data_2YUR # _entry.id 2YUR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 2YUR pdb_00002yur 10.2210/pdb2yur/pdb RCSB RCSB027159 ? ? WWPDB D_1000027159 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-04-08 2 'Structure model' 1 1 2011-07-13 3 'Structure model' 1 2 2022-03-16 4 'Structure model' 1 3 2024-05-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' database_2 2 3 'Structure model' pdbx_nmr_software 3 3 'Structure model' pdbx_nmr_spectrometer 4 3 'Structure model' pdbx_struct_assembly 5 3 'Structure model' pdbx_struct_oper_list 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site 8 4 'Structure model' chem_comp_atom 9 4 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_pdbx_nmr_software.name' 4 3 'Structure model' '_pdbx_nmr_spectrometer.model' 5 3 'Structure model' '_struct_ref_seq_dif.details' 6 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 7 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 8 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2YUR _pdbx_database_status.recvd_initial_deposition_date 2007-04-06 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr REL _pdbx_database_status.SG_entry Y _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # _pdbx_database_related.db_name TargetDB _pdbx_database_related.db_id hso002000490.3 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Abe, H.' 1 'Miyamoto, K.' 2 'Tochio, N.' 3 'Tomizawa, T.' 4 'Koshiba, S.' 5 'Harada, T.' 6 'Watanabe, S.' 7 'Kigawa, T.' 8 'Yokoyama, S.' 9 'RIKEN Structural Genomics/Proteomics Initiative (RSGI)' 10 # _citation.id primary _citation.title 'Solution structure of the Ring finger of human Retinoblastoma-binding protein 6' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Abe, H.' 1 ? primary 'Miyamoto, K.' 2 ? primary 'Tochio, N.' 3 ? primary 'Tomizawa, T.' 4 ? primary 'Koshiba, S.' 5 ? primary 'Harada, T.' 6 ? primary 'Watanabe, S.' 7 ? primary 'Kigawa, T.' 8 ? primary 'Yokoyama, S.' 9 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Retinoblastoma-binding protein 6' 7693.442 1 ? ? 'UNP residues 249-309, C3HC4 domain' ? 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;p53-associated cellular protein of testis, Proliferation potential-related protein, Protein P2P-R, Retinoblastoma-binding Q protein 1, Protein RBQ-1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSSGSSGEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALSGPSSG _entity_poly.pdbx_seq_one_letter_code_can GSSGSSGEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDALSGPSSG _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier hso002000490.3 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 SER n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 GLY n 1 8 GLU n 1 9 ASP n 1 10 ASP n 1 11 PRO n 1 12 ILE n 1 13 PRO n 1 14 ASP n 1 15 GLU n 1 16 LEU n 1 17 LEU n 1 18 CYS n 1 19 LEU n 1 20 ILE n 1 21 CYS n 1 22 LYS n 1 23 ASP n 1 24 ILE n 1 25 MET n 1 26 THR n 1 27 ASP n 1 28 ALA n 1 29 VAL n 1 30 VAL n 1 31 ILE n 1 32 PRO n 1 33 CYS n 1 34 CYS n 1 35 GLY n 1 36 ASN n 1 37 SER n 1 38 TYR n 1 39 CYS n 1 40 ASP n 1 41 GLU n 1 42 CYS n 1 43 ILE n 1 44 ARG n 1 45 THR n 1 46 ALA n 1 47 LEU n 1 48 LEU n 1 49 GLU n 1 50 SER n 1 51 ASP n 1 52 GLU n 1 53 HIS n 1 54 THR n 1 55 CYS n 1 56 PRO n 1 57 THR n 1 58 CYS n 1 59 HIS n 1 60 GLN n 1 61 ASN n 1 62 ASP n 1 63 VAL n 1 64 SER n 1 65 PRO n 1 66 ASP n 1 67 ALA n 1 68 LEU n 1 69 SER n 1 70 GLY n 1 71 PRO n 1 72 SER n 1 73 SER n 1 74 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene RBBP6 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name P060731-05 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'cell-free protein synthesis' # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 1 1 GLY GLY A . n A 1 2 SER 2 2 2 SER SER A . n A 1 3 SER 3 3 3 SER SER A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 ASP 9 9 9 ASP ASP A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 PRO 13 13 13 PRO PRO A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 CYS 18 18 18 CYS CYS A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 ILE 20 20 20 ILE ILE A . n A 1 21 CYS 21 21 21 CYS CYS A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 ASP 23 23 23 ASP ASP A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 MET 25 25 25 MET MET A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ILE 31 31 31 ILE ILE A . n A 1 32 PRO 32 32 32 PRO PRO A . n A 1 33 CYS 33 33 33 CYS CYS A . n A 1 34 CYS 34 34 34 CYS CYS A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 TYR 38 38 38 TYR TYR A . n A 1 39 CYS 39 39 39 CYS CYS A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 ILE 43 43 43 ILE ILE A . n A 1 44 ARG 44 44 44 ARG ARG A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 HIS 53 53 53 HIS HIS A . n A 1 54 THR 54 54 54 THR THR A . n A 1 55 CYS 55 55 55 CYS CYS A . n A 1 56 PRO 56 56 56 PRO PRO A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 CYS 58 58 58 CYS CYS A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 GLN 60 60 60 GLN GLN A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 PRO 65 65 65 PRO PRO A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 PRO 71 71 71 PRO PRO A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 SER 73 73 73 SER SER A . n A 1 74 GLY 74 74 74 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 201 ZN ZN A . C 2 ZN 1 401 401 ZN ZN A . # _exptl.entry_id 2YUR _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 2YUR _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 2YUR _struct.title 'Solution structure of the Ring finger of human Retinoblastoma-binding protein 6' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2YUR _struct_keywords.pdbx_keywords 'PROTEIN BINDING' _struct_keywords.text ;p53-associated cellular protein of testis, Proliferation potential-related protein, Protein P2P-R, Retinoblastoma-binding Q protein 1, Protein RBQ-1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RBBP6_HUMAN _struct_ref.pdbx_db_accession Q7Z6E9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code EDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCHQNDVSPDAL _struct_ref.pdbx_align_begin 249 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2YUR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 8 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 68 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q7Z6E9 _struct_ref_seq.db_align_beg 249 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 309 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 68 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 2YUR GLY A 1 ? UNP Q7Z6E9 ? ? 'expression tag' 1 1 1 2YUR SER A 2 ? UNP Q7Z6E9 ? ? 'expression tag' 2 2 1 2YUR SER A 3 ? UNP Q7Z6E9 ? ? 'expression tag' 3 3 1 2YUR GLY A 4 ? UNP Q7Z6E9 ? ? 'expression tag' 4 4 1 2YUR SER A 5 ? UNP Q7Z6E9 ? ? 'expression tag' 5 5 1 2YUR SER A 6 ? UNP Q7Z6E9 ? ? 'expression tag' 6 6 1 2YUR GLY A 7 ? UNP Q7Z6E9 ? ? 'expression tag' 7 7 1 2YUR SER A 69 ? UNP Q7Z6E9 ? ? 'expression tag' 69 8 1 2YUR GLY A 70 ? UNP Q7Z6E9 ? ? 'expression tag' 70 9 1 2YUR PRO A 71 ? UNP Q7Z6E9 ? ? 'expression tag' 71 10 1 2YUR SER A 72 ? UNP Q7Z6E9 ? ? 'expression tag' 72 11 1 2YUR SER A 73 ? UNP Q7Z6E9 ? ? 'expression tag' 73 12 1 2YUR GLY A 74 ? UNP Q7Z6E9 ? ? 'expression tag' 74 13 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PRO A 13 ? LEU A 17 ? PRO A 13 LEU A 17 5 ? 5 HELX_P HELX_P2 2 GLU A 41 ? SER A 50 ? GLU A 41 SER A 50 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 18 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 18 A ZN 201 1_555 ? ? ? ? ? ? ? 2.209 ? ? metalc2 metalc ? ? A CYS 21 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.327 ? ? metalc3 metalc ? ? A CYS 33 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 33 A ZN 401 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc4 metalc ? ? A CYS 34 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 34 A ZN 401 1_555 ? ? ? ? ? ? ? 2.340 ? ? metalc5 metalc ? ? A CYS 39 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 39 A ZN 201 1_555 ? ? ? ? ? ? ? 2.332 ? ? metalc6 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 201 1_555 ? ? ? ? ? ? ? 2.186 ? ? metalc7 metalc ? ? A CYS 55 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 55 A ZN 401 1_555 ? ? ? ? ? ? ? 2.309 ? ? metalc8 metalc ? ? A CYS 58 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 58 A ZN 401 1_555 ? ? ? ? ? ? ? 2.206 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 21 ? A CYS 21 ? 1_555 103.2 ? 2 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 103.2 ? 3 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 39 ? A CYS 39 ? 1_555 113.0 ? 4 SG ? A CYS 18 ? A CYS 18 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 128.8 ? 5 SG ? A CYS 21 ? A CYS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 104.1 ? 6 SG ? A CYS 39 ? A CYS 39 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 1_555 SG ? A CYS 42 ? A CYS 42 ? 1_555 104.7 ? 7 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 34 ? A CYS 34 ? 1_555 98.5 ? 8 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 103.7 ? 9 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 55 ? A CYS 55 ? 1_555 115.7 ? 10 SG ? A CYS 33 ? A CYS 33 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 110.0 ? 11 SG ? A CYS 34 ? A CYS 34 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 103.6 ? 12 SG ? A CYS 55 ? A CYS 55 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 58 ? A CYS 58 ? 1_555 122.7 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 VAL A 29 ? VAL A 30 ? VAL A 29 VAL A 30 A 2 SER A 37 ? TYR A 38 ? SER A 37 TYR A 38 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id VAL _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 29 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id VAL _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 29 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 38 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 38 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 201 ? 5 'BINDING SITE FOR RESIDUE ZN A 201' AC2 Software A ZN 401 ? 3 'BINDING SITE FOR RESIDUE ZN A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 CYS A 18 ? CYS A 18 . ? 1_555 ? 2 AC1 5 ILE A 20 ? ILE A 20 . ? 1_555 ? 3 AC1 5 CYS A 21 ? CYS A 21 . ? 1_555 ? 4 AC1 5 ASP A 23 ? ASP A 23 . ? 1_555 ? 5 AC1 5 CYS A 39 ? CYS A 39 . ? 1_555 ? 6 AC2 3 ILE A 31 ? ILE A 31 . ? 1_555 ? 7 AC2 3 CYS A 33 ? CYS A 33 . ? 1_555 ? 8 AC2 3 CYS A 34 ? CYS A 34 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ILE A 12 ? ? -35.04 124.90 2 1 LEU A 19 ? ? -96.89 38.80 3 1 ILE A 20 ? ? -133.01 -69.85 4 1 CYS A 34 ? ? -134.99 -55.66 5 1 ASP A 40 ? ? -35.64 -35.76 6 1 HIS A 53 ? ? -61.63 82.25 7 1 CYS A 55 ? ? -39.01 138.02 8 1 HIS A 59 ? ? -45.74 99.97 9 1 ASP A 62 ? ? 74.30 54.98 10 1 SER A 64 ? ? -40.78 101.44 11 1 LEU A 68 ? ? -42.00 155.61 12 1 SER A 69 ? ? -75.96 49.37 13 1 SER A 72 ? ? -87.07 41.02 14 2 GLU A 15 ? ? -49.41 -18.67 15 2 ILE A 20 ? ? -120.07 -75.31 16 2 CYS A 34 ? ? -134.98 -51.27 17 2 ASP A 40 ? ? -35.54 -32.19 18 2 ARG A 44 ? ? -65.74 -70.45 19 2 HIS A 53 ? ? -62.88 83.25 20 2 PRO A 56 ? ? -69.75 5.08 21 2 PRO A 65 ? ? -69.72 2.11 22 2 LEU A 68 ? ? -37.34 137.31 23 3 ILE A 20 ? ? -72.83 -75.66 24 3 LYS A 22 ? ? 36.60 55.10 25 3 ILE A 24 ? ? -35.88 127.96 26 3 ALA A 28 ? ? -37.20 133.68 27 3 CYS A 33 ? ? -29.54 -52.94 28 3 CYS A 34 ? ? -134.96 -57.20 29 3 ASP A 40 ? ? -33.30 -36.92 30 3 SER A 50 ? ? -55.49 178.74 31 3 GLU A 52 ? ? -172.29 117.16 32 3 HIS A 53 ? ? 38.15 47.27 33 3 PRO A 56 ? ? -69.74 3.98 34 3 HIS A 59 ? ? 33.03 44.82 35 3 ASP A 62 ? ? 74.33 54.92 36 3 SER A 64 ? ? -43.94 103.18 37 3 LEU A 68 ? ? -36.44 146.72 38 4 GLU A 15 ? ? -37.05 -30.19 39 4 ILE A 20 ? ? -123.69 -75.50 40 4 ALA A 28 ? ? -46.29 109.27 41 4 CYS A 34 ? ? -134.97 -63.23 42 4 ASP A 40 ? ? -39.95 -26.19 43 4 PRO A 56 ? ? -69.81 2.81 44 4 THR A 57 ? ? -123.52 -65.12 45 4 ASN A 61 ? ? -106.07 -61.53 46 4 PRO A 65 ? ? -69.82 2.84 47 4 LEU A 68 ? ? -36.67 152.87 48 5 LEU A 19 ? ? -99.17 41.56 49 5 ILE A 20 ? ? -134.50 -71.37 50 5 CYS A 34 ? ? -134.95 -55.70 51 5 ASP A 40 ? ? -34.25 -32.34 52 5 HIS A 53 ? ? 32.98 42.66 53 5 CYS A 55 ? ? -33.64 125.62 54 5 PRO A 56 ? ? -69.67 5.34 55 5 VAL A 63 ? ? -38.65 158.73 56 5 PRO A 65 ? ? -69.80 4.35 57 5 ALA A 67 ? ? -86.97 37.81 58 5 SER A 69 ? ? -83.84 44.15 59 6 PRO A 11 ? ? -69.72 -179.84 60 6 LEU A 19 ? ? -97.44 41.17 61 6 ILE A 20 ? ? -134.96 -70.50 62 6 CYS A 34 ? ? -135.09 -56.11 63 6 ASP A 40 ? ? -33.48 -35.15 64 6 GLU A 52 ? ? -94.34 44.05 65 6 HIS A 53 ? ? 28.87 41.50 66 6 ASN A 61 ? ? -134.61 -40.86 67 6 PRO A 65 ? ? -69.77 9.93 68 6 ALA A 67 ? ? -78.42 43.70 69 7 ILE A 20 ? ? -130.85 -71.09 70 7 CYS A 34 ? ? -134.98 -57.36 71 7 ASP A 40 ? ? -35.60 -34.81 72 7 PRO A 56 ? ? -69.81 9.88 73 7 THR A 57 ? ? -123.05 -63.02 74 7 ASP A 66 ? ? -81.84 36.75 75 7 PRO A 71 ? ? -69.82 3.13 76 8 SER A 6 ? ? -57.02 175.72 77 8 GLU A 8 ? ? -46.45 151.02 78 8 ILE A 20 ? ? -131.88 -74.37 79 8 ILE A 24 ? ? -38.64 129.12 80 8 ALA A 28 ? ? -33.41 141.67 81 8 CYS A 33 ? ? -28.79 -47.61 82 8 CYS A 34 ? ? -134.96 -55.88 83 8 ASN A 36 ? ? -39.59 142.03 84 8 ASP A 40 ? ? -37.35 -30.37 85 8 CYS A 42 ? ? -44.30 -72.67 86 8 HIS A 53 ? ? -35.34 104.71 87 8 CYS A 55 ? ? -33.52 132.45 88 8 PRO A 56 ? ? -69.80 4.14 89 8 THR A 57 ? ? -124.20 -73.46 90 8 HIS A 59 ? ? -39.25 110.83 91 8 SER A 64 ? ? -43.05 105.39 92 8 ASP A 66 ? ? -88.17 30.10 93 8 PRO A 71 ? ? -69.74 7.82 94 8 SER A 72 ? ? -29.97 -48.59 95 9 SER A 2 ? ? -81.71 46.30 96 9 SER A 6 ? ? -47.97 169.33 97 9 LEU A 19 ? ? -99.47 41.72 98 9 ILE A 20 ? ? -134.26 -68.94 99 9 ALA A 28 ? ? -36.75 123.91 100 9 CYS A 34 ? ? -132.83 -55.86 101 9 ASP A 40 ? ? -36.36 -29.95 102 9 CYS A 42 ? ? -36.52 -71.14 103 9 HIS A 53 ? ? -35.58 101.25 104 9 PRO A 65 ? ? -69.69 5.09 105 9 ALA A 67 ? ? -79.87 47.09 106 10 GLU A 8 ? ? -38.79 144.81 107 10 ILE A 20 ? ? -132.05 -72.17 108 10 ALA A 28 ? ? -32.15 123.54 109 10 CYS A 33 ? ? -29.50 -46.67 110 10 CYS A 34 ? ? -134.79 -57.47 111 10 ASN A 36 ? ? -36.79 147.27 112 10 CYS A 42 ? ? -37.16 -72.24 113 10 SER A 50 ? ? -60.59 -174.82 114 10 HIS A 53 ? ? 36.72 39.44 115 10 CYS A 55 ? ? -39.28 134.35 116 10 PRO A 56 ? ? -69.74 6.16 117 10 THR A 57 ? ? -131.50 -62.59 118 10 ASP A 62 ? ? 72.36 50.16 119 10 LEU A 68 ? ? -34.41 151.38 120 10 SER A 69 ? ? -80.20 43.51 121 11 SER A 6 ? ? -68.23 95.91 122 11 GLU A 15 ? ? -37.92 -28.56 123 11 LEU A 19 ? ? -97.46 34.80 124 11 ILE A 20 ? ? -129.39 -73.36 125 11 ALA A 28 ? ? -32.06 142.45 126 11 CYS A 34 ? ? -135.03 -55.56 127 11 ASP A 40 ? ? -35.59 -34.05 128 11 SER A 50 ? ? -39.85 104.64 129 11 HIS A 53 ? ? -33.76 98.85 130 11 CYS A 55 ? ? -33.37 122.94 131 11 PRO A 56 ? ? -69.73 8.59 132 11 THR A 57 ? ? -121.70 -64.55 133 11 VAL A 63 ? ? -36.66 123.39 134 11 ASP A 66 ? ? -86.24 31.90 135 11 LEU A 68 ? ? -35.32 148.40 136 11 SER A 72 ? ? -35.67 120.97 137 12 SER A 2 ? ? -55.43 103.20 138 12 GLU A 15 ? ? -39.48 -27.12 139 12 LEU A 16 ? ? -83.78 33.87 140 12 ILE A 20 ? ? -125.30 -71.62 141 12 ILE A 24 ? ? -38.63 133.91 142 12 ALA A 28 ? ? -36.94 104.19 143 12 CYS A 34 ? ? -135.00 -52.25 144 12 ASP A 40 ? ? -35.80 -30.18 145 12 PRO A 56 ? ? -69.79 4.45 146 12 ASP A 62 ? ? 36.81 54.02 147 12 LEU A 68 ? ? -32.60 134.22 148 12 PRO A 71 ? ? -69.73 10.39 149 13 GLU A 15 ? ? -38.57 -27.06 150 13 LEU A 19 ? ? -99.55 39.70 151 13 ILE A 20 ? ? -134.58 -70.50 152 13 CYS A 34 ? ? -135.08 -55.64 153 13 ASP A 40 ? ? -35.09 -37.50 154 13 HIS A 53 ? ? 39.51 42.44 155 13 LEU A 68 ? ? -35.80 153.64 156 13 SER A 72 ? ? -56.71 105.92 157 14 ILE A 20 ? ? -125.81 -75.72 158 14 ALA A 28 ? ? -38.96 126.72 159 14 CYS A 33 ? ? -29.81 -52.98 160 14 CYS A 34 ? ? -135.06 -56.81 161 14 ASP A 40 ? ? -33.84 -34.04 162 14 HIS A 53 ? ? 34.71 44.20 163 14 PRO A 56 ? ? -69.74 5.80 164 14 PRO A 65 ? ? -69.72 9.98 165 14 ALA A 67 ? ? -77.43 46.38 166 14 SER A 69 ? ? 33.00 40.09 167 14 PRO A 71 ? ? -69.77 7.09 168 15 SER A 2 ? ? -63.80 88.28 169 15 LEU A 16 ? ? -84.07 30.78 170 15 ILE A 20 ? ? -124.29 -74.75 171 15 ILE A 24 ? ? -39.85 132.01 172 15 CYS A 33 ? ? -29.12 -53.30 173 15 CYS A 34 ? ? -135.02 -59.04 174 15 ASP A 40 ? ? -33.83 -33.60 175 15 SER A 50 ? ? -58.73 174.74 176 15 GLU A 52 ? ? -111.12 52.10 177 15 HIS A 53 ? ? 33.71 46.44 178 15 LEU A 68 ? ? -36.53 148.96 179 16 LEU A 19 ? ? -98.17 37.07 180 16 ILE A 20 ? ? -134.17 -75.97 181 16 ALA A 28 ? ? -35.51 133.92 182 16 CYS A 34 ? ? -135.04 -55.33 183 16 ASP A 40 ? ? -35.20 -35.05 184 16 HIS A 53 ? ? -32.18 103.47 185 16 GLN A 60 ? ? -59.52 174.82 186 16 LEU A 68 ? ? -41.85 150.93 187 17 PRO A 11 ? ? -69.71 -176.59 188 17 LEU A 19 ? ? -99.10 31.93 189 17 ILE A 20 ? ? -126.41 -72.68 190 17 ALA A 28 ? ? -44.41 103.72 191 17 CYS A 34 ? ? -135.02 -55.61 192 17 ASP A 40 ? ? -39.29 -29.34 193 17 HIS A 53 ? ? -54.54 104.81 194 17 THR A 54 ? ? -161.17 115.33 195 17 CYS A 55 ? ? -35.63 126.45 196 17 PRO A 56 ? ? -69.79 3.64 197 17 ASP A 62 ? ? -33.60 93.67 198 17 ASP A 66 ? ? -99.93 32.76 199 17 LEU A 68 ? ? -36.50 147.58 200 17 PRO A 71 ? ? -69.77 89.10 201 18 LEU A 19 ? ? -97.44 32.36 202 18 ILE A 20 ? ? -128.96 -75.35 203 18 CYS A 34 ? ? -134.98 -53.84 204 18 ASP A 40 ? ? -34.24 -35.00 205 18 SER A 50 ? ? -45.48 164.51 206 18 PRO A 56 ? ? -69.72 4.64 207 18 PRO A 65 ? ? -69.86 2.96 208 18 LEU A 68 ? ? -34.31 145.67 209 19 GLU A 8 ? ? -84.30 42.49 210 19 ILE A 20 ? ? -130.37 -71.55 211 19 ALA A 28 ? ? -39.49 107.20 212 19 CYS A 34 ? ? -135.02 -54.74 213 19 ASP A 40 ? ? -37.95 -30.40 214 19 HIS A 53 ? ? -69.99 87.98 215 19 CYS A 55 ? ? -37.23 127.60 216 19 HIS A 59 ? ? -37.20 104.93 217 19 LEU A 68 ? ? -34.13 148.38 218 20 ILE A 12 ? ? -37.80 131.73 219 20 PRO A 13 ? ? -69.63 -177.73 220 20 ILE A 20 ? ? -75.26 -76.14 221 20 LYS A 22 ? ? 36.40 46.65 222 20 CYS A 34 ? ? -134.98 -56.62 223 20 ASP A 40 ? ? -34.97 -39.30 224 20 HIS A 53 ? ? -56.59 85.74 225 20 PRO A 56 ? ? -69.75 9.23 226 20 GLN A 60 ? ? -55.71 -173.42 227 20 ASP A 62 ? ? 74.91 53.97 228 20 VAL A 63 ? ? -49.88 159.29 229 20 PRO A 65 ? ? -69.71 0.79 230 20 LEU A 68 ? ? -34.64 145.46 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name 'NPPSFA, National Project on Protein Structural and Functional Analyses' _pdbx_SG_project.full_name_of_center 'RIKEN Structural Genomics/Proteomics Initiative' _pdbx_SG_project.initial_of_center RSGI # _pdbx_nmr_ensemble.entry_id 2YUR _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'structures with the least restraint violations,target function' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 2YUR _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'lowest energy' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '1.18mM Protein; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3; 0.05mM Zncl2+1mM IDA; 90% H2O, 10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 296 _pdbx_nmr_exptl_sample_conditions.pressure ambient _pdbx_nmr_exptl_sample_conditions.pH 7.0 _pdbx_nmr_exptl_sample_conditions.ionic_strength 120mM _pdbx_nmr_exptl_sample_conditions.pressure_units . _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 3D_15N-separated_NOESY 1 2 1 3D_13C-separated_NOESY 1 # _pdbx_nmr_refine.entry_id 2YUR _pdbx_nmr_refine.method 'torsion angle dynamics' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal collection XwinNMR 3.5 Bruker 1 processing NMRPipe 20031121 'Delaglio, F.' 2 'data analysis' NMNMRView 5.0.4 'Johnson, B.A.' 3 'data analysis' KUJIRA 0.9747 'Kobayashi, N.' 4 'structure solution' CYANA 2.0.17 'Guntert, P.' 5 refinement CYANA 2.0.17 'Guntert, P.' 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PRO N N N N 247 PRO CA C N S 248 PRO C C N N 249 PRO O O N N 250 PRO CB C N N 251 PRO CG C N N 252 PRO CD C N N 253 PRO OXT O N N 254 PRO H H N N 255 PRO HA H N N 256 PRO HB2 H N N 257 PRO HB3 H N N 258 PRO HG2 H N N 259 PRO HG3 H N N 260 PRO HD2 H N N 261 PRO HD3 H N N 262 PRO HXT H N N 263 SER N N N N 264 SER CA C N S 265 SER C C N N 266 SER O O N N 267 SER CB C N N 268 SER OG O N N 269 SER OXT O N N 270 SER H H N N 271 SER H2 H N N 272 SER HA H N N 273 SER HB2 H N N 274 SER HB3 H N N 275 SER HG H N N 276 SER HXT H N N 277 THR N N N N 278 THR CA C N S 279 THR C C N N 280 THR O O N N 281 THR CB C N R 282 THR OG1 O N N 283 THR CG2 C N N 284 THR OXT O N N 285 THR H H N N 286 THR H2 H N N 287 THR HA H N N 288 THR HB H N N 289 THR HG1 H N N 290 THR HG21 H N N 291 THR HG22 H N N 292 THR HG23 H N N 293 THR HXT H N N 294 TYR N N N N 295 TYR CA C N S 296 TYR C C N N 297 TYR O O N N 298 TYR CB C N N 299 TYR CG C Y N 300 TYR CD1 C Y N 301 TYR CD2 C Y N 302 TYR CE1 C Y N 303 TYR CE2 C Y N 304 TYR CZ C Y N 305 TYR OH O N N 306 TYR OXT O N N 307 TYR H H N N 308 TYR H2 H N N 309 TYR HA H N N 310 TYR HB2 H N N 311 TYR HB3 H N N 312 TYR HD1 H N N 313 TYR HD2 H N N 314 TYR HE1 H N N 315 TYR HE2 H N N 316 TYR HH H N N 317 TYR HXT H N N 318 VAL N N N N 319 VAL CA C N S 320 VAL C C N N 321 VAL O O N N 322 VAL CB C N N 323 VAL CG1 C N N 324 VAL CG2 C N N 325 VAL OXT O N N 326 VAL H H N N 327 VAL H2 H N N 328 VAL HA H N N 329 VAL HB H N N 330 VAL HG11 H N N 331 VAL HG12 H N N 332 VAL HG13 H N N 333 VAL HG21 H N N 334 VAL HG22 H N N 335 VAL HG23 H N N 336 VAL HXT H N N 337 ZN ZN ZN N N 338 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PRO N CA sing N N 235 PRO N CD sing N N 236 PRO N H sing N N 237 PRO CA C sing N N 238 PRO CA CB sing N N 239 PRO CA HA sing N N 240 PRO C O doub N N 241 PRO C OXT sing N N 242 PRO CB CG sing N N 243 PRO CB HB2 sing N N 244 PRO CB HB3 sing N N 245 PRO CG CD sing N N 246 PRO CG HG2 sing N N 247 PRO CG HG3 sing N N 248 PRO CD HD2 sing N N 249 PRO CD HD3 sing N N 250 PRO OXT HXT sing N N 251 SER N CA sing N N 252 SER N H sing N N 253 SER N H2 sing N N 254 SER CA C sing N N 255 SER CA CB sing N N 256 SER CA HA sing N N 257 SER C O doub N N 258 SER C OXT sing N N 259 SER CB OG sing N N 260 SER CB HB2 sing N N 261 SER CB HB3 sing N N 262 SER OG HG sing N N 263 SER OXT HXT sing N N 264 THR N CA sing N N 265 THR N H sing N N 266 THR N H2 sing N N 267 THR CA C sing N N 268 THR CA CB sing N N 269 THR CA HA sing N N 270 THR C O doub N N 271 THR C OXT sing N N 272 THR CB OG1 sing N N 273 THR CB CG2 sing N N 274 THR CB HB sing N N 275 THR OG1 HG1 sing N N 276 THR CG2 HG21 sing N N 277 THR CG2 HG22 sing N N 278 THR CG2 HG23 sing N N 279 THR OXT HXT sing N N 280 TYR N CA sing N N 281 TYR N H sing N N 282 TYR N H2 sing N N 283 TYR CA C sing N N 284 TYR CA CB sing N N 285 TYR CA HA sing N N 286 TYR C O doub N N 287 TYR C OXT sing N N 288 TYR CB CG sing N N 289 TYR CB HB2 sing N N 290 TYR CB HB3 sing N N 291 TYR CG CD1 doub Y N 292 TYR CG CD2 sing Y N 293 TYR CD1 CE1 sing Y N 294 TYR CD1 HD1 sing N N 295 TYR CD2 CE2 doub Y N 296 TYR CD2 HD2 sing N N 297 TYR CE1 CZ doub Y N 298 TYR CE1 HE1 sing N N 299 TYR CE2 CZ sing Y N 300 TYR CE2 HE2 sing N N 301 TYR CZ OH sing N N 302 TYR OH HH sing N N 303 TYR OXT HXT sing N N 304 VAL N CA sing N N 305 VAL N H sing N N 306 VAL N H2 sing N N 307 VAL CA C sing N N 308 VAL CA CB sing N N 309 VAL CA HA sing N N 310 VAL C O doub N N 311 VAL C OXT sing N N 312 VAL CB CG1 sing N N 313 VAL CB CG2 sing N N 314 VAL CB HB sing N N 315 VAL CG1 HG11 sing N N 316 VAL CG1 HG12 sing N N 317 VAL CG1 HG13 sing N N 318 VAL CG2 HG21 sing N N 319 VAL CG2 HG22 sing N N 320 VAL CG2 HG23 sing N N 321 VAL OXT HXT sing N N 322 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AVANCE _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 800 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 2YUR _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S ZN # loop_