data_2Z44 # _entry.id 2Z44 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 2Z44 RCSB RCSB027496 WWPDB D_1000027496 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 2Z45 . unspecified PDB 2Z46 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 2Z44 _pdbx_database_status.recvd_initial_deposition_date 2007-06-12 _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_cs ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tomimoto, Y.' 1 'Ihara, K.' 2 'Onizuka, T.' 3 'Kanai, S.' 4 'Ashida, H.' 5 'Yokota, A.' 6 'Tanaka, S.' 7 'Miyasaka, H.' 8 'Yamada, Y.' 9 'Kato, R.' 10 'Wakatsuki, S.' 11 # _citation.id primary _citation.title 'Crystal Structure of ORF134' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Tomimoto, Y.' 1 primary 'Ihara, K.' 2 primary 'Onizuka, T.' 3 primary 'Kanai, S.' 4 primary 'Ashida, H.' 5 primary 'Yokota, A.' 6 primary 'Tanaka, S.' 7 primary 'Miyasaka, H.' 8 primary 'Yamada, Y.' 9 primary 'Kato, R.' 10 primary 'Wakatsuki, S.' 11 # _cell.entry_id 2Z44 _cell.length_a 56.461 _cell.length_b 56.461 _cell.length_c 85.167 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 2Z44 _symmetry.space_group_name_H-M 'P 31 1 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 151 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ORF134 15471.664 1 ? ? ? ? 2 water nat water 18.015 34 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name RbcX # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)EFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEA(MSE)(MSE)LENKELV LRILTVRENLAEGVLEFLPE(MSE)VLSQIKQSNGNHRRSLLERLTQVDSSSTDQTEPNPGESDTSEDSE ; _entity_poly.pdbx_seq_one_letter_code_can ;MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAE GVLEFLPEMVLSQIKQSNGNHRRSLLERLTQVDSSSTDQTEPNPGESDTSEDSE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLU n 1 3 PHE n 1 4 LYS n 1 5 LYS n 1 6 VAL n 1 7 ALA n 1 8 LYS n 1 9 GLU n 1 10 THR n 1 11 ALA n 1 12 ILE n 1 13 THR n 1 14 LEU n 1 15 GLN n 1 16 SER n 1 17 TYR n 1 18 LEU n 1 19 THR n 1 20 TYR n 1 21 GLN n 1 22 ALA n 1 23 VAL n 1 24 ARG n 1 25 LEU n 1 26 ILE n 1 27 SER n 1 28 GLN n 1 29 GLN n 1 30 LEU n 1 31 SER n 1 32 GLU n 1 33 THR n 1 34 ASN n 1 35 PRO n 1 36 GLY n 1 37 GLN n 1 38 ALA n 1 39 ILE n 1 40 TRP n 1 41 LEU n 1 42 GLY n 1 43 GLU n 1 44 PHE n 1 45 SER n 1 46 LYS n 1 47 ARG n 1 48 HIS n 1 49 PRO n 1 50 ILE n 1 51 GLN n 1 52 GLU n 1 53 SER n 1 54 ASP n 1 55 LEU n 1 56 TYR n 1 57 LEU n 1 58 GLU n 1 59 ALA n 1 60 MSE n 1 61 MSE n 1 62 LEU n 1 63 GLU n 1 64 ASN n 1 65 LYS n 1 66 GLU n 1 67 LEU n 1 68 VAL n 1 69 LEU n 1 70 ARG n 1 71 ILE n 1 72 LEU n 1 73 THR n 1 74 VAL n 1 75 ARG n 1 76 GLU n 1 77 ASN n 1 78 LEU n 1 79 ALA n 1 80 GLU n 1 81 GLY n 1 82 VAL n 1 83 LEU n 1 84 GLU n 1 85 PHE n 1 86 LEU n 1 87 PRO n 1 88 GLU n 1 89 MSE n 1 90 VAL n 1 91 LEU n 1 92 SER n 1 93 GLN n 1 94 ILE n 1 95 LYS n 1 96 GLN n 1 97 SER n 1 98 ASN n 1 99 GLY n 1 100 ASN n 1 101 HIS n 1 102 ARG n 1 103 ARG n 1 104 SER n 1 105 LEU n 1 106 LEU n 1 107 GLU n 1 108 ARG n 1 109 LEU n 1 110 THR n 1 111 GLN n 1 112 VAL n 1 113 ASP n 1 114 SER n 1 115 SER n 1 116 SER n 1 117 THR n 1 118 ASP n 1 119 GLN n 1 120 THR n 1 121 GLU n 1 122 PRO n 1 123 ASN n 1 124 PRO n 1 125 GLY n 1 126 GLU n 1 127 SER n 1 128 ASP n 1 129 THR n 1 130 SER n 1 131 GLU n 1 132 ASP n 1 133 SER n 1 134 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain PCC7002 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Synechococcus sp.' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id ? _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pIVEX2.3 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description 'In vitro translation' # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q44177_SYNP2 _struct_ref.pdbx_db_accession Q44177 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MEFKKVAKETAITLQSYLTYQAVRLISQQLSETNPGQAIWLGEFSKRHPIQESDLYLEAMMLENKELVLRILTVRENLAE GVLEFLPEMVLSQIKQSNGNHRRSLLERLTQVDSSSTDQTEPNPGESDTSEDSE ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 2Z44 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 134 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q44177 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 134 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 134 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 2Z44 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.53 _exptl_crystal.density_percent_sol 51.42 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details '50% PEG 200, 0.1M phosphate-citrate pH 4.2, 0.2M NaCl, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.id 1 _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.pdbx_collection_date 2005-06-29 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97923 1.0 2 0.97946 1.0 3 0.96423 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.pdbx_synchrotron_site 'Photon Factory' _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97923, 0.97946, 0.96423' # _reflns.entry_id 2Z44 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 50 _reflns.number_all ? _reflns.number_obs 5247 _reflns.percent_possible_obs 98.7 _reflns.pdbx_Rmerge_I_obs 0.109 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 64.2 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.59 _reflns_shell.percent_possible_all 98.2 _reflns_shell.Rmerge_I_obs 0.461 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_ordinal 1 # _refine.entry_id 2Z44 _refine.ls_number_reflns_obs 5247 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 48.80 _refine.ls_d_res_high 2.50 _refine.ls_percent_reflns_obs 98.76 _refine.ls_R_factor_obs 0.20823 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.20452 _refine.ls_R_factor_R_free 0.2805 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.5 _refine.ls_number_reflns_R_free 248 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.955 _refine.correlation_coeff_Fo_to_Fc_free 0.899 _refine.B_iso_mean 53.313 _refine.aniso_B[1][1] -2.27 _refine.aniso_B[2][2] -2.27 _refine.aniso_B[3][3] 3.41 _refine.aniso_B[1][2] -1.14 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.406 _refine.pdbx_overall_ESU_R_Free 0.301 _refine.overall_SU_ML 0.245 _refine.overall_SU_B 12.048 _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_overall_phase_error ? _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 895 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 34 _refine_hist.number_atoms_total 929 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 48.80 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.016 0.022 ? 907 'X-RAY DIFFRACTION' ? r_bond_other_d 0.001 0.020 ? 630 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.463 1.983 ? 1222 'X-RAY DIFFRACTION' ? r_angle_other_deg 0.915 3.000 ? 1543 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 6.023 5.000 ? 109 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 35.114 24.773 ? 44 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 18.941 15.000 ? 181 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 12.034 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.068 0.200 ? 142 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.004 0.020 ? 980 'X-RAY DIFFRACTION' ? r_gen_planes_other 0.001 0.020 ? 170 'X-RAY DIFFRACTION' ? r_nbd_refined 0.204 0.200 ? 235 'X-RAY DIFFRACTION' ? r_nbd_other 0.178 0.200 ? 603 'X-RAY DIFFRACTION' ? r_nbtor_refined 0.174 0.200 ? 441 'X-RAY DIFFRACTION' ? r_nbtor_other 0.096 0.200 ? 482 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined 0.150 0.200 ? 24 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined 0.207 0.200 ? 18 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other 0.268 0.200 ? 48 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined 0.324 0.200 ? 3 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it 1.119 1.500 ? 691 'X-RAY DIFFRACTION' ? r_mcbond_other 0.143 1.500 ? 220 'X-RAY DIFFRACTION' ? r_mcangle_it 1.288 2.000 ? 886 'X-RAY DIFFRACTION' ? r_scbond_it 1.880 3.000 ? 395 'X-RAY DIFFRACTION' ? r_scangle_it 2.971 4.500 ? 336 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.498 _refine_ls_shell.d_res_low 2.563 _refine_ls_shell.number_reflns_R_work 391 _refine_ls_shell.R_factor_R_work 0.268 _refine_ls_shell.percent_reflns_obs 98.55 _refine_ls_shell.R_factor_R_free 0.439 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 18 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 2Z44 _struct.title 'Crystal Structure of Selenomethionine-labeled ORF134' _struct.pdbx_descriptor ORF134 _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 2Z44 _struct_keywords.pdbx_keywords CHAPERONE _struct_keywords.text 'chaperone, helix bundle' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 2 ? ASN A 34 ? GLU A 2 ASN A 34 1 ? 33 HELX_P HELX_P2 2 ASN A 34 ? HIS A 48 ? ASN A 34 HIS A 48 1 ? 15 HELX_P HELX_P3 3 GLU A 52 ? MSE A 61 ? GLU A 52 MSE A 61 1 ? 10 HELX_P HELX_P4 4 ASN A 64 ? LEU A 83 ? ASN A 64 LEU A 83 1 ? 20 HELX_P HELX_P5 5 PHE A 85 ? THR A 110 ? PHE A 85 THR A 110 1 ? 26 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ALA 59 C ? ? ? 1_555 A MSE 60 N ? ? A ALA 59 A MSE 60 1_555 ? ? ? ? ? ? ? 1.326 ? covale2 covale ? ? A MSE 60 C ? ? ? 1_555 A MSE 61 N ? ? A MSE 60 A MSE 61 1_555 ? ? ? ? ? ? ? 1.330 ? covale3 covale ? ? A MSE 61 C ? ? ? 1_555 A LEU 62 N ? ? A MSE 61 A LEU 62 1_555 ? ? ? ? ? ? ? 1.315 ? covale4 covale ? ? A GLU 88 C ? ? ? 1_555 A MSE 89 N ? ? A GLU 88 A MSE 89 1_555 ? ? ? ? ? ? ? 1.334 ? covale5 covale ? ? A MSE 89 C ? ? ? 1_555 A VAL 90 N ? ? A MSE 89 A VAL 90 1_555 ? ? ? ? ? ? ? 1.329 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _database_PDB_matrix.entry_id 2Z44 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 2Z44 _atom_sites.fract_transf_matrix[1][1] 0.017711 _atom_sites.fract_transf_matrix[1][2] 0.010226 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020451 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011742 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 LYS 4 4 4 LYS LYS A . n A 1 5 LYS 5 5 5 LYS LYS A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 THR 13 13 13 THR THR A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 TYR 17 17 17 TYR TYR A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 GLN 21 21 21 GLN GLN A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 VAL 23 23 23 VAL VAL A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 SER 27 27 27 SER SER A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 GLN 29 29 29 GLN GLN A . n A 1 30 LEU 30 30 30 LEU LEU A . n A 1 31 SER 31 31 31 SER SER A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 ASN 34 34 34 ASN ASN A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 ILE 39 39 39 ILE ILE A . n A 1 40 TRP 40 40 40 TRP TRP A . n A 1 41 LEU 41 41 41 LEU LEU A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 GLU 43 43 43 GLU GLU A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 LYS 46 46 46 LYS LYS A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 LEU 57 57 57 LEU LEU A . n A 1 58 GLU 58 58 58 GLU GLU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 MSE 60 60 60 MSE MSE A . n A 1 61 MSE 61 61 61 MSE MSE A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ASN 64 64 64 ASN ASN A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 ARG 70 70 70 ARG ARG A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 VAL 74 74 74 VAL VAL A . n A 1 75 ARG 75 75 75 ARG ARG A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 GLU 80 80 80 GLU GLU A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 MSE 89 89 89 MSE MSE A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 SER 92 92 92 SER SER A . n A 1 93 GLN 93 93 93 GLN GLN A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 LYS 95 95 95 LYS LYS A . n A 1 96 GLN 96 96 96 GLN GLN A . n A 1 97 SER 97 97 97 SER SER A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 ARG 103 103 103 ARG ARG A . n A 1 104 SER 104 104 104 SER SER A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 GLU 107 107 107 GLU GLU A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 GLN 111 111 111 GLN GLN A . n A 1 112 VAL 112 112 ? ? ? A . n A 1 113 ASP 113 113 ? ? ? A . n A 1 114 SER 114 114 ? ? ? A . n A 1 115 SER 115 115 ? ? ? A . n A 1 116 SER 116 116 ? ? ? A . n A 1 117 THR 117 117 ? ? ? A . n A 1 118 ASP 118 118 ? ? ? A . n A 1 119 GLN 119 119 ? ? ? A . n A 1 120 THR 120 120 ? ? ? A . n A 1 121 GLU 121 121 ? ? ? A . n A 1 122 PRO 122 122 ? ? ? A . n A 1 123 ASN 123 123 ? ? ? A . n A 1 124 PRO 124 124 ? ? ? A . n A 1 125 GLY 125 125 ? ? ? A . n A 1 126 GLU 126 126 ? ? ? A . n A 1 127 SER 127 127 ? ? ? A . n A 1 128 ASP 128 128 ? ? ? A . n A 1 129 THR 129 129 ? ? ? A . n A 1 130 SER 130 130 ? ? ? A . n A 1 131 GLU 131 131 ? ? ? A . n A 1 132 ASP 132 132 ? ? ? A . n A 1 133 SER 133 133 ? ? ? A . n A 1 134 GLU 134 134 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 135 1 HOH HOH A . B 2 HOH 2 136 2 HOH HOH A . B 2 HOH 3 137 3 HOH HOH A . B 2 HOH 4 138 4 HOH HOH A . B 2 HOH 5 139 5 HOH HOH A . B 2 HOH 6 140 6 HOH HOH A . B 2 HOH 7 141 7 HOH HOH A . B 2 HOH 8 142 8 HOH HOH A . B 2 HOH 9 143 9 HOH HOH A . B 2 HOH 10 144 10 HOH HOH A . B 2 HOH 11 145 11 HOH HOH A . B 2 HOH 12 146 12 HOH HOH A . B 2 HOH 13 147 13 HOH HOH A . B 2 HOH 14 148 14 HOH HOH A . B 2 HOH 15 149 15 HOH HOH A . B 2 HOH 16 150 16 HOH HOH A . B 2 HOH 17 151 17 HOH HOH A . B 2 HOH 18 152 18 HOH HOH A . B 2 HOH 19 153 19 HOH HOH A . B 2 HOH 20 154 20 HOH HOH A . B 2 HOH 21 155 21 HOH HOH A . B 2 HOH 22 156 22 HOH HOH A . B 2 HOH 23 157 23 HOH HOH A . B 2 HOH 24 158 24 HOH HOH A . B 2 HOH 25 159 25 HOH HOH A . B 2 HOH 26 160 26 HOH HOH A . B 2 HOH 27 161 27 HOH HOH A . B 2 HOH 28 162 28 HOH HOH A . B 2 HOH 29 163 29 HOH HOH A . B 2 HOH 30 164 30 HOH HOH A . B 2 HOH 31 165 31 HOH HOH A . B 2 HOH 32 166 32 HOH HOH A . B 2 HOH 33 167 33 HOH HOH A . B 2 HOH 34 168 34 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 60 A MSE 60 ? MET SELENOMETHIONINE 2 A MSE 61 A MSE 61 ? MET SELENOMETHIONINE 3 A MSE 89 A MSE 89 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5220 ? 1 MORE -39 ? 1 'SSA (A^2)' 11670 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 x,x-y,-z 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 136 ? B HOH . 2 1 A HOH 149 ? B HOH . 3 1 A HOH 153 ? B HOH . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2008-06-24 2 'Structure model' 1 1 2011-07-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Version format compliance' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal REFMAC refinement 5.3.0034 ? 1 HKL-2000 'data collection' . ? 2 HKL-2000 'data reduction' . ? 3 HKL-2000 'data scaling' . ? 4 SOLVE phasing . ? 5 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CG _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 76 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 CD _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 76 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.624 _pdbx_validate_rmsd_bond.bond_target_value 1.515 _pdbx_validate_rmsd_bond.bond_deviation 0.109 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.015 _pdbx_validate_rmsd_bond.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 34 ? ? -164.26 74.45 2 1 ASN A 64 ? ? -163.35 78.94 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A VAL 112 ? A VAL 112 3 1 Y 1 A ASP 113 ? A ASP 113 4 1 Y 1 A SER 114 ? A SER 114 5 1 Y 1 A SER 115 ? A SER 115 6 1 Y 1 A SER 116 ? A SER 116 7 1 Y 1 A THR 117 ? A THR 117 8 1 Y 1 A ASP 118 ? A ASP 118 9 1 Y 1 A GLN 119 ? A GLN 119 10 1 Y 1 A THR 120 ? A THR 120 11 1 Y 1 A GLU 121 ? A GLU 121 12 1 Y 1 A PRO 122 ? A PRO 122 13 1 Y 1 A ASN 123 ? A ASN 123 14 1 Y 1 A PRO 124 ? A PRO 124 15 1 Y 1 A GLY 125 ? A GLY 125 16 1 Y 1 A GLU 126 ? A GLU 126 17 1 Y 1 A SER 127 ? A SER 127 18 1 Y 1 A ASP 128 ? A ASP 128 19 1 Y 1 A THR 129 ? A THR 129 20 1 Y 1 A SER 130 ? A SER 130 21 1 Y 1 A GLU 131 ? A GLU 131 22 1 Y 1 A ASP 132 ? A ASP 132 23 1 Y 1 A SER 133 ? A SER 133 24 1 Y 1 A GLU 134 ? A GLU 134 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #