data_2YUM # _entry.id 2YUM # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YUM pdb_00002yum 10.2210/pdb2yum/pdb RCSB RCSB027154 ? ? WWPDB D_1000027154 ? ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hsi002027679.2 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YUM _pdbx_database_status.recvd_initial_deposition_date 2007-04-06 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Abe, H.' 1 'Tochio, N.' 2 'Miyamoto, K.' 3 'Saito, K.' 4 'Koshiba, S.' 5 'Inoue, M.' 6 'Kigawa, T.' 7 'Yokoyama, S.' 8 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 9 # _citation.id primary _citation.title 'Solution structure of the Myb-like DNA-binding domain of human ZZZ3 protein' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abe, H.' 1 ? primary 'Tochio, N.' 2 ? primary 'Miyamoto, K.' 3 ? primary 'Saito, K.' 4 ? primary 'Koshiba, S.' 5 ? primary 'Inoue, M.' 6 ? primary 'Kigawa, T.' 7 ? primary 'Yokoyama, S.' 8 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Zinc finger ZZ-type-containing protein 3' _entity.formula_weight 8299.343 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment 'Myb-like DNA-binding domain, UNP residues 652-713' _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ZZZ3 protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGNQLWTVEEQKKLEQLLIKYPPEEVESRRWQKIADELGNRTAKQVASQVQKYFIKLTKAGIPVSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGNQLWTVEEQKKLEQLLIKYPPEEVESRRWQKIADELGNRTAKQVASQVQKYFIKLTKAGIPVSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hsi002027679.2 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 ASN n 1 9 GLN n 1 10 LEU n 1 11 TRP n 1 12 THR n 1 13 VAL n 1 14 GLU n 1 15 GLU n 1 16 GLN n 1 17 LYS n 1 18 LYS n 1 19 LEU n 1 20 GLU n 1 21 GLN n 1 22 LEU n 1 23 LEU n 1 24 ILE n 1 25 LYS n 1 26 TYR n 1 27 PRO n 1 28 PRO n 1 29 GLU n 1 30 GLU n 1 31 VAL n 1 32 GLU n 1 33 SER n 1 34 ARG n 1 35 ARG n 1 36 TRP n 1 37 GLN n 1 38 LYS n 1 39 ILE n 1 40 ALA n 1 41 ASP n 1 42 GLU n 1 43 LEU n 1 44 GLY n 1 45 ASN n 1 46 ARG n 1 47 THR n 1 48 ALA n 1 49 LYS n 1 50 GLN n 1 51 VAL n 1 52 ALA n 1 53 SER n 1 54 GLN n 1 55 VAL n 1 56 GLN n 1 57 LYS n 1 58 TYR n 1 59 PHE n 1 60 ILE n 1 61 LYS n 1 62 LEU n 1 63 THR n 1 64 LYS n 1 65 ALA n 1 66 GLY n 1 67 ILE n 1 68 PRO n 1 69 VAL n 1 70 SER n 1 71 GLY n 1 72 PRO n 1 73 SER n 1 74 SER n 1 75 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ZZZ3 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P050613-19 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZZZ3_HUMAN _struct_ref.pdbx_db_accession Q8IYH5 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code NQLWTVEEQKKLEQLLIKYPPEEVESRRWQKIADELGNRTAKQVASQVQKYFIKLTKAGIPV _struct_ref.pdbx_align_begin 652 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YUM _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 69 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IYH5 _struct_ref_seq.db_align_beg 652 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 713 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 69 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YUM GLY A 1 ? UNP Q8IYH5 ? ? 'expression tag' 1 1 1 2YUM SER A 2 ? UNP Q8IYH5 ? ? 'expression tag' 2 2 1 2YUM SER A 3 ? UNP Q8IYH5 ? ? 'expression tag' 3 3 1 2YUM GLY A 4 ? UNP Q8IYH5 ? ? 'expression tag' 4 4 1 2YUM SER A 5 ? UNP Q8IYH5 ? ? 'expression tag' 5 5 1 2YUM SER A 6 ? UNP Q8IYH5 ? ? 'expression tag' 6 6 1 2YUM GLY A 7 ? UNP Q8IYH5 ? ? 'expression tag' 7 7 1 2YUM SER A 70 ? UNP Q8IYH5 ? ? 'expression tag' 70 8 1 2YUM GLY A 71 ? UNP Q8IYH5 ? ? 'expression tag' 71 9 1 2YUM PRO A 72 ? UNP Q8IYH5 ? ? 'expression tag' 72 10 1 2YUM SER A 73 ? UNP Q8IYH5 ? ? 'expression tag' 73 11 1 2YUM SER A 74 ? UNP Q8IYH5 ? ? 'expression tag' 74 12 1 2YUM GLY A 75 ? UNP Q8IYH5 ? ? 'expression tag' 75 13 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 298 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.14mM Protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _pdbx_nmr_refine.entry_id 2YUM _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 2YUM _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations, target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2YUM _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMNMRView 5.0.4 'Johnson, B.' 3 'data analysis' KUJIRA 0.9747 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # _exptl.entry_id 2YUM _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 2YUM _struct.title 'Solution structure of the Myb-like DNA-binding domain of human ZZZ3 protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YUM _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text ;TRANSCRIPTION, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI ; # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_biol.id 1 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 THR A 12 ? TYR A 26 ? THR A 12 TYR A 26 1 ? 15 HELX_P HELX_P2 2 VAL A 31 ? GLY A 44 ? VAL A 31 GLY A 44 1 ? 14 HELX_P HELX_P3 3 THR A 47 ? ILE A 60 ? THR A 47 ILE A 60 1 ? 14 HELX_P HELX_P4 4 LYS A 61 ? THR A 63 ? LYS A 61 THR A 63 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 2YUM _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2YUM _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 ASN 8 8 8 ASN ASN A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 TRP 11 11 11 TRP TRP A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 GLN 16 16 16 GLN GLN A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 TYR 26 26 26 TYR TYR A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 GLU 30 30 30 GLU GLU A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 SER 33 33 33 SER SER A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 GLU 42 42 42 GLU GLU A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 ASN 45 45 45 ASN ASN A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 THR 47 47 47 THR THR A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LYS 49 49 49 LYS LYS A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 VAL 51 51 51 VAL VAL A . n A 1 52 ALA 52 52 52 ALA ALA A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 GLN 54 54 54 GLN GLN A . n A 1 55 VAL 55 55 55 VAL VAL A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 LYS 61 61 61 LYS LYS A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 LYS 64 64 64 LYS LYS A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ILE 67 67 67 ILE ILE A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 SER 70 70 70 SER SER A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 PRO 72 72 72 PRO PRO A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 SER 74 74 74 SER SER A . n A 1 75 GLY 75 75 75 GLY GLY A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2007-10-09 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' # _pdbx_database_remark.id 999 _pdbx_database_remark.text ;SEQUENCE The sequence is based on Reference 2 in the database, ZZZ3_HUMAN. ; # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TRP A 11 ? ? -49.03 172.44 2 1 LYS A 61 ? ? -82.38 39.45 3 1 LEU A 62 ? ? -132.16 -33.06 4 1 THR A 63 ? ? -66.70 72.22 5 1 LYS A 64 ? ? 34.40 36.16 6 1 PRO A 72 ? ? -69.83 97.71 7 2 SER A 5 ? ? -94.52 -60.85 8 2 LYS A 61 ? ? -34.37 -35.22 9 3 LYS A 49 ? ? -58.85 -70.04 10 3 LYS A 64 ? ? -173.33 129.99 11 3 ILE A 67 ? ? -34.96 137.84 12 3 PRO A 72 ? ? -69.77 94.78 13 4 GLN A 9 ? ? -100.62 42.29 14 4 GLU A 32 ? ? -82.31 39.31 15 4 SER A 33 ? ? -128.36 -55.11 16 4 LYS A 49 ? ? -56.97 -70.00 17 4 GLN A 50 ? ? -37.04 -38.18 18 4 THR A 63 ? ? -81.78 40.13 19 4 ALA A 65 ? ? 34.52 43.51 20 4 VAL A 69 ? ? -92.39 -60.53 21 4 PRO A 72 ? ? -69.73 92.03 22 5 SER A 2 ? ? -85.15 42.09 23 5 PHE A 59 ? ? -132.28 -52.48 24 5 LEU A 62 ? ? -101.21 48.65 25 5 LYS A 64 ? ? -129.46 -63.52 26 5 SER A 74 ? ? -54.14 100.51 27 6 SER A 2 ? ? -41.60 150.99 28 6 GLN A 9 ? ? -85.78 36.83 29 6 TRP A 11 ? ? -37.10 116.26 30 6 GLN A 50 ? ? -39.22 -39.88 31 6 LYS A 64 ? ? 34.64 49.59 32 6 ALA A 65 ? ? -34.42 150.21 33 6 PRO A 72 ? ? -69.78 86.47 34 7 GLN A 9 ? ? -89.44 42.15 35 7 TRP A 11 ? ? -38.35 155.19 36 7 LYS A 49 ? ? -61.08 -71.28 37 7 GLN A 50 ? ? -38.46 -29.42 38 7 THR A 63 ? ? -45.83 159.27 39 7 PRO A 72 ? ? -69.71 89.54 40 8 SER A 3 ? ? -90.86 42.19 41 8 SER A 5 ? ? 39.34 41.79 42 8 ALA A 48 ? ? -38.18 -26.68 43 8 PRO A 68 ? ? -69.76 -173.29 44 8 SER A 70 ? ? -172.20 139.91 45 9 SER A 3 ? ? -104.08 -62.29 46 9 ASN A 8 ? ? -133.16 -47.78 47 9 GLN A 16 ? ? -45.47 -70.20 48 9 THR A 63 ? ? -39.60 144.27 49 9 LYS A 64 ? ? -39.33 134.55 50 9 SER A 70 ? ? -134.77 -46.68 51 10 ASN A 8 ? ? -104.45 79.78 52 10 TRP A 11 ? ? -51.70 171.87 53 10 GLN A 50 ? ? -39.01 -39.29 54 10 THR A 63 ? ? -51.32 172.63 55 10 ILE A 67 ? ? -33.72 132.84 56 11 ASN A 8 ? ? -91.59 45.43 57 11 PHE A 59 ? ? -131.67 -56.14 58 11 LEU A 62 ? ? -107.84 45.99 59 11 THR A 63 ? ? -91.19 -62.38 60 12 GLN A 9 ? ? -108.69 66.90 61 12 ALA A 48 ? ? -37.15 -28.34 62 12 LYS A 49 ? ? -74.76 -71.00 63 12 VAL A 69 ? ? -35.17 140.06 64 13 SER A 5 ? ? 38.63 42.63 65 13 LYS A 18 ? ? -39.40 -36.90 66 13 GLU A 32 ? ? -36.39 -29.93 67 13 SER A 33 ? ? -50.47 -70.65 68 13 LYS A 49 ? ? -54.66 -70.10 69 13 GLN A 50 ? ? -38.16 -36.63 70 14 SER A 3 ? ? -122.56 -53.70 71 14 SER A 6 ? ? -131.99 -53.51 72 14 LYS A 49 ? ? -58.28 -70.23 73 14 ILE A 67 ? ? -33.61 132.82 74 15 SER A 2 ? ? -100.61 42.09 75 15 VAL A 13 ? ? -33.73 -72.57 76 15 LEU A 62 ? ? -36.43 -33.39 77 15 ALA A 65 ? ? -80.56 41.97 78 15 SER A 74 ? ? -172.22 147.58 79 16 ASN A 8 ? ? -81.99 44.71 80 16 VAL A 69 ? ? 29.57 39.93 81 16 SER A 70 ? ? -34.45 150.79 82 16 PRO A 72 ? ? -69.81 -177.32 83 17 LEU A 62 ? ? -88.19 33.35 84 17 LYS A 64 ? ? -41.88 161.56 85 17 ALA A 65 ? ? -43.70 155.39 86 17 SER A 70 ? ? 39.61 47.16 87 17 SER A 74 ? ? -129.95 -59.43 88 18 VAL A 13 ? ? -36.65 -37.10 89 18 VAL A 69 ? ? -37.37 143.22 90 19 TRP A 11 ? ? -34.05 134.49 91 19 GLU A 20 ? ? -34.67 -39.17 92 19 LYS A 49 ? ? -60.91 -71.28 93 19 THR A 63 ? ? -34.85 149.81 94 19 SER A 73 ? ? -73.92 -71.97 95 20 GLN A 9 ? ? -87.90 41.75 96 20 TRP A 11 ? ? -39.28 137.64 97 20 LYS A 49 ? ? -69.14 -70.37 #