data_30OR # _entry.id 30OR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 30OR pdb_000030or 10.2210/pdb30or/pdb WWPDB D_1292156148 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-09-16 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 30OR _pdbx_database_status.recvd_initial_deposition_date 2026-05-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 12 _pdbx_contact_author.email ashwin.chari@mpinat.mpg.de _pdbx_contact_author.name_first Ashwin _pdbx_contact_author.name_last Chari _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0001-6220-9828 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Paknia, E.' 1 0000-0002-9228-6215 'Flensburg, C.' 2 0000-0003-2454-5841 'Chodkiewicz, M.L.' 3 0000-0003-4448-445X 'Fogh, R.' 4 0009-0000-6340-7754 'Keller, P.' 5 0000-0001-6737-9383 'Vonrhein, C.' 6 0000-0001-7835-5416 'Schulze-Briese, C.' 7 0000-0002-8850-3926 'Dominiak, P.M.' 8 0000-0002-1466-1243 'Bourenkov, G.' 9 0000-0002-2617-5920 'Bricogne, G.' 10 0000-0002-0298-5507 'Chari, A.' 11 0000-0001-6220-9828 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr D Struct Biol' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2059-7983 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 82 _citation.language ? _citation.page_first 1044 _citation.page_last 1055 _citation.title 'Towards routine accurate electron-density studies of biological macromolecules.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S2059798326007448 _citation.pdbx_database_id_PubMed 42583823 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Paknia, E.' 1 0000-0002-9228-6215 primary 'Flensburg, C.' 2 0000-0003-2454-5841 primary 'Chodkiewicz, M.L.' 3 0000-0003-4448-445X primary 'Fogh, R.H.' 4 0009-0000-6340-7754 primary 'Keller, P.' 5 0000-0001-6737-9383 primary 'Vonrhein, C.' 6 0000-0001-7835-5416 primary 'Schulze-Briese, C.' 7 0000-0002-8850-3926 primary 'Dominiak, P.M.' 8 ? primary 'Bourenkov, G.' 9 0000-0002-2617-5920 primary 'Bricogne, G.' 10 0000-0002-0298-5507 primary 'Chari, A.' 11 0000-0001-6220-9828 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Rubredoxin 6212.862 1 ? W4L,R5S ? ? 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 3 non-polymer syn 'SODIUM ION' 22.990 3 ? ? ? ? 4 water nat water 18.015 115 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Rd # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GGGHMAKLSCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFERIE _entity_poly.pdbx_seq_one_letter_code_can GGGHMAKLSCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFERIE _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 'SODIUM ION' NA 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 GLY n 1 3 GLY n 1 4 HIS n 1 5 MET n 1 6 ALA n 1 7 LYS n 1 8 LEU n 1 9 SER n 1 10 CYS n 1 11 LYS n 1 12 ILE n 1 13 CYS n 1 14 GLY n 1 15 TYR n 1 16 ILE n 1 17 TYR n 1 18 ASP n 1 19 GLU n 1 20 ASP n 1 21 GLU n 1 22 GLY n 1 23 ASP n 1 24 PRO n 1 25 ASP n 1 26 ASN n 1 27 GLY n 1 28 ILE n 1 29 SER n 1 30 PRO n 1 31 GLY n 1 32 THR n 1 33 LYS n 1 34 PHE n 1 35 GLU n 1 36 ASP n 1 37 LEU n 1 38 PRO n 1 39 ASP n 1 40 ASP n 1 41 TRP n 1 42 VAL n 1 43 CYS n 1 44 PRO n 1 45 LEU n 1 46 CYS n 1 47 GLY n 1 48 ALA n 1 49 PRO n 1 50 LYS n 1 51 SER n 1 52 GLU n 1 53 PHE n 1 54 GLU n 1 55 ARG n 1 56 ILE n 1 57 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 57 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'rub, rd, PYRAB08920, PAB7224' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus abyssi GE5' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 272844 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant AI _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pRSET A' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -3 -3 GLY GLY A . n A 1 2 GLY 2 -2 -2 GLY GLY A . n A 1 3 GLY 3 -1 -1 GLY GLY A . n A 1 4 HIS 4 0 0 HIS HIS A . n A 1 5 MET 5 1 1 MET MET A . n A 1 6 ALA 6 2 2 ALA ALA A . n A 1 7 LYS 7 3 3 LYS LYS A . n A 1 8 LEU 8 4 4 LEU LEU A . n A 1 9 SER 9 5 5 SER SER A . n A 1 10 CYS 10 6 6 CYS CYS A . n A 1 11 LYS 11 7 7 LYS LYS A . n A 1 12 ILE 12 8 8 ILE ILE A . n A 1 13 CYS 13 9 9 CYS CYS A . n A 1 14 GLY 14 10 10 GLY GLY A . n A 1 15 TYR 15 11 11 TYR TYR A . n A 1 16 ILE 16 12 12 ILE ILE A . n A 1 17 TYR 17 13 13 TYR TYR A . n A 1 18 ASP 18 14 14 ASP ASP A . n A 1 19 GLU 19 15 15 GLU GLU A . n A 1 20 ASP 20 16 16 ASP ASP A . n A 1 21 GLU 21 17 17 GLU GLU A . n A 1 22 GLY 22 18 18 GLY GLY A . n A 1 23 ASP 23 19 19 ASP ASP A . n A 1 24 PRO 24 20 20 PRO PRO A . n A 1 25 ASP 25 21 21 ASP ASP A . n A 1 26 ASN 26 22 22 ASN ASN A . n A 1 27 GLY 27 23 23 GLY GLY A . n A 1 28 ILE 28 24 24 ILE ILE A . n A 1 29 SER 29 25 25 SER SER A . n A 1 30 PRO 30 26 26 PRO PRO A . n A 1 31 GLY 31 27 27 GLY GLY A . n A 1 32 THR 32 28 28 THR THR A . n A 1 33 LYS 33 29 29 LYS LYS A . n A 1 34 PHE 34 30 30 PHE PHE A . n A 1 35 GLU 35 31 31 GLU GLU A . n A 1 36 ASP 36 32 32 ASP ASP A . n A 1 37 LEU 37 33 33 LEU LEU A . n A 1 38 PRO 38 34 34 PRO PRO A . n A 1 39 ASP 39 35 35 ASP ASP A . n A 1 40 ASP 40 36 36 ASP ASP A . n A 1 41 TRP 41 37 37 TRP TRP A . n A 1 42 VAL 42 38 38 VAL VAL A . n A 1 43 CYS 43 39 39 CYS CYS A . n A 1 44 PRO 44 40 40 PRO PRO A . n A 1 45 LEU 45 41 41 LEU LEU A . n A 1 46 CYS 46 42 42 CYS CYS A . n A 1 47 GLY 47 43 43 GLY GLY A . n A 1 48 ALA 48 44 44 ALA ALA A . n A 1 49 PRO 49 45 45 PRO PRO A . n A 1 50 LYS 50 46 46 LYS LYS A . n A 1 51 SER 51 47 47 SER SER A . n A 1 52 GLU 52 48 48 GLU GLU A . n A 1 53 PHE 53 49 49 PHE PHE A . n A 1 54 GLU 54 50 50 GLU GLU A . n A 1 55 ARG 55 51 51 ARG ARG A . n A 1 56 ILE 56 52 52 ILE ILE A . n A 1 57 GLU 57 53 53 GLU GLU A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id FE _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id FE _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 101 54 FE FE A . C 3 NA 1 102 1 NA NA A . D 3 NA 1 103 2 NA NA A . E 3 NA 1 104 3 NA NA A . F 4 HOH 1 201 80 HOH HOH A . F 4 HOH 2 202 99 HOH HOH A . F 4 HOH 3 203 113 HOH HOH A . F 4 HOH 4 204 100 HOH HOH A . F 4 HOH 5 205 58 HOH HOH A . F 4 HOH 6 206 91 HOH HOH A . F 4 HOH 7 207 39 HOH HOH A . F 4 HOH 8 208 37 HOH HOH A . F 4 HOH 9 209 66 HOH HOH A . F 4 HOH 10 210 7 HOH HOH A . F 4 HOH 11 211 84 HOH HOH A . F 4 HOH 12 212 94 HOH HOH A . F 4 HOH 13 213 107 HOH HOH A . F 4 HOH 14 214 102 HOH HOH A . F 4 HOH 15 215 19 HOH HOH A . F 4 HOH 16 216 8 HOH HOH A . F 4 HOH 17 217 49 HOH HOH A . F 4 HOH 18 218 89 HOH HOH A . F 4 HOH 19 219 32 HOH HOH A . F 4 HOH 20 220 90 HOH HOH A . F 4 HOH 21 221 71 HOH HOH A . F 4 HOH 22 222 6 HOH HOH A . F 4 HOH 23 223 93 HOH HOH A . F 4 HOH 24 224 15 HOH HOH A . F 4 HOH 25 225 4 HOH HOH A . F 4 HOH 26 226 60 HOH HOH A . F 4 HOH 27 227 106 HOH HOH A . F 4 HOH 28 228 50 HOH HOH A . F 4 HOH 29 229 2 HOH HOH A . F 4 HOH 30 230 13 HOH HOH A . F 4 HOH 31 231 64 HOH HOH A . F 4 HOH 32 232 3 HOH HOH A . F 4 HOH 33 233 74 HOH HOH A . F 4 HOH 34 234 17 HOH HOH A . F 4 HOH 35 235 30 HOH HOH A . F 4 HOH 36 236 57 HOH HOH A . F 4 HOH 37 237 72 HOH HOH A . F 4 HOH 38 238 16 HOH HOH A . F 4 HOH 39 239 43 HOH HOH A . F 4 HOH 40 240 10 HOH HOH A . F 4 HOH 41 241 62 HOH HOH A . F 4 HOH 42 242 70 HOH HOH A . F 4 HOH 43 243 82 HOH HOH A . F 4 HOH 44 244 68 HOH HOH A . F 4 HOH 45 245 35 HOH HOH A . F 4 HOH 46 246 86 HOH HOH A . F 4 HOH 47 247 29 HOH HOH A . F 4 HOH 48 248 48 HOH HOH A . F 4 HOH 49 249 1 HOH HOH A . F 4 HOH 50 250 55 HOH HOH A . F 4 HOH 51 251 34 HOH HOH A . F 4 HOH 52 252 28 HOH HOH A . F 4 HOH 53 253 83 HOH HOH A . F 4 HOH 54 254 56 HOH HOH A . F 4 HOH 55 255 9 HOH HOH A . F 4 HOH 56 256 67 HOH HOH A . F 4 HOH 57 257 87 HOH HOH A . F 4 HOH 58 258 44 HOH HOH A . F 4 HOH 59 259 33 HOH HOH A . F 4 HOH 60 260 110 HOH HOH A . F 4 HOH 61 261 26 HOH HOH A . F 4 HOH 62 262 12 HOH HOH A . F 4 HOH 63 263 40 HOH HOH A . F 4 HOH 64 264 95 HOH HOH A . F 4 HOH 65 265 47 HOH HOH A . F 4 HOH 66 266 46 HOH HOH A . F 4 HOH 67 267 31 HOH HOH A . F 4 HOH 68 268 101 HOH HOH A . F 4 HOH 69 269 42 HOH HOH A . F 4 HOH 70 270 114 HOH HOH A . F 4 HOH 71 271 96 HOH HOH A . F 4 HOH 72 272 105 HOH HOH A . F 4 HOH 73 273 11 HOH HOH A . F 4 HOH 74 274 63 HOH HOH A . F 4 HOH 75 275 111 HOH HOH A . F 4 HOH 76 276 24 HOH HOH A . F 4 HOH 77 277 14 HOH HOH A . F 4 HOH 78 278 97 HOH HOH A . F 4 HOH 79 279 81 HOH HOH A . F 4 HOH 80 280 5 HOH HOH A . F 4 HOH 81 281 36 HOH HOH A . F 4 HOH 82 282 27 HOH HOH A . F 4 HOH 83 283 54 HOH HOH A . F 4 HOH 84 284 112 HOH HOH A . F 4 HOH 85 285 78 HOH HOH A . F 4 HOH 86 286 92 HOH HOH A . F 4 HOH 87 287 98 HOH HOH A . F 4 HOH 88 288 69 HOH HOH A . F 4 HOH 89 289 38 HOH HOH A . F 4 HOH 90 290 53 HOH HOH A . F 4 HOH 91 291 18 HOH HOH A . F 4 HOH 92 292 108 HOH HOH A . F 4 HOH 93 293 23 HOH HOH A . F 4 HOH 94 294 51 HOH HOH A . F 4 HOH 95 295 65 HOH HOH A . F 4 HOH 96 296 109 HOH HOH A . F 4 HOH 97 297 115 HOH HOH A . F 4 HOH 98 298 88 HOH HOH A . F 4 HOH 99 299 85 HOH HOH A . F 4 HOH 100 300 52 HOH HOH A . F 4 HOH 101 301 59 HOH HOH A . F 4 HOH 102 302 61 HOH HOH A . F 4 HOH 103 303 77 HOH HOH A . F 4 HOH 104 304 22 HOH HOH A . F 4 HOH 105 305 25 HOH HOH A . F 4 HOH 106 306 103 HOH HOH A . F 4 HOH 107 307 21 HOH HOH A . F 4 HOH 108 308 41 HOH HOH A . F 4 HOH 109 309 20 HOH HOH A . F 4 HOH 110 310 73 HOH HOH A . F 4 HOH 111 311 104 HOH HOH A . F 4 HOH 112 312 45 HOH HOH A . F 4 HOH 113 313 75 HOH HOH A . F 4 HOH 114 314 79 HOH HOH A . F 4 HOH 115 315 76 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.4 ? 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? MxCuBE ? ? ? . ? 2 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Jan 19, 2025 (2025-11-03)' ? 3 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? 20260314 ? 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.8.2 ? 5 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? STARANISO ? ? ? '3.0.19 (17-01-2026)' ? 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? '2.10.4 (2026-02-17)' ? 7 # _cell.angle_alpha 90 _cell.angle_alpha_esd ? _cell.angle_beta 90 _cell.angle_beta_esd ? _cell.angle_gamma 90 _cell.angle_gamma_esd ? _cell.entry_id 30OR _cell.details ? _cell.formula_units_Z ? _cell.length_a 24.73 _cell.length_a_esd ? _cell.length_b 39.237 _cell.length_b_esd ? _cell.length_c 45.14 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 30OR _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 30OR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.8 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 29.72 _exptl_crystal.description orthorhombic _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '3.6 - 3.8 M Sodium Malonate (pH 6.0)' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 291 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details '19 Beryllium compound refractive lenses, proximal slits (20 cm from sample)' _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER2 X CdTe 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-06-17 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator M _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.38573 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P14 (MX2)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.38573 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P14 (MX2)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 30OR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 0.433 _reflns.d_resolution_low 20.921 _reflns.details ;Some remarks regarding the mmCIF items written, the PDB Exchange Dictionary (PDBx/mmCIF) Version 5.0 supporting the data files in the current PDB archive (dictionary version 5.325, last updated 2020-04-13: http://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v50.dic/Index/) and the actual quantities provided by MRFANA (https://github.com/githubgphl/MRFANA) from the autoPROC package (https://www.globalphasing.com/autoproc/). In general, the mmCIF categories here should provide items that are currently used in the PDB archive. If there are alternatives, the one recommended by the PDB developers has been selected. The distinction between *_all and *_obs quantities is not always clear: often only one version is actively used within the PDB archive (or is the one recommended by PDB developers). The intention of distinguishing between classes of reflections before and after some kind of observation criterion was applied, can in principle be useful - but such criteria change in various ways throughout the data processing steps (rejection of overloaded or too partial reflections, outlier/misfit rejections during scaling etc) and there is no retrospect computation of data scaling/merging statistics for the reflections used in the final refinement (where another observation criterion might have been applied). Typical data processing will usually only provide one version of statistics at various stages and these are given in the recommended item here, irrespective of the "_all" and "_obs" connotation, see e.g. the use of _reflns.pdbx_Rmerge_I_obs, _reflns.pdbx_Rrim_I_all and _reflns.pdbx_Rpim_I_all. Please note that all statistics related to "merged intensities" (or "merging") are based on inverse-variance weighting of the individual measurements making up a symmetry-unique reflection. This is standard for several decades now, even if some of the dictionary definitions seem to suggest that a simple "mean" or "average" intensity is being used instead. R-values are always given for all symmetry-equivalent reflections following Friedel's law, i.e. Bijvoet pairs are not treated separately (since we want to describe the overall mean intensity and not the mean I(+) and I(-) here). The Rrim metric is identical to the Rmeas R-value and only differs in name. _reflns.pdbx_number_measured_all is the number of measured intensities just before the final merging step (at which point no additional rejection takes place). _reflns.number_obs is the number of symmetry-unique observations, i.e. the result of merging those measurements via inverse-variance weighting. _reflns.pdbx_netI_over_sigmaI is based on the merged intensities (_reflns.number_obs) as expected. _reflns.pdbx_redundancy is synonymous with "multiplicity". The per-shell item _reflns_shell.number_measured_all corresponds to the overall value _reflns.pdbx_number_measured_all. The per-shell item _reflns_shell.number_unique_all corresponds to the overall value _reflns.number_obs. The per-shell item _reflns_shell.percent_possible_all corresponds to the overall value _reflns.percent_possible_obs. The per-shell item _reflns_shell.meanI_over_sigI_obs corresponds to the overall value given as _reflns.pdbx_netI_over_sigmaI. But be aware of the incorrect definition of the former in the current dictionary! ; _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 245905 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 26.62 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.92 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.0573 _reflns.pdbx_Rpim_I_all 0.0110 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 6545565 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 1.000 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.0562 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] 1.00000 _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] 0.00000 _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] 0.00000 _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] 0.00000 _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] 1.00000 _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] 0.00000 _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] 0.00000 _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] 0.00000 _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] 1.00000 _reflns.pdbx_aniso_diffraction_limit_1 0.44100 _reflns.pdbx_aniso_diffraction_limit_2 0.46200 _reflns.pdbx_aniso_diffraction_limit_3 0.45600 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] 1.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] 1.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] 1.0000 _reflns.pdbx_aniso_B_tensor_eigenvalue_1 0.0000 _reflns.pdbx_aniso_B_tensor_eigenvalue_2 0.0908 _reflns.pdbx_aniso_B_tensor_eigenvalue_3 0.4326 _reflns.pdbx_orthogonalization_convention pdb _reflns.pdbx_percent_possible_ellipsoidal 96.2 _reflns.pdbx_percent_possible_spherical 84.4 _reflns.pdbx_percent_possible_ellipsoidal_anomalous 96.2 _reflns.pdbx_percent_possible_spherical_anomalous 84.3 _reflns.pdbx_redundancy_anomalous 13.68 _reflns.pdbx_CC_half_anomalous -0.102 _reflns.pdbx_absDiff_over_sigma_anomalous 0.813 _reflns.pdbx_percent_possible_anomalous 96.2 _reflns.pdbx_observed_signal_threshold 1.20 _reflns.pdbx_signal_type 'local ' _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_CC_star _reflns_shell.pdbx_R_split _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_percent_possible_ellipsoidal _reflns_shell.pdbx_percent_possible_spherical _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous _reflns_shell.pdbx_percent_possible_spherical_anomalous _reflns_shell.pdbx_redundancy_anomalous _reflns_shell.pdbx_CC_half_anomalous _reflns_shell.pdbx_absDiff_over_sigma_anomalous _reflns_shell.pdbx_percent_possible_anomalous 1.264 20.921 ? 71.92 342259 342259 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 27.84 ? ? ? 0.0380 0.0073 ? 1 ? 1.000 ? ? 100.0 ? 0.0373 ? 100.0 100.0 100.0 100.0 15.07 -0.121 0.791 100.0 0.998 1.264 ? 68.11 342463 342463 ? 12296 12296 ? ? ? ? ? ? ? ? ? ? ? 27.85 ? ? ? 0.0477 0.0090 ? 2 ? 1.000 ? ? 100.0 ? 0.0468 ? 100.0 100.0 100.0 100.0 14.59 0.129 0.955 100.0 0.869 0.998 ? 60.64 349888 349888 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 28.46 ? ? ? 0.0594 0.0111 ? 3 ? 0.999 ? ? 100.0 ? 0.0583 ? 100.0 100.0 100.0 100.0 14.79 0.126 1.049 100.0 0.788 0.869 ? 52.33 352489 352489 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 28.67 ? ? ? 0.0674 0.0126 ? 4 ? 0.999 ? ? 100.0 ? 0.0662 ? 100.0 100.0 100.0 100.0 14.83 0.205 1.000 100.0 0.731 0.788 ? 44.78 335727 335727 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 27.31 ? ? ? 0.0815 0.0156 ? 5 ? 0.999 ? ? 100.0 ? 0.0800 ? 100.0 100.0 100.0 100.0 14.08 0.166 0.992 100.0 0.687 0.731 ? 38.04 332446 332446 ? 12296 12296 ? ? ? ? ? ? ? ? ? ? ? 27.04 ? ? ? 0.0922 0.0177 ? 6 ? 0.999 ? ? 100.0 ? 0.0905 ? 100.0 100.0 100.0 100.0 13.93 0.190 0.982 100.0 0.652 0.687 ? 30.96 335814 335814 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 27.31 ? ? ? 0.1141 0.0217 ? 7 ? 0.999 ? ? 100.0 ? 0.1120 ? 100.0 100.0 100.0 100.0 14.04 0.151 0.915 100.0 0.624 0.652 ? 24.27 337958 337958 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 27.49 ? ? ? 0.1514 0.0288 ? 8 ? 0.998 ? ? 100.0 ? 0.1486 ? 100.0 100.0 100.0 100.0 14.11 0.121 0.855 100.0 0.599 0.624 ? 19.85 338752 338752 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 27.55 ? ? ? 0.1852 0.0351 ? 9 ? 0.997 ? ? 100.0 ? 0.1818 ? 100.0 100.0 100.0 100.0 14.15 0.110 0.810 100.0 0.578 0.599 ? 16.22 338904 338904 ? 12296 12296 ? ? ? ? ? ? ? ? ? ? ? 27.56 ? ? ? 0.2324 0.0441 ? 10 ? 0.995 ? ? 100.0 ? 0.2282 ? 100.0 100.0 100.0 100.0 14.14 0.074 0.779 100.0 0.560 0.578 ? 12.88 336358 336358 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 27.36 ? ? ? 0.2912 0.0555 ? 11 ? 0.993 ? ? 100.0 ? 0.2859 ? 100.0 100.0 100.0 100.0 14.02 0.054 0.727 100.0 0.544 0.560 ? 9.91 334980 334980 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 27.25 ? ? ? 0.3870 0.0738 ? 12 ? 0.987 ? ? 100.0 ? 0.3799 ? 100.0 100.0 100.0 100.0 13.95 0.024 0.716 100.0 0.529 0.544 ? 7.20 329365 329365 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 26.79 ? ? ? 0.5294 0.1017 ? 13 ? 0.976 ? ? 100.0 ? 0.5195 ? 100.0 100.0 100.0 100.0 13.71 0.060 0.750 100.0 0.516 0.529 ? 5.43 328053 328053 ? 12296 12296 ? ? ? ? ? ? ? ? ? ? ? 26.68 ? ? ? 0.7187 0.1385 ? 14 ? 0.960 ? ? 100.0 ? 0.7052 ? 100.0 100.0 100.0 100.0 13.64 0.136 0.780 100.0 0.505 0.516 ? 4.07 328112 328112 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 26.69 ? ? ? 0.9773 0.1883 ? 15 ? 0.930 ? ? 99.9 ? 0.9588 ? 99.9 99.9 100.0 100.0 13.64 0.119 0.749 100.0 0.494 0.505 ? 3.25 328644 328644 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 26.73 ? ? ? 1.2380 0.2383 ? 16 ? 0.887 ? ? 99.4 ? 1.2147 ? 99.4 99.4 99.6 99.6 13.64 0.099 0.729 99.6 0.484 0.494 ? 2.73 329064 329064 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 26.76 ? ? ? 1.4971 0.2879 ? 17 ? 0.839 ? ? 98.7 ? 1.4689 ? 98.7 98.7 99.1 99.1 13.64 0.063 0.704 99.1 0.474 0.484 ? 2.25 329534 329534 ? 12296 12296 ? ? ? ? ? ? ? ? ? ? ? 26.80 ? ? ? 1.8377 0.3532 ? 18 ? 0.772 ? ? 96.8 ? 1.8032 ? 96.8 96.8 97.3 97.3 13.64 0.075 0.701 97.3 0.464 0.474 ? 1.94 276396 276396 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 22.48 ? ? ? 1.9310 0.4053 ? 19 ? 0.706 ? ? 86.5 ? 1.8875 ? 86.5 86.5 87.3 87.3 11.42 0.049 0.676 87.3 0.433 0.464 ? 1.66 218359 218359 ? 12295 12295 ? ? ? ? ? ? ? ? ? ? ? 17.76 ? ? ? 1.9230 0.4541 ? 20 ? 0.621 ? ? 59.9 ? 1.8678 ? 59.9 22.3 60.2 22.5 9.01 0.006 0.640 60.2 # _refine.aniso_B[1][1] -0.2324 _refine.aniso_B[1][2] 0 _refine.aniso_B[1][3] 0 _refine.aniso_B[2][2] -0.0449 _refine.aniso_B[2][3] 0 _refine.aniso_B[3][3] 0.2772 _refine.B_iso_max ? _refine.B_iso_mean 4.38 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.993 _refine.correlation_coeff_Fo_to_Fc_free 0.993 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 30OR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 0.434 _refine.ls_d_res_low 20.92 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 245522 _refine.ls_number_reflns_R_free 12376 _refine.ls_number_reflns_R_work 233146 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 85.1 _refine.ls_percent_reflns_R_free ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.0685 _refine.ls_R_factor_R_free 0.0725 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.0682 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.002 _refine.pdbx_overall_SU_R_free_Blow_DPI 0.002 _refine.pdbx_overall_SU_R_Blow_DPI 0.002 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI 0.002 _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 30OR _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_coordinate_error_obs 0.024 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 0.434 _refine_hist.d_res_low 20.92 _refine_hist.number_atoms_solvent 115 _refine_hist.number_atoms_total 552 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 433 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.032 ? 1233 ? t_bond_d 2 ? HARMONIC 'X-RAY DIFFRACTION' ? 2.38 ? 2299 ? t_angle_deg 2 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 369 ? t_dihedral_angle_d 2 ? SINUSOIDAL 'X-RAY DIFFRACTION' ? ? ? 221 ? t_gen_planes 5 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 1233 ? t_it 10 ? HARMONIC 'X-RAY DIFFRACTION' ? ? ? 86 ? t_chiral_improper_torsion 5 ? SEMIHARMONIC 'X-RAY DIFFRACTION' ? ? ? 1641 ? t_ideal_dist_contact 4 ? SEMIHARMONIC 'X-RAY DIFFRACTION' ? 6.69 ? ? ? t_omega_torsion ? ? ? 'X-RAY DIFFRACTION' ? 15.01 ? ? ? t_other_torsion ? ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 0.434 _refine_ls_shell.d_res_low 0.46 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 264 _refine_ls_shell.number_reflns_R_work 4647 _refine_ls_shell.percent_reflns_obs 99.48 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2579 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_R_complete ? _refine_ls_shell.correlation_coeff_Fo_to_Fc ? _refine_ls_shell.correlation_coeff_Fo_to_Fc_free ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work ? _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? _refine_ls_shell.R_factor_R_free 0.2666 # _struct.entry_id 30OR _struct.title 'Pyrococcus abyssi Rubredoxin @ 0.43 Angstrom resolution, Independent Atom Model (IAM) refinement' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 30OR _struct_keywords.text 'Rubredoxin, electron tranport, ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code RUBR_PYRAB _struct_ref.pdbx_db_accession Q9V099 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code MAKWRCKICGYIYDEDEGDPDNGISPGTKFEDLPDDWVCPLCGAPKSEFERIE _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 30OR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 5 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 57 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9V099 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 53 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 53 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 30OR GLY A 1 ? UNP Q9V099 ? ? 'expression tag' -3 1 1 30OR GLY A 2 ? UNP Q9V099 ? ? 'expression tag' -2 2 1 30OR GLY A 3 ? UNP Q9V099 ? ? 'expression tag' -1 3 1 30OR HIS A 4 ? UNP Q9V099 ? ? 'expression tag' 0 4 1 30OR LEU A 8 ? UNP Q9V099 TRP 4 conflict 4 5 1 30OR SER A 9 ? UNP Q9V099 ARG 5 conflict 5 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 23 ? GLY A 27 ? ASP A 19 GLY A 23 5 ? 5 HELX_P HELX_P2 AA2 LYS A 33 ? LEU A 37 ? LYS A 29 LEU A 33 5 ? 5 HELX_P HELX_P3 AA3 PRO A 49 ? SER A 51 ? PRO A 45 SER A 47 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 10 SG ? ? ? 1_555 B FE . FE ? ? A CYS 6 A FE 101 1_555 ? ? ? ? ? ? ? 2.298 ? ? metalc2 metalc ? ? A CYS 13 SG ? ? ? 1_555 B FE . FE ? ? A CYS 9 A FE 101 1_555 ? ? ? ? ? ? ? 2.270 ? ? metalc3 metalc ? ? A ASN 26 OD1 ? ? ? 1_555 C NA . NA ? ? A ASN 22 A NA 102 1_555 ? ? ? ? ? ? ? 2.426 ? ? metalc4 metalc ? ? A GLU 35 OE1 B ? ? 1_555 C NA . NA ? ? A GLU 31 A NA 102 3_555 ? ? ? ? ? ? ? 2.744 ? ? metalc5 metalc ? ? A GLU 35 OE2 A ? ? 1_555 C NA . NA ? ? A GLU 31 A NA 102 3_555 ? ? ? ? ? ? ? 2.372 ? ? metalc6 metalc ? ? A GLU 35 O ? ? ? 1_555 D NA . NA A ? A GLU 31 A NA 103 1_555 ? ? ? ? ? ? ? 2.253 ? ? metalc7 metalc ? ? A CYS 43 SG ? ? ? 1_555 B FE . FE ? ? A CYS 39 A FE 101 1_555 ? ? ? ? ? ? ? 2.339 ? ? metalc8 metalc ? ? A CYS 46 SG ? ? ? 1_555 B FE . FE ? ? A CYS 42 A FE 101 1_555 ? ? ? ? ? ? ? 2.278 ? ? metalc9 metalc ? ? C NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 102 A HOH 250 1_555 ? ? ? ? ? ? ? 2.424 ? ? metalc10 metalc ? ? C NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 102 A HOH 274 3_545 ? ? ? ? ? ? ? 2.409 ? ? metalc11 metalc ? ? C NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 102 A HOH 277 1_555 ? ? ? ? ? ? ? 2.451 ? ? metalc12 metalc ? ? C NA . NA ? ? ? 1_555 F HOH . O ? ? A NA 102 A HOH 280 1_555 ? ? ? ? ? ? ? 2.440 ? ? metalc13 metalc ? ? D NA . NA A ? ? 1_555 F HOH . O A ? A NA 103 A HOH 206 1_555 ? ? ? ? ? ? ? 2.861 ? ? metalc14 metalc ? ? D NA . NA A ? ? 1_555 F HOH . O A ? A NA 103 A HOH 242 3_555 ? ? ? ? ? ? ? 2.762 ? ? metalc15 metalc ? ? D NA . NA A ? ? 1_555 F HOH . O A ? A NA 103 A HOH 245 1_555 ? ? ? ? ? ? ? 2.513 ? ? metalc16 metalc ? ? D NA . NA A ? ? 1_555 F HOH . O A ? A NA 103 A HOH 256 1_555 ? ? ? ? ? ? ? 2.422 ? ? metalc17 metalc ? ? D NA . NA A ? ? 1_555 F HOH . O A ? A NA 103 A HOH 282 1_555 ? ? ? ? ? ? ? 2.365 ? ? metalc18 metalc ? ? D NA . NA A ? ? 1_555 F HOH . O A ? A NA 103 A HOH 298 1_555 ? ? ? ? ? ? ? 2.379 ? ? metalc19 metalc ? ? E NA . NA B ? ? 1_555 F HOH . O ? ? A NA 104 A HOH 218 2_465 ? ? ? ? ? ? ? 2.357 ? ? metalc20 metalc ? ? E NA . NA B ? ? 1_555 F HOH . O B ? A NA 104 A HOH 223 1_555 ? ? ? ? ? ? ? 2.573 ? ? metalc21 metalc ? ? E NA . NA B ? ? 1_555 F HOH . O B ? A NA 104 A HOH 231 2_565 ? ? ? ? ? ? ? 2.551 ? ? metalc22 metalc ? ? E NA . NA B ? ? 1_555 F HOH . O B ? A NA 104 A HOH 270 1_555 ? ? ? ? ? ? ? 2.364 ? ? metalc23 metalc ? ? E NA . NA B ? ? 1_555 F HOH . O B ? A NA 104 A HOH 286 1_555 ? ? ? ? ? ? ? 2.626 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 10 ? A CYS 6 ? 1_555 FE ? B FE . ? A FE 101 ? 1_555 SG ? A CYS 13 ? A CYS 9 ? 1_555 116.7 ? 2 SG ? A CYS 10 ? A CYS 6 ? 1_555 FE ? B FE . ? A FE 101 ? 1_555 SG ? A CYS 43 ? A CYS 39 ? 1_555 112.9 ? 3 SG ? A CYS 13 ? A CYS 9 ? 1_555 FE ? B FE . ? A FE 101 ? 1_555 SG ? A CYS 43 ? A CYS 39 ? 1_555 98.6 ? 4 SG ? A CYS 10 ? A CYS 6 ? 1_555 FE ? B FE . ? A FE 101 ? 1_555 SG ? A CYS 46 ? A CYS 42 ? 1_555 103.4 ? 5 SG ? A CYS 13 ? A CYS 9 ? 1_555 FE ? B FE . ? A FE 101 ? 1_555 SG ? A CYS 46 ? A CYS 42 ? 1_555 113.1 ? 6 SG ? A CYS 43 ? A CYS 39 ? 1_555 FE ? B FE . ? A FE 101 ? 1_555 SG ? A CYS 46 ? A CYS 42 ? 1_555 112.6 ? 7 OD1 ? A ASN 26 ? A ASN 22 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 OE1 B A GLU 35 ? A GLU 31 ? 1_555 57.1 ? 8 OD1 ? A ASN 26 ? A ASN 22 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 OE2 A A GLU 35 ? A GLU 31 ? 1_555 55.3 ? 9 OE1 B A GLU 35 ? A GLU 31 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 OE2 A A GLU 35 ? A GLU 31 ? 1_555 2.5 ? 10 OD1 ? A ASN 26 ? A ASN 22 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 250 ? 1_555 90.5 ? 11 OE1 B A GLU 35 ? A GLU 31 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 250 ? 1_555 84.2 ? 12 OE2 A A GLU 35 ? A GLU 31 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 250 ? 1_555 82.6 ? 13 OD1 ? A ASN 26 ? A ASN 22 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 274 ? 3_545 97.0 ? 14 OE1 B A GLU 35 ? A GLU 31 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 274 ? 3_545 110.9 ? 15 OE2 A A GLU 35 ? A GLU 31 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 274 ? 3_545 112.5 ? 16 O ? F HOH . ? A HOH 250 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 274 ? 3_545 164.9 ? 17 OD1 ? A ASN 26 ? A ASN 22 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 277 ? 1_555 170.5 ? 18 OE1 B A GLU 35 ? A GLU 31 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 277 ? 1_555 114.8 ? 19 OE2 A A GLU 35 ? A GLU 31 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 277 ? 1_555 116.4 ? 20 O ? F HOH . ? A HOH 250 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 277 ? 1_555 83.4 ? 21 O ? F HOH . ? A HOH 274 ? 3_545 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 277 ? 1_555 90.7 ? 22 OD1 ? A ASN 26 ? A ASN 22 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 280 ? 1_555 85.0 ? 23 OE1 B A GLU 35 ? A GLU 31 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 280 ? 1_555 32.6 ? 24 OE2 A A GLU 35 ? A GLU 31 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 280 ? 1_555 35.1 ? 25 O ? F HOH . ? A HOH 250 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 280 ? 1_555 100.8 ? 26 O ? F HOH . ? A HOH 274 ? 3_545 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 280 ? 1_555 93.0 ? 27 O ? F HOH . ? A HOH 277 ? 1_555 NA ? C NA . ? A NA 102 ? 1_555 O ? F HOH . ? A HOH 280 ? 1_555 89.0 ? 28 O ? A GLU 35 ? A GLU 31 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 206 ? 1_555 72.3 ? 29 O ? A GLU 35 ? A GLU 31 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 242 ? 3_555 109.4 ? 30 O A F HOH . ? A HOH 206 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 242 ? 3_555 58.8 ? 31 O ? A GLU 35 ? A GLU 31 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 245 ? 1_555 89.0 ? 32 O A F HOH . ? A HOH 206 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 245 ? 1_555 142.0 ? 33 O A F HOH . ? A HOH 242 ? 3_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 245 ? 1_555 157.7 ? 34 O ? A GLU 35 ? A GLU 31 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 256 ? 1_555 88.4 ? 35 O A F HOH . ? A HOH 206 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 256 ? 1_555 45.1 ? 36 O A F HOH . ? A HOH 242 ? 3_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 256 ? 1_555 89.8 ? 37 O A F HOH . ? A HOH 245 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 256 ? 1_555 103.5 ? 38 O ? A GLU 35 ? A GLU 31 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 282 ? 1_555 99.3 ? 39 O A F HOH . ? A HOH 206 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 282 ? 1_555 129.0 ? 40 O A F HOH . ? A HOH 242 ? 3_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 282 ? 1_555 79.2 ? 41 O A F HOH . ? A HOH 245 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 282 ? 1_555 85.7 ? 42 O A F HOH . ? A HOH 256 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 282 ? 1_555 168.2 ? 43 O ? A GLU 35 ? A GLU 31 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 298 ? 1_555 171.1 ? 44 O A F HOH . ? A HOH 206 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 298 ? 1_555 108.7 ? 45 O A F HOH . ? A HOH 242 ? 3_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 298 ? 1_555 77.8 ? 46 O A F HOH . ? A HOH 245 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 298 ? 1_555 85.1 ? 47 O A F HOH . ? A HOH 256 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 298 ? 1_555 86.5 ? 48 O A F HOH . ? A HOH 282 ? 1_555 NA A D NA . ? A NA 103 ? 1_555 O A F HOH . ? A HOH 298 ? 1_555 86.9 ? 49 O ? F HOH . ? A HOH 218 ? 2_465 NA B E NA . ? A NA 104 ? 1_555 O B F HOH . ? A HOH 223 ? 1_555 103.8 ? 50 O ? F HOH . ? A HOH 218 ? 2_465 NA B E NA . ? A NA 104 ? 1_555 O B F HOH . ? A HOH 231 ? 2_565 85.5 ? 51 O B F HOH . ? A HOH 223 ? 1_555 NA B E NA . ? A NA 104 ? 1_555 O B F HOH . ? A HOH 231 ? 2_565 100.5 ? 52 O ? F HOH . ? A HOH 218 ? 2_465 NA B E NA . ? A NA 104 ? 1_555 O B F HOH . ? A HOH 270 ? 1_555 91.1 ? 53 O B F HOH . ? A HOH 223 ? 1_555 NA B E NA . ? A NA 104 ? 1_555 O B F HOH . ? A HOH 270 ? 1_555 76.2 ? 54 O B F HOH . ? A HOH 231 ? 2_565 NA B E NA . ? A NA 104 ? 1_555 O B F HOH . ? A HOH 270 ? 1_555 174.6 ? 55 O ? F HOH . ? A HOH 218 ? 2_465 NA B E NA . ? A NA 104 ? 1_555 O B F HOH . ? A HOH 286 ? 1_555 106.9 ? 56 O B F HOH . ? A HOH 223 ? 1_555 NA B E NA . ? A NA 104 ? 1_555 O B F HOH . ? A HOH 286 ? 1_555 144.7 ? 57 O B F HOH . ? A HOH 231 ? 2_565 NA B E NA . ? A NA 104 ? 1_555 O B F HOH . ? A HOH 286 ? 1_555 98.8 ? 58 O B F HOH . ? A HOH 270 ? 1_555 NA B E NA . ? A NA 104 ? 1_555 O B F HOH . ? A HOH 286 ? 1_555 86.3 ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 3 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 16 ? ASP A 18 ? ILE A 12 ASP A 14 AA1 2 LYS A 7 ? CYS A 10 ? LYS A 3 CYS A 6 AA1 3 PHE A 53 ? GLU A 57 ? PHE A 49 GLU A 53 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O TYR A 17 ? O TYR A 13 N LEU A 8 ? N LEU A 4 AA1 2 3 N LYS A 7 ? N LYS A 3 O ILE A 56 ? O ILE A 52 # _pdbx_entry_details.entry_id 30OR _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 N A GLY -3 ? B CA A GLY -3 ? B 1.331 1.456 -0.125 0.015 N 2 1 C A GLY -3 ? B N A GLY -2 ? B 1.130 1.336 -0.206 0.023 Y 3 1 NE2 A HIS 0 ? B CD2 A HIS 0 ? B 1.256 1.373 -0.117 0.011 N 4 1 SD A MET 1 ? B CE A MET 1 ? B 1.358 1.774 -0.416 0.056 N 5 1 CB A SER 5 ? A OG A SER 5 ? A 1.324 1.418 -0.094 0.013 N 6 1 CD A GLU 17 ? B OE1 A GLU 17 ? B 1.172 1.252 -0.080 0.011 N 7 1 CD A GLU 17 ? B OE2 A GLU 17 ? B 1.351 1.252 0.099 0.011 N 8 1 CG A ASP 21 ? B OD2 A ASP 21 ? B 1.102 1.249 -0.147 0.023 N 9 1 N A ILE 24 ? ? CA A ILE 24 ? B 1.314 1.459 -0.145 0.020 N 10 1 CB A GLU 53 ? B CG A GLU 53 ? B 1.328 1.517 -0.189 0.019 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MET 1 ? B SD A MET 1 ? B CE A MET 1 ? B 87.40 100.20 -12.80 1.60 N 2 1 CB A ASP 14 ? ? CG A ASP 14 ? ? OD1 A ASP 14 ? ? 123.95 118.30 5.65 0.90 N 3 1 CB A ASP 14 ? ? CG A ASP 14 ? ? OD2 A ASP 14 ? ? 112.42 118.30 -5.88 0.90 N 4 1 CB A ASN 22 ? ? CA A ASN 22 ? ? C A ASN 22 ? B 124.19 110.40 13.79 2.00 N 5 1 CB A ASP 35 ? B CG A ASP 35 ? B OD2 A ASP 35 ? B 109.69 118.30 -8.61 0.90 N 6 1 CB A ASP 36 ? ? CG A ASP 36 ? ? OD1 A ASP 36 ? ? 110.98 118.30 -7.32 0.90 N 7 1 CB A ASP 36 ? ? CG A ASP 36 ? ? OD2 A ASP 36 ? ? 124.75 118.30 6.45 0.90 N 8 1 NE A ARG 51 ? A CZ A ARG 51 ? A NH1 A ARG 51 ? A 116.49 120.30 -3.81 0.50 N # _pdbx_validate_polymer_linkage.id 1 _pdbx_validate_polymer_linkage.PDB_model_num 1 _pdbx_validate_polymer_linkage.auth_atom_id_1 C _pdbx_validate_polymer_linkage.auth_asym_id_1 A _pdbx_validate_polymer_linkage.auth_comp_id_1 GLY _pdbx_validate_polymer_linkage.auth_seq_id_1 -3 _pdbx_validate_polymer_linkage.PDB_ins_code_1 ? _pdbx_validate_polymer_linkage.label_alt_id_1 B _pdbx_validate_polymer_linkage.auth_atom_id_2 N _pdbx_validate_polymer_linkage.auth_asym_id_2 A _pdbx_validate_polymer_linkage.auth_comp_id_2 GLY _pdbx_validate_polymer_linkage.auth_seq_id_2 -2 _pdbx_validate_polymer_linkage.PDB_ins_code_2 ? _pdbx_validate_polymer_linkage.label_alt_id_2 B _pdbx_validate_polymer_linkage.dist 1.13 # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O A A HOH 313 ? 6.17 . 2 1 O ? A HOH 314 ? 6.56 . 3 1 O A A HOH 315 ? 7.03 . # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE FE FE N N 88 GLU N N N N 89 GLU CA C N S 90 GLU C C N N 91 GLU O O N N 92 GLU CB C N N 93 GLU CG C N N 94 GLU CD C N N 95 GLU OE1 O N N 96 GLU OE2 O N N 97 GLU OXT O N N 98 GLU H H N N 99 GLU H2 H N N 100 GLU HA H N N 101 GLU HB2 H N N 102 GLU HB3 H N N 103 GLU HG2 H N N 104 GLU HG3 H N N 105 GLU HE2 H N N 106 GLU HXT H N N 107 GLY N N N N 108 GLY CA C N N 109 GLY C C N N 110 GLY O O N N 111 GLY OXT O N N 112 GLY H H N N 113 GLY H2 H N N 114 GLY HA2 H N N 115 GLY HA3 H N N 116 GLY HXT H N N 117 HIS N N N N 118 HIS CA C N S 119 HIS C C N N 120 HIS O O N N 121 HIS CB C N N 122 HIS CG C Y N 123 HIS ND1 N Y N 124 HIS CD2 C Y N 125 HIS CE1 C Y N 126 HIS NE2 N Y N 127 HIS OXT O N N 128 HIS H H N N 129 HIS H2 H N N 130 HIS HA H N N 131 HIS HB2 H N N 132 HIS HB3 H N N 133 HIS HD1 H N N 134 HIS HD2 H N N 135 HIS HE1 H N N 136 HIS HE2 H N N 137 HIS HXT H N N 138 HOH O O N N 139 HOH H1 H N N 140 HOH H2 H N N 141 ILE N N N N 142 ILE CA C N S 143 ILE C C N N 144 ILE O O N N 145 ILE CB C N S 146 ILE CG1 C N N 147 ILE CG2 C N N 148 ILE CD1 C N N 149 ILE OXT O N N 150 ILE H H N N 151 ILE H2 H N N 152 ILE HA H N N 153 ILE HB H N N 154 ILE HG12 H N N 155 ILE HG13 H N N 156 ILE HG21 H N N 157 ILE HG22 H N N 158 ILE HG23 H N N 159 ILE HD11 H N N 160 ILE HD12 H N N 161 ILE HD13 H N N 162 ILE HXT H N N 163 LEU N N N N 164 LEU CA C N S 165 LEU C C N N 166 LEU O O N N 167 LEU CB C N N 168 LEU CG C N N 169 LEU CD1 C N N 170 LEU CD2 C N N 171 LEU OXT O N N 172 LEU H H N N 173 LEU H2 H N N 174 LEU HA H N N 175 LEU HB2 H N N 176 LEU HB3 H N N 177 LEU HG H N N 178 LEU HD11 H N N 179 LEU HD12 H N N 180 LEU HD13 H N N 181 LEU HD21 H N N 182 LEU HD22 H N N 183 LEU HD23 H N N 184 LEU HXT H N N 185 LYS N N N N 186 LYS CA C N S 187 LYS C C N N 188 LYS O O N N 189 LYS CB C N N 190 LYS CG C N N 191 LYS CD C N N 192 LYS CE C N N 193 LYS NZ N N N 194 LYS OXT O N N 195 LYS H H N N 196 LYS H2 H N N 197 LYS HA H N N 198 LYS HB2 H N N 199 LYS HB3 H N N 200 LYS HG2 H N N 201 LYS HG3 H N N 202 LYS HD2 H N N 203 LYS HD3 H N N 204 LYS HE2 H N N 205 LYS HE3 H N N 206 LYS HZ1 H N N 207 LYS HZ2 H N N 208 LYS HZ3 H N N 209 LYS HXT H N N 210 MET N N N N 211 MET CA C N S 212 MET C C N N 213 MET O O N N 214 MET CB C N N 215 MET CG C N N 216 MET SD S N N 217 MET CE C N N 218 MET OXT O N N 219 MET H H N N 220 MET H2 H N N 221 MET HA H N N 222 MET HB2 H N N 223 MET HB3 H N N 224 MET HG2 H N N 225 MET HG3 H N N 226 MET HE1 H N N 227 MET HE2 H N N 228 MET HE3 H N N 229 MET HXT H N N 230 NA NA NA N N 231 PHE N N N N 232 PHE CA C N S 233 PHE C C N N 234 PHE O O N N 235 PHE CB C N N 236 PHE CG C Y N 237 PHE CD1 C Y N 238 PHE CD2 C Y N 239 PHE CE1 C Y N 240 PHE CE2 C Y N 241 PHE CZ C Y N 242 PHE OXT O N N 243 PHE H H N N 244 PHE H2 H N N 245 PHE HA H N N 246 PHE HB2 H N N 247 PHE HB3 H N N 248 PHE HD1 H N N 249 PHE HD2 H N N 250 PHE HE1 H N N 251 PHE HE2 H N N 252 PHE HZ H N N 253 PHE HXT H N N 254 PRO N N N N 255 PRO CA C N S 256 PRO C C N N 257 PRO O O N N 258 PRO CB C N N 259 PRO CG C N N 260 PRO CD C N N 261 PRO OXT O N N 262 PRO H H N N 263 PRO HA H N N 264 PRO HB2 H N N 265 PRO HB3 H N N 266 PRO HG2 H N N 267 PRO HG3 H N N 268 PRO HD2 H N N 269 PRO HD3 H N N 270 PRO HXT H N N 271 SER N N N N 272 SER CA C N S 273 SER C C N N 274 SER O O N N 275 SER CB C N N 276 SER OG O N N 277 SER OXT O N N 278 SER H H N N 279 SER H2 H N N 280 SER HA H N N 281 SER HB2 H N N 282 SER HB3 H N N 283 SER HG H N N 284 SER HXT H N N 285 THR N N N N 286 THR CA C N S 287 THR C C N N 288 THR O O N N 289 THR CB C N R 290 THR OG1 O N N 291 THR CG2 C N N 292 THR OXT O N N 293 THR H H N N 294 THR H2 H N N 295 THR HA H N N 296 THR HB H N N 297 THR HG1 H N N 298 THR HG21 H N N 299 THR HG22 H N N 300 THR HG23 H N N 301 THR HXT H N N 302 TRP N N N N 303 TRP CA C N S 304 TRP C C N N 305 TRP O O N N 306 TRP CB C N N 307 TRP CG C Y N 308 TRP CD1 C Y N 309 TRP CD2 C Y N 310 TRP NE1 N Y N 311 TRP CE2 C Y N 312 TRP CE3 C Y N 313 TRP CZ2 C Y N 314 TRP CZ3 C Y N 315 TRP CH2 C Y N 316 TRP OXT O N N 317 TRP H H N N 318 TRP H2 H N N 319 TRP HA H N N 320 TRP HB2 H N N 321 TRP HB3 H N N 322 TRP HD1 H N N 323 TRP HE1 H N N 324 TRP HE3 H N N 325 TRP HZ2 H N N 326 TRP HZ3 H N N 327 TRP HH2 H N N 328 TRP HXT H N N 329 TYR N N N N 330 TYR CA C N S 331 TYR C C N N 332 TYR O O N N 333 TYR CB C N N 334 TYR CG C Y N 335 TYR CD1 C Y N 336 TYR CD2 C Y N 337 TYR CE1 C Y N 338 TYR CE2 C Y N 339 TYR CZ C Y N 340 TYR OH O N N 341 TYR OXT O N N 342 TYR H H N N 343 TYR H2 H N N 344 TYR HA H N N 345 TYR HB2 H N N 346 TYR HB3 H N N 347 TYR HD1 H N N 348 TYR HD2 H N N 349 TYR HE1 H N N 350 TYR HE2 H N N 351 TYR HH H N N 352 TYR HXT H N N 353 VAL N N N N 354 VAL CA C N S 355 VAL C C N N 356 VAL O O N N 357 VAL CB C N N 358 VAL CG1 C N N 359 VAL CG2 C N N 360 VAL OXT O N N 361 VAL H H N N 362 VAL H2 H N N 363 VAL HA H N N 364 VAL HB H N N 365 VAL HG11 H N N 366 VAL HG12 H N N 367 VAL HG13 H N N 368 VAL HG21 H N N 369 VAL HG22 H N N 370 VAL HG23 H N N 371 VAL HXT H N N 372 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLU N CA sing N N 83 GLU N H sing N N 84 GLU N H2 sing N N 85 GLU CA C sing N N 86 GLU CA CB sing N N 87 GLU CA HA sing N N 88 GLU C O doub N N 89 GLU C OXT sing N N 90 GLU CB CG sing N N 91 GLU CB HB2 sing N N 92 GLU CB HB3 sing N N 93 GLU CG CD sing N N 94 GLU CG HG2 sing N N 95 GLU CG HG3 sing N N 96 GLU CD OE1 doub N N 97 GLU CD OE2 sing N N 98 GLU OE2 HE2 sing N N 99 GLU OXT HXT sing N N 100 GLY N CA sing N N 101 GLY N H sing N N 102 GLY N H2 sing N N 103 GLY CA C sing N N 104 GLY CA HA2 sing N N 105 GLY CA HA3 sing N N 106 GLY C O doub N N 107 GLY C OXT sing N N 108 GLY OXT HXT sing N N 109 HIS N CA sing N N 110 HIS N H sing N N 111 HIS N H2 sing N N 112 HIS CA C sing N N 113 HIS CA CB sing N N 114 HIS CA HA sing N N 115 HIS C O doub N N 116 HIS C OXT sing N N 117 HIS CB CG sing N N 118 HIS CB HB2 sing N N 119 HIS CB HB3 sing N N 120 HIS CG ND1 sing Y N 121 HIS CG CD2 doub Y N 122 HIS ND1 CE1 doub Y N 123 HIS ND1 HD1 sing N N 124 HIS CD2 NE2 sing Y N 125 HIS CD2 HD2 sing N N 126 HIS CE1 NE2 sing Y N 127 HIS CE1 HE1 sing N N 128 HIS NE2 HE2 sing N N 129 HIS OXT HXT sing N N 130 HOH O H1 sing N N 131 HOH O H2 sing N N 132 ILE N CA sing N N 133 ILE N H sing N N 134 ILE N H2 sing N N 135 ILE CA C sing N N 136 ILE CA CB sing N N 137 ILE CA HA sing N N 138 ILE C O doub N N 139 ILE C OXT sing N N 140 ILE CB CG1 sing N N 141 ILE CB CG2 sing N N 142 ILE CB HB sing N N 143 ILE CG1 CD1 sing N N 144 ILE CG1 HG12 sing N N 145 ILE CG1 HG13 sing N N 146 ILE CG2 HG21 sing N N 147 ILE CG2 HG22 sing N N 148 ILE CG2 HG23 sing N N 149 ILE CD1 HD11 sing N N 150 ILE CD1 HD12 sing N N 151 ILE CD1 HD13 sing N N 152 ILE OXT HXT sing N N 153 LEU N CA sing N N 154 LEU N H sing N N 155 LEU N H2 sing N N 156 LEU CA C sing N N 157 LEU CA CB sing N N 158 LEU CA HA sing N N 159 LEU C O doub N N 160 LEU C OXT sing N N 161 LEU CB CG sing N N 162 LEU CB HB2 sing N N 163 LEU CB HB3 sing N N 164 LEU CG CD1 sing N N 165 LEU CG CD2 sing N N 166 LEU CG HG sing N N 167 LEU CD1 HD11 sing N N 168 LEU CD1 HD12 sing N N 169 LEU CD1 HD13 sing N N 170 LEU CD2 HD21 sing N N 171 LEU CD2 HD22 sing N N 172 LEU CD2 HD23 sing N N 173 LEU OXT HXT sing N N 174 LYS N CA sing N N 175 LYS N H sing N N 176 LYS N H2 sing N N 177 LYS CA C sing N N 178 LYS CA CB sing N N 179 LYS CA HA sing N N 180 LYS C O doub N N 181 LYS C OXT sing N N 182 LYS CB CG sing N N 183 LYS CB HB2 sing N N 184 LYS CB HB3 sing N N 185 LYS CG CD sing N N 186 LYS CG HG2 sing N N 187 LYS CG HG3 sing N N 188 LYS CD CE sing N N 189 LYS CD HD2 sing N N 190 LYS CD HD3 sing N N 191 LYS CE NZ sing N N 192 LYS CE HE2 sing N N 193 LYS CE HE3 sing N N 194 LYS NZ HZ1 sing N N 195 LYS NZ HZ2 sing N N 196 LYS NZ HZ3 sing N N 197 LYS OXT HXT sing N N 198 MET N CA sing N N 199 MET N H sing N N 200 MET N H2 sing N N 201 MET CA C sing N N 202 MET CA CB sing N N 203 MET CA HA sing N N 204 MET C O doub N N 205 MET C OXT sing N N 206 MET CB CG sing N N 207 MET CB HB2 sing N N 208 MET CB HB3 sing N N 209 MET CG SD sing N N 210 MET CG HG2 sing N N 211 MET CG HG3 sing N N 212 MET SD CE sing N N 213 MET CE HE1 sing N N 214 MET CE HE2 sing N N 215 MET CE HE3 sing N N 216 MET OXT HXT sing N N 217 PHE N CA sing N N 218 PHE N H sing N N 219 PHE N H2 sing N N 220 PHE CA C sing N N 221 PHE CA CB sing N N 222 PHE CA HA sing N N 223 PHE C O doub N N 224 PHE C OXT sing N N 225 PHE CB CG sing N N 226 PHE CB HB2 sing N N 227 PHE CB HB3 sing N N 228 PHE CG CD1 doub Y N 229 PHE CG CD2 sing Y N 230 PHE CD1 CE1 sing Y N 231 PHE CD1 HD1 sing N N 232 PHE CD2 CE2 doub Y N 233 PHE CD2 HD2 sing N N 234 PHE CE1 CZ doub Y N 235 PHE CE1 HE1 sing N N 236 PHE CE2 CZ sing Y N 237 PHE CE2 HE2 sing N N 238 PHE CZ HZ sing N N 239 PHE OXT HXT sing N N 240 PRO N CA sing N N 241 PRO N CD sing N N 242 PRO N H sing N N 243 PRO CA C sing N N 244 PRO CA CB sing N N 245 PRO CA HA sing N N 246 PRO C O doub N N 247 PRO C OXT sing N N 248 PRO CB CG sing N N 249 PRO CB HB2 sing N N 250 PRO CB HB3 sing N N 251 PRO CG CD sing N N 252 PRO CG HG2 sing N N 253 PRO CG HG3 sing N N 254 PRO CD HD2 sing N N 255 PRO CD HD3 sing N N 256 PRO OXT HXT sing N N 257 SER N CA sing N N 258 SER N H sing N N 259 SER N H2 sing N N 260 SER CA C sing N N 261 SER CA CB sing N N 262 SER CA HA sing N N 263 SER C O doub N N 264 SER C OXT sing N N 265 SER CB OG sing N N 266 SER CB HB2 sing N N 267 SER CB HB3 sing N N 268 SER OG HG sing N N 269 SER OXT HXT sing N N 270 THR N CA sing N N 271 THR N H sing N N 272 THR N H2 sing N N 273 THR CA C sing N N 274 THR CA CB sing N N 275 THR CA HA sing N N 276 THR C O doub N N 277 THR C OXT sing N N 278 THR CB OG1 sing N N 279 THR CB CG2 sing N N 280 THR CB HB sing N N 281 THR OG1 HG1 sing N N 282 THR CG2 HG21 sing N N 283 THR CG2 HG22 sing N N 284 THR CG2 HG23 sing N N 285 THR OXT HXT sing N N 286 TRP N CA sing N N 287 TRP N H sing N N 288 TRP N H2 sing N N 289 TRP CA C sing N N 290 TRP CA CB sing N N 291 TRP CA HA sing N N 292 TRP C O doub N N 293 TRP C OXT sing N N 294 TRP CB CG sing N N 295 TRP CB HB2 sing N N 296 TRP CB HB3 sing N N 297 TRP CG CD1 doub Y N 298 TRP CG CD2 sing Y N 299 TRP CD1 NE1 sing Y N 300 TRP CD1 HD1 sing N N 301 TRP CD2 CE2 doub Y N 302 TRP CD2 CE3 sing Y N 303 TRP NE1 CE2 sing Y N 304 TRP NE1 HE1 sing N N 305 TRP CE2 CZ2 sing Y N 306 TRP CE3 CZ3 doub Y N 307 TRP CE3 HE3 sing N N 308 TRP CZ2 CH2 doub Y N 309 TRP CZ2 HZ2 sing N N 310 TRP CZ3 CH2 sing Y N 311 TRP CZ3 HZ3 sing N N 312 TRP CH2 HH2 sing N N 313 TRP OXT HXT sing N N 314 TYR N CA sing N N 315 TYR N H sing N N 316 TYR N H2 sing N N 317 TYR CA C sing N N 318 TYR CA CB sing N N 319 TYR CA HA sing N N 320 TYR C O doub N N 321 TYR C OXT sing N N 322 TYR CB CG sing N N 323 TYR CB HB2 sing N N 324 TYR CB HB3 sing N N 325 TYR CG CD1 doub Y N 326 TYR CG CD2 sing Y N 327 TYR CD1 CE1 sing Y N 328 TYR CD1 HD1 sing N N 329 TYR CD2 CE2 doub Y N 330 TYR CD2 HD2 sing N N 331 TYR CE1 CZ doub Y N 332 TYR CE1 HE1 sing N N 333 TYR CE2 CZ sing Y N 334 TYR CE2 HE2 sing N N 335 TYR CZ OH sing N N 336 TYR OH HH sing N N 337 TYR OXT HXT sing N N 338 VAL N CA sing N N 339 VAL N H sing N N 340 VAL N H2 sing N N 341 VAL CA C sing N N 342 VAL CA CB sing N N 343 VAL CA HA sing N N 344 VAL C O doub N N 345 VAL C OXT sing N N 346 VAL CB CG1 sing N N 347 VAL CB CG2 sing N N 348 VAL CB HB sing N N 349 VAL CG1 HG11 sing N N 350 VAL CG1 HG12 sing N N 351 VAL CG1 HG13 sing N N 352 VAL CG2 HG21 sing N N 353 VAL CG2 HG22 sing N N 354 VAL CG2 HG23 sing N N 355 VAL OXT HXT sing N N 356 # _pdbx_audit_support.funding_organization 'Volkswagen Foundation' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number 0200374 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 9TA4 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 30OR _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.040437 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025486 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.022153 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C FE H N NA O S # loop_ # loop_ #