184 LYS HA H N N 185 LYS HB2 H N N 186 LYS HB3 H N N 187 LYS HG2 H N N 188 LYS HG3 H N N 189 LYS HD2 H N N 190 LYS HD3 H N N 191 LYS HE2 H N N 192 LYS HE3 H N N 193 LYS HZ1 H N N 194 LYS HZ2 H N N 195 LYS HZ3 H N N 196 LYS HXT H N N 197 PHE N N N N 198 PHE CA C N S 199 PHE C C N N 200 PHE O O N N 201 PHE CB C N N 202 PHE CG C Y N 203 PHE CD1 C Y N 204 PHE CD2 C Y N 205 PHE CE1 C Y N 206 PHE CE2 C Y N 207 PHE CZ C Y N 208 PHE OXT O N N 209 PHE H H N N 210 PHE H2 H N N 211 PHE HA H N N 212 PHE HB2 H N N 213 PHE HB3 H N N 214 PHE HD1 H N N 215 PHE HD2 H N N 216 PHE HE1 H N N 217 PHE HE2 H N N 218 PHE HZ H N N 219 PHE HXT H N N 220 PRO N N N N 221 PRO CA C N S 222 PRO C C N N 223 PRO O O N N 224 PRO CB C N N 225 PRO CG C N N 226 PRO CD C N N 227 PRO OXT O N N 228 PRO H H N N 229 PRO HA H N N 230 PRO HB2 H N N 231 PRO HB3 H N N 232 PRO HG2 H N N 233 PRO HG3 H N N 234 PRO HD2 H N N 235 PRO HD3 H N N 236 PRO HXT H N N 237 SER N N N N 238 SER CA C N S 239 SER C C N N 240 SER O O N N 241 SER CB C N N 242 SER OG O N N 243 SER OXT O N N 244 SER H H N N 245 SER H2 H N N 246 SER HA H N N 247 SER HB2 H N N 248 SER HB3 H N N 249 SER HG H N N 250 SER HXT H N N 251 THR N N N N 252 THR CA C N S 253 THR C C N N 254 THR O O N N 255 THR CB C N R 256 THR OG1 O N N 257 THR CG2 C N N 258 THR OXT O N N 259 THR H H N N 260 THR H2 H N N 261 THR HA H N N 262 THR HB H N N 263 THR HG1 H N N 264 THR HG21 H N N 265 THR HG22 H N N 266 THR HG23 H N N 267 THR HXT H N N 268 TYR N N N N 269 TYR CA C N S 270 TYR C C N N 271 TYR O O N N 272 TYR CB C N N 273 TYR CG C Y N 274 TYR CD1 C Y N 275 TYR CD2 C Y N 276 TYR CE1 C Y N 277 TYR CE2 C Y N 278 TYR CZ C Y N 279 TYR OH O N N 280 TYR OXT O N N 281 TYR H H N N 282 TYR H2 H N N 283 TYR HA H N N 284 TYR HB2 H N N 285 TYR HB3 H N N 286 TYR HD1 H N N 287 TYR HD2 H N N 288 TYR HE1 H N N 289 TYR HE2 H N N 290 TYR HH H N N 291 TYR HXT H N N 292 ZN ZN ZN N N 293 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 CYS N CA sing N N 43 CYS N H sing N N 44 CYS N H2 sing N N 45 CYS CA C sing N N 46 CYS CA CB sing N N 47 CYS CA HA sing N N 48 CYS C O doub N N 49 CYS C OXT sing N N 50 CYS CB SG sing N N 51 CYS CB HB2 sing N N 52 CYS CB HB3 sing N N 53 CYS SG HG sing N N 54 CYS OXT HXT sing N N 55 GLN N CA sing N N 56 GLN N H sing N N 57 GLN N H2 sing N N 58 GLN CA C sing N N 59 GLN CA CB sing N N 60 GLN CA HA sing N N 61 GLN C O doub N N 62 GLN C OXT sing N N 63 GLN CB CG sing N N 64 GLN CB HB2 sing N N 65 GLN CB HB3 sing N N 66 GLN CG CD sing N N 67 GLN CG HG2 sing N N 68 GLN CG HG3 sing N N 69 GLN CD OE1 doub N N 70 GLN CD NE2 sing N N 71 GLN NE2 HE21 sing N N 72 GLN NE2 HE22 sing N N 73 GLN OXT HXT sing N N 74 GLU N CA sing N N 75 GLU N H sing N N 76 GLU N H2 sing N N 77 GLU CA C sing N N 78 GLU CA CB sing N N 79 GLU CA HA sing N N 80 GLU C O doub N N 81 GLU C OXT sing N N 82 GLU CB CG sing N N 83 GLU CB HB2 sing N N 84 GLU CB HB3 sing N N 85 GLU CG CD sing N N 86 GLU CG HG2 sing N N 87 GLU CG HG3 sing N N 88 GLU CD OE1 doub N N 89 GLU CD OE2 sing N N 90 GLU OE2 HE2 sing N N 91 GLU OXT HXT sing N N 92 GLY N CA sing N N 93 GLY N H sing N N 94 GLY N H2 sing N N 95 GLY CA C sing N N 96 GLY CA HA2 sing N N 97 GLY CA HA3 sing N N 98 GLY C O doub N N 99 GLY C OXT sing N N 100 GLY OXT HXT sing N N 101 HIS N CA sing N N 102 HIS N H sing N N 103 HIS N H2 sing N N 104 HIS CA C sing N N 105 HIS CA CB sing N N 106 HIS CA HA sing N N 107 HIS C O doub N N 108 HIS C OXT sing N N 109 HIS CB CG sing N N 110 HIS CB HB2 sing N N 111 HIS CB HB3 sing N N 112 HIS CG ND1 sing Y N 113 HIS CG CD2 doub Y N 114 HIS ND1 CE1 doub Y N 115 HIS ND1 HD1 sing N N 116 HIS CD2 NE2 sing Y N 117 HIS CD2 HD2 sing N N 118 HIS CE1 NE2 sing Y N 119 HIS CE1 HE1 sing N N 120 HIS NE2 HE2 sing N N 121 HIS OXT HXT sing N N 122 ILE N CA sing N N 123 ILE N H sing N N 124 ILE N H2 sing N N 125 ILE CA C sing N N 126 ILE CA CB sing N N 127 ILE CA HA sing N N 128 ILE C O doub N N 129 ILE C OXT sing N N 130 ILE CB CG1 sing N N 131 ILE CB CG2 sing N N 132 ILE CB HB sing N N 133 ILE CG1 CD1 sing N N 134 ILE CG1 HG12 sing N N 135 ILE CG1 HG13 sing N N 136 ILE CG2 HG21 sing N N 137 ILE CG2 HG22 sing N N 138 ILE CG2 HG23 sing N N 139 ILE CD1 HD11 sing N N 140 ILE CD1 HD12 sing N N 141 ILE CD1 HD13 sing N N 142 ILE OXT HXT sing N N 143 LEU N CA sing N N 144 LEU N H sing N N 145 LEU N H2 sing N N 146 LEU CA C sing N N 147 LEU CA CB sing N N 148 LEU CA HA sing N N 149 LEU C O doub N N 150 LEU C OXT sing N N 151 LEU CB CG sing N N 152 LEU CB HB2 sing N N 153 LEU CB HB3 sing N N 154 LEU CG CD1 sing N N 155 LEU CG CD2 sing N N 156 LEU CG HG sing N N 157 LEU CD1 HD11 sing N N 158 LEU CD1 HD12 sing N N 159 LEU CD1 HD13 sing N N 160 LEU CD2 HD21 sing N N 161 LEU CD2 HD22 sing N N 162 LEU CD2 HD23 sing N N 163 LEU OXT HXT sing N N 164 LYS N CA sing N N 165 LYS N H sing N N 166 LYS N H2 sing N N 167 LYS CA C sing N N 168 LYS CA CB sing N N 169 LYS CA HA sing N N 170 LYS C O doub N N 171 LYS C OXT sing N N 172 LYS CB CG sing N N 173 LYS CB HB2 sing N N 174 LYS CB HB3 sing N N 175 LYS CG CD sing N N 176 LYS CG HG2 sing N N 177 LYS CG HG3 sing N N 178 LYS CD CE sing N N 179 LYS CD HD2 sing N N 180 LYS CD HD3 sing N N 181 LYS CE NZ sing N N 182 LYS CE HE2 sing N N 183 LYS CE HE3 sing N N 184 LYS NZ HZ1 sing N N 185 LYS NZ HZ2 sing N N 186 LYS NZ HZ3 sing N N 187 LYS OXT HXT sing N N 188 PHE N CA sing N N 189 PHE N H sing N N 190 PHE N H2 sing N N 191 PHE CA C sing N N 192 PHE CA CB sing N N 193 PHE CA HA sing N N 194 PHE C O doub N N 195 PHE C OXT sing N N 196 PHE CB CG sing N N 197 PHE CB HB2 sing N N 198 PHE CB HB3 sing N N 199 PHE CG CD1 doub Y N 200 PHE CG CD2 sing Y N 201 PHE CD1 CE1 sing Y N 202 PHE CD1 HD1 sing N N 203 PHE CD2 CE2 doub Y N 204 PHE CD2 HD2 sing N N 205 PHE CE1 CZ doub Y N 206 PHE CE1 HE1 sing N N 207 PHE CE2 CZ sing Y N 208 PHE CE2 HE2 sing N N 209 PHE CZ HZ sing N N 210 PHE OXT HXT sing N N 211 PRO N CA sing N N 212 PRO N CD sing N N 213 PRO N H sing N N 214 PRO CA C sing N N 215 PRO CA CB sing N N 216 PRO CA HA sing N N 217 PRO C O doub N N 218 PRO C OXT sing N N 219 PRO CB CG sing N N 220 PRO CB HB2 sing N N 221 PRO CB HB3 sing N N 222 PRO CG CD sing N N 223 PRO CG HG2 sing N N 224 PRO CG HG3 sing N N 225 PRO CD HD2 sing N N 226 PRO CD HD3 sing N N 227 PRO OXT HXT sing N N 228 SER N CA sing N N 229 SER N H sing N N 230 SER N H2 sing N N 231 SER CA C sing N N 232 SER CA CB sing N N 233 SER CA HA sing N N 234 SER C O doub N N 235 SER C OXT sing N N 236 SER CB OG sing N N 237 SER CB HB2 sing N N 238 SER CB HB3 sing N N 239 SER OG HG sing N N 240 SER OXT HXT sing N N 241 THR N CA sing N N 242 THR N H sing N N 243 THR N H2 sing N N 244 THR CA C sing N N 245 THR CA CB sing N N 246 THR CA HA sing N N 247 THR C O doub N N 248 THR C OXT sing N N 249 THR CB OG1 sing N N 250 THR CB CG2 sing N N 251 THR CB HB sing N N 252 THR OG1 HG1 sing N N 253 THR CG2 HG21 sing N N 254 THR CG2 HG22 sing N N 255 THR CG2 HG23 sing N N 256 THR OXT HXT sing N N 257 TYR N CA sing N N 258 TYR N H sing N N 259 TYR N H2 sing N N 260 TYR CA C sing N N 261 TYR CA CB sing N N 262 TYR CA HA sing N N 263 TYR C O doub N N 264 TYR C OXT sing N N 265 TYR CB CG sing N N 266 TYR CB HB2 sing N N 267 TYR CB HB3 sing N N 268 TYR CG CD1 doub Y N 269 TYR CG CD2 sing Y N 270 TYR CD1 CE1 sing Y N 271 TYR CD1 HD1 sing N N 272 TYR CD2 CE2 doub Y N 273 TYR CD2 HD2 sing N N 274 TYR CE1 CZ doub Y N 275 TYR CE1 HE1 sing N N 276 TYR CE2 CZ sing Y N 277 TYR CE2 HE2 sing N N 278 TYR CZ OH sing N N 279 TYR OH HH sing N N 280 TYR OXT HXT sing N N 281 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2YTS _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_