data_31LQ # _entry.id 31LQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 31LQ pdb_000031lq 10.2210/pdb31lq/pdb WWPDB D_1292157998 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-10-07 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 31LQ _pdbx_database_status.recvd_initial_deposition_date 2026-06-11 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_contact_author.id _pdbx_contact_author.email _pdbx_contact_author.name_first _pdbx_contact_author.name_last _pdbx_contact_author.name_mi _pdbx_contact_author.role _pdbx_contact_author.identifier_ORCID 3 gert.bange@synmikro.uni-marburg.de Gert Bange ? 'principal investigator/group leader' 0000-0002-7826-0932 4 bedrunka@staff.uni-marburg.de Patricia Bedrunka ? 'principal investigator/group leader' 0000-0002-9984-5518 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Shivakumar, R.D.' 1 0000-0001-9381-262X 'Bedrunka, P.' 2 0000-0002-9984-5518 'Kiontke, S.' 3 0000-0001-5822-913X 'Bange, G.' 4 0000-0002-7826-0932 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 302 _citation.language ? _citation.page_first 113490 _citation.page_last 113490 _citation.title 'Molecular insights into the promiscuous Ap 4 N hydrolase YqeK.' _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jbc.2026.113490 _citation.pdbx_database_id_PubMed 42641892 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Shivakumar, R.D.' 1 ? primary 'Happel, N.' 2 ? primary 'Burchert, F.' 3 ? primary 'Bruck, M.' 4 ? primary 'Randau, L.' 5 ? primary 'Pane-Farre, J.' 6 ? primary 'Linne, U.' 7 ? primary 'Freitag, J.' 8 ? primary 'Hinrichs, R.' 9 ? primary 'Kiontke, S.' 10 ? primary 'Bange, G.' 11 ? primary 'Bedrunka-Meinert, P.' 12 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ; 22533.672 1 3.6.1.41 ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 4 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201 1 ? ? ? ? 5 water nat water 18.015 70 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGEREQALRIVKEQLTEHRYEHTLGVVETAVKLAERYGADVKKAELAAIFHDYAKFRPVEEMKQLILAQNMPNDLLVYNS ELWHAPVGAYLVQTEVGLDDPEVLDAIRYHTSGRAGMTLLEKIIYLADYIEPGRRFPGVDDVRRLAEEDLNRALLQAVKN TIAFLLEKGQLIYPDTIHAYNSLVREVKGEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGEREQALRIVKEQLTEHRYEHTLGVVETAVKLAERYGADVKKAELAAIFHDYAKFRPVEEMKQLILAQNMPNDLLVYNS ELWHAPVGAYLVQTEVGLDDPEVLDAIRYHTSGRAGMTLLEKIIYLADYIEPGRRFPGVDDVRRLAEEDLNRALLQAVKN TIAFLLEKGQLIYPDTIHAYNSLVREVKGEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'ZINC ION' ZN 4 "ADENOSINE-5'-DIPHOSPHATE" ADP 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 GLU n 1 4 ARG n 1 5 GLU n 1 6 GLN n 1 7 ALA n 1 8 LEU n 1 9 ARG n 1 10 ILE n 1 11 VAL n 1 12 LYS n 1 13 GLU n 1 14 GLN n 1 15 LEU n 1 16 THR n 1 17 GLU n 1 18 HIS n 1 19 ARG n 1 20 TYR n 1 21 GLU n 1 22 HIS n 1 23 THR n 1 24 LEU n 1 25 GLY n 1 26 VAL n 1 27 VAL n 1 28 GLU n 1 29 THR n 1 30 ALA n 1 31 VAL n 1 32 LYS n 1 33 LEU n 1 34 ALA n 1 35 GLU n 1 36 ARG n 1 37 TYR n 1 38 GLY n 1 39 ALA n 1 40 ASP n 1 41 VAL n 1 42 LYS n 1 43 LYS n 1 44 ALA n 1 45 GLU n 1 46 LEU n 1 47 ALA n 1 48 ALA n 1 49 ILE n 1 50 PHE n 1 51 HIS n 1 52 ASP n 1 53 TYR n 1 54 ALA n 1 55 LYS n 1 56 PHE n 1 57 ARG n 1 58 PRO n 1 59 VAL n 1 60 GLU n 1 61 GLU n 1 62 MET n 1 63 LYS n 1 64 GLN n 1 65 LEU n 1 66 ILE n 1 67 LEU n 1 68 ALA n 1 69 GLN n 1 70 ASN n 1 71 MET n 1 72 PRO n 1 73 ASN n 1 74 ASP n 1 75 LEU n 1 76 LEU n 1 77 VAL n 1 78 TYR n 1 79 ASN n 1 80 SER n 1 81 GLU n 1 82 LEU n 1 83 TRP n 1 84 HIS n 1 85 ALA n 1 86 PRO n 1 87 VAL n 1 88 GLY n 1 89 ALA n 1 90 TYR n 1 91 LEU n 1 92 VAL n 1 93 GLN n 1 94 THR n 1 95 GLU n 1 96 VAL n 1 97 GLY n 1 98 LEU n 1 99 ASP n 1 100 ASP n 1 101 PRO n 1 102 GLU n 1 103 VAL n 1 104 LEU n 1 105 ASP n 1 106 ALA n 1 107 ILE n 1 108 ARG n 1 109 TYR n 1 110 HIS n 1 111 THR n 1 112 SER n 1 113 GLY n 1 114 ARG n 1 115 ALA n 1 116 GLY n 1 117 MET n 1 118 THR n 1 119 LEU n 1 120 LEU n 1 121 GLU n 1 122 LYS n 1 123 ILE n 1 124 ILE n 1 125 TYR n 1 126 LEU n 1 127 ALA n 1 128 ASP n 1 129 TYR n 1 130 ILE n 1 131 GLU n 1 132 PRO n 1 133 GLY n 1 134 ARG n 1 135 ARG n 1 136 PHE n 1 137 PRO n 1 138 GLY n 1 139 VAL n 1 140 ASP n 1 141 ASP n 1 142 VAL n 1 143 ARG n 1 144 ARG n 1 145 LEU n 1 146 ALA n 1 147 GLU n 1 148 GLU n 1 149 ASP n 1 150 LEU n 1 151 ASN n 1 152 ARG n 1 153 ALA n 1 154 LEU n 1 155 LEU n 1 156 GLN n 1 157 ALA n 1 158 VAL n 1 159 LYS n 1 160 ASN n 1 161 THR n 1 162 ILE n 1 163 ALA n 1 164 PHE n 1 165 LEU n 1 166 LEU n 1 167 GLU n 1 168 LYS n 1 169 GLY n 1 170 GLN n 1 171 LEU n 1 172 ILE n 1 173 TYR n 1 174 PRO n 1 175 ASP n 1 176 THR n 1 177 ILE n 1 178 HIS n 1 179 ALA n 1 180 TYR n 1 181 ASN n 1 182 SER n 1 183 LEU n 1 184 VAL n 1 185 ARG n 1 186 GLU n 1 187 VAL n 1 188 LYS n 1 189 GLY n 1 190 GLU n 1 191 HIS n 1 192 HIS n 1 193 HIS n 1 194 HIS n 1 195 HIS n 1 196 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 196 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'yqeK, HSX42_14295' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Geobacillus thermodenitrificans' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 33940 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ADP non-polymer n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 0 ? ? ? A . n A 1 2 GLY 2 1 ? ? ? A . n A 1 3 GLU 3 2 3 GLU GLU A . n A 1 4 ARG 4 3 4 ARG ARG A . n A 1 5 GLU 5 4 5 GLU GLU A . n A 1 6 GLN 6 5 6 GLN GLN A . n A 1 7 ALA 7 6 7 ALA ALA A . n A 1 8 LEU 8 7 8 LEU LEU A . n A 1 9 ARG 9 8 9 ARG ARG A . n A 1 10 ILE 10 9 10 ILE ILE A . n A 1 11 VAL 11 10 11 VAL VAL A . n A 1 12 LYS 12 11 12 LYS LYS A . n A 1 13 GLU 13 12 13 GLU GLU A . n A 1 14 GLN 14 13 14 GLN GLN A . n A 1 15 LEU 15 14 15 LEU LEU A . n A 1 16 THR 16 15 16 THR THR A . n A 1 17 GLU 17 16 17 GLU GLU A . n A 1 18 HIS 18 17 18 HIS HIS A . n A 1 19 ARG 19 18 19 ARG ARG A . n A 1 20 TYR 20 19 20 TYR TYR A . n A 1 21 GLU 21 20 21 GLU GLU A . n A 1 22 HIS 22 21 22 HIS HIS A . n A 1 23 THR 23 22 23 THR THR A . n A 1 24 LEU 24 23 24 LEU LEU A . n A 1 25 GLY 25 24 25 GLY GLY A . n A 1 26 VAL 26 25 26 VAL VAL A . n A 1 27 VAL 27 26 27 VAL VAL A . n A 1 28 GLU 28 27 28 GLU GLU A . n A 1 29 THR 29 28 29 THR THR A . n A 1 30 ALA 30 29 30 ALA ALA A . n A 1 31 VAL 31 30 31 VAL VAL A . n A 1 32 LYS 32 31 32 LYS LYS A . n A 1 33 LEU 33 32 33 LEU LEU A . n A 1 34 ALA 34 33 34 ALA ALA A . n A 1 35 GLU 35 34 35 GLU GLU A . n A 1 36 ARG 36 35 36 ARG ARG A . n A 1 37 TYR 37 36 37 TYR TYR A . n A 1 38 GLY 38 37 38 GLY GLY A . n A 1 39 ALA 39 38 39 ALA ALA A . n A 1 40 ASP 40 39 40 ASP ASP A . n A 1 41 VAL 41 40 41 VAL VAL A . n A 1 42 LYS 42 41 42 LYS LYS A . n A 1 43 LYS 43 42 43 LYS LYS A . n A 1 44 ALA 44 43 44 ALA ALA A . n A 1 45 GLU 45 44 45 GLU GLU A . n A 1 46 LEU 46 45 46 LEU LEU A . n A 1 47 ALA 47 46 47 ALA ALA A . n A 1 48 ALA 48 47 48 ALA ALA A . n A 1 49 ILE 49 48 49 ILE ILE A . n A 1 50 PHE 50 49 50 PHE PHE A . n A 1 51 HIS 51 50 51 HIS HIS A . n A 1 52 ASP 52 51 52 ASP ASP A . n A 1 53 TYR 53 52 53 TYR TYR A . n A 1 54 ALA 54 53 54 ALA ALA A . n A 1 55 LYS 55 54 55 LYS LYS A . n A 1 56 PHE 56 55 56 PHE PHE A . n A 1 57 ARG 57 56 57 ARG ARG A . n A 1 58 PRO 58 57 58 PRO PRO A . n A 1 59 VAL 59 58 59 VAL VAL A . n A 1 60 GLU 60 59 60 GLU GLU A . n A 1 61 GLU 61 60 61 GLU GLU A . n A 1 62 MET 62 61 62 MET MET A . n A 1 63 LYS 63 62 63 LYS LYS A . n A 1 64 GLN 64 63 64 GLN GLN A . n A 1 65 LEU 65 64 65 LEU LEU A . n A 1 66 ILE 66 65 66 ILE ILE A . n A 1 67 LEU 67 66 67 LEU LEU A . n A 1 68 ALA 68 67 68 ALA ALA A . n A 1 69 GLN 69 68 69 GLN GLN A . n A 1 70 ASN 70 69 70 ASN ASN A . n A 1 71 MET 71 70 71 MET MET A . n A 1 72 PRO 72 71 72 PRO PRO A . n A 1 73 ASN 73 72 73 ASN ASN A . n A 1 74 ASP 74 73 74 ASP ASP A . n A 1 75 LEU 75 74 75 LEU LEU A . n A 1 76 LEU 76 75 76 LEU LEU A . n A 1 77 VAL 77 76 77 VAL VAL A . n A 1 78 TYR 78 77 78 TYR TYR A . n A 1 79 ASN 79 78 79 ASN ASN A . n A 1 80 SER 80 79 80 SER SER A . n A 1 81 GLU 81 80 81 GLU GLU A . n A 1 82 LEU 82 81 82 LEU LEU A . n A 1 83 TRP 83 82 83 TRP TRP A . n A 1 84 HIS 84 83 84 HIS HIS A . n A 1 85 ALA 85 84 85 ALA ALA A . n A 1 86 PRO 86 85 86 PRO PRO A . n A 1 87 VAL 87 86 87 VAL VAL A . n A 1 88 GLY 88 87 88 GLY GLY A . n A 1 89 ALA 89 88 89 ALA ALA A . n A 1 90 TYR 90 89 90 TYR TYR A . n A 1 91 LEU 91 90 91 LEU LEU A . n A 1 92 VAL 92 91 92 VAL VAL A . n A 1 93 GLN 93 92 93 GLN GLN A . n A 1 94 THR 94 93 94 THR THR A . n A 1 95 GLU 95 94 95 GLU GLU A . n A 1 96 VAL 96 95 96 VAL VAL A . n A 1 97 GLY 97 96 97 GLY GLY A . n A 1 98 LEU 98 97 98 LEU LEU A . n A 1 99 ASP 99 98 99 ASP ASP A . n A 1 100 ASP 100 99 100 ASP ASP A . n A 1 101 PRO 101 100 101 PRO PRO A . n A 1 102 GLU 102 101 102 GLU GLU A . n A 1 103 VAL 103 102 103 VAL VAL A . n A 1 104 LEU 104 103 104 LEU LEU A . n A 1 105 ASP 105 104 105 ASP ASP A . n A 1 106 ALA 106 105 106 ALA ALA A . n A 1 107 ILE 107 106 107 ILE ILE A . n A 1 108 ARG 108 107 108 ARG ARG A . n A 1 109 TYR 109 108 109 TYR TYR A . n A 1 110 HIS 110 109 110 HIS HIS A . n A 1 111 THR 111 110 111 THR THR A . n A 1 112 SER 112 111 112 SER SER A . n A 1 113 GLY 113 112 113 GLY GLY A . n A 1 114 ARG 114 113 114 ARG ARG A . n A 1 115 ALA 115 114 115 ALA ALA A . n A 1 116 GLY 116 115 116 GLY GLY A . n A 1 117 MET 117 116 117 MET MET A . n A 1 118 THR 118 117 118 THR THR A . n A 1 119 LEU 119 118 119 LEU LEU A . n A 1 120 LEU 120 119 120 LEU LEU A . n A 1 121 GLU 121 120 121 GLU GLU A . n A 1 122 LYS 122 121 122 LYS LYS A . n A 1 123 ILE 123 122 123 ILE ILE A . n A 1 124 ILE 124 123 124 ILE ILE A . n A 1 125 TYR 125 124 125 TYR TYR A . n A 1 126 LEU 126 125 126 LEU LEU A . n A 1 127 ALA 127 126 127 ALA ALA A . n A 1 128 ASP 128 127 128 ASP ASP A . n A 1 129 TYR 129 128 129 TYR TYR A . n A 1 130 ILE 130 129 130 ILE ILE A . n A 1 131 GLU 131 130 131 GLU GLU A . n A 1 132 PRO 132 131 132 PRO PRO A . n A 1 133 GLY 133 132 133 GLY GLY A . n A 1 134 ARG 134 133 134 ARG ARG A . n A 1 135 ARG 135 134 135 ARG ARG A . n A 1 136 PHE 136 135 136 PHE PHE A . n A 1 137 PRO 137 136 137 PRO PRO A . n A 1 138 GLY 138 137 138 GLY GLY A . n A 1 139 VAL 139 138 139 VAL VAL A . n A 1 140 ASP 140 139 140 ASP ASP A . n A 1 141 ASP 141 140 141 ASP ASP A . n A 1 142 VAL 142 141 142 VAL VAL A . n A 1 143 ARG 143 142 143 ARG ARG A . n A 1 144 ARG 144 143 144 ARG ARG A . n A 1 145 LEU 145 144 145 LEU LEU A . n A 1 146 ALA 146 145 146 ALA ALA A . n A 1 147 GLU 147 146 147 GLU GLU A . n A 1 148 GLU 148 147 148 GLU GLU A . n A 1 149 ASP 149 148 149 ASP ASP A . n A 1 150 LEU 150 149 150 LEU LEU A . n A 1 151 ASN 151 150 151 ASN ASN A . n A 1 152 ARG 152 151 152 ARG ARG A . n A 1 153 ALA 153 152 153 ALA ALA A . n A 1 154 LEU 154 153 154 LEU LEU A . n A 1 155 LEU 155 154 155 LEU LEU A . n A 1 156 GLN 156 155 156 GLN GLN A . n A 1 157 ALA 157 156 157 ALA ALA A . n A 1 158 VAL 158 157 158 VAL VAL A . n A 1 159 LYS 159 158 159 LYS LYS A . n A 1 160 ASN 160 159 160 ASN ASN A . n A 1 161 THR 161 160 161 THR THR A . n A 1 162 ILE 162 161 162 ILE ILE A . n A 1 163 ALA 163 162 163 ALA ALA A . n A 1 164 PHE 164 163 164 PHE PHE A . n A 1 165 LEU 165 164 165 LEU LEU A . n A 1 166 LEU 166 165 166 LEU LEU A . n A 1 167 GLU 167 166 167 GLU GLU A . n A 1 168 LYS 168 167 168 LYS LYS A . n A 1 169 GLY 169 168 169 GLY GLY A . n A 1 170 GLN 170 169 170 GLN GLN A . n A 1 171 LEU 171 170 171 LEU LEU A . n A 1 172 ILE 172 171 172 ILE ILE A . n A 1 173 TYR 173 172 173 TYR TYR A . n A 1 174 PRO 174 173 174 PRO PRO A . n A 1 175 ASP 175 174 175 ASP ASP A . n A 1 176 THR 176 175 176 THR THR A . n A 1 177 ILE 177 176 177 ILE ILE A . n A 1 178 HIS 178 177 178 HIS HIS A . n A 1 179 ALA 179 178 179 ALA ALA A . n A 1 180 TYR 180 179 180 TYR TYR A . n A 1 181 ASN 181 180 181 ASN ASN A . n A 1 182 SER 182 181 182 SER SER A . n A 1 183 LEU 183 182 183 LEU LEU A . n A 1 184 VAL 184 183 184 VAL VAL A . n A 1 185 ARG 185 184 185 ARG ARG A . n A 1 186 GLU 186 185 186 GLU GLU A . n A 1 187 VAL 187 186 187 VAL VAL A . n A 1 188 LYS 188 187 188 LYS LYS A . n A 1 189 GLY 189 188 189 GLY GLY A . n A 1 190 GLU 190 189 ? ? ? A . n A 1 191 HIS 191 190 ? ? ? A . n A 1 192 HIS 192 191 ? ? ? A . n A 1 193 HIS 193 192 ? ? ? A . n A 1 194 HIS 194 193 ? ? ? A . n A 1 195 HIS 195 194 ? ? ? A . n A 1 196 HIS 196 195 ? ? ? A . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id ADP _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id ADP _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 200 200 CA CA A . C 3 ZN 1 201 201 ZN ZN A . D 3 ZN 1 202 202 ZN ZN A . E 4 ADP 1 203 203 ADP ADP A . F 5 HOH 1 301 23 HOH HOH A . F 5 HOH 2 302 19 HOH HOH A . F 5 HOH 3 303 36 HOH HOH A . F 5 HOH 4 304 62 HOH HOH A . F 5 HOH 5 305 27 HOH HOH A . F 5 HOH 6 306 11 HOH HOH A . F 5 HOH 7 307 63 HOH HOH A . F 5 HOH 8 308 53 HOH HOH A . F 5 HOH 9 309 38 HOH HOH A . F 5 HOH 10 310 58 HOH HOH A . F 5 HOH 11 311 42 HOH HOH A . F 5 HOH 12 312 48 HOH HOH A . F 5 HOH 13 313 16 HOH HOH A . F 5 HOH 14 314 44 HOH HOH A . F 5 HOH 15 315 60 HOH HOH A . F 5 HOH 16 316 24 HOH HOH A . F 5 HOH 17 317 5 HOH HOH A . F 5 HOH 18 318 29 HOH HOH A . F 5 HOH 19 319 25 HOH HOH A . F 5 HOH 20 320 40 HOH HOH A . F 5 HOH 21 321 56 HOH HOH A . F 5 HOH 22 322 12 HOH HOH A . F 5 HOH 23 323 22 HOH HOH A . F 5 HOH 24 324 6 HOH HOH A . F 5 HOH 25 325 10 HOH HOH A . F 5 HOH 26 326 55 HOH HOH A . F 5 HOH 27 327 50 HOH HOH A . F 5 HOH 28 328 2 HOH HOH A . F 5 HOH 29 329 57 HOH HOH A . F 5 HOH 30 330 34 HOH HOH A . F 5 HOH 31 331 69 HOH HOH A . F 5 HOH 32 332 32 HOH HOH A . F 5 HOH 33 333 52 HOH HOH A . F 5 HOH 34 334 28 HOH HOH A . F 5 HOH 35 335 37 HOH HOH A . F 5 HOH 36 336 1 HOH HOH A . F 5 HOH 37 337 39 HOH HOH A . F 5 HOH 38 338 66 HOH HOH A . F 5 HOH 39 339 14 HOH HOH A . F 5 HOH 40 340 45 HOH HOH A . F 5 HOH 41 341 35 HOH HOH A . F 5 HOH 42 342 9 HOH HOH A . F 5 HOH 43 343 30 HOH HOH A . F 5 HOH 44 344 33 HOH HOH A . F 5 HOH 45 345 4 HOH HOH A . F 5 HOH 46 346 47 HOH HOH A . F 5 HOH 47 347 21 HOH HOH A . F 5 HOH 48 348 61 HOH HOH A . F 5 HOH 49 349 41 HOH HOH A . F 5 HOH 50 350 7 HOH HOH A . F 5 HOH 51 351 46 HOH HOH A . F 5 HOH 52 352 17 HOH HOH A . F 5 HOH 53 353 15 HOH HOH A . F 5 HOH 54 354 8 HOH HOH A . F 5 HOH 55 355 18 HOH HOH A . F 5 HOH 56 356 3 HOH HOH A . F 5 HOH 57 357 68 HOH HOH A . F 5 HOH 58 358 54 HOH HOH A . F 5 HOH 59 359 65 HOH HOH A . F 5 HOH 60 360 64 HOH HOH A . F 5 HOH 61 361 70 HOH HOH A . F 5 HOH 62 362 51 HOH HOH A . F 5 HOH 63 363 43 HOH HOH A . F 5 HOH 64 364 59 HOH HOH A . F 5 HOH 65 365 49 HOH HOH A . F 5 HOH 66 366 20 HOH HOH A . F 5 HOH 67 367 13 HOH HOH A . F 5 HOH 68 368 26 HOH HOH A . F 5 HOH 69 369 31 HOH HOH A . F 5 HOH 70 370 67 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.20.1_4487 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 31LQ _cell.details ? _cell.formula_units_Z ? _cell.length_a 73.280 _cell.length_a_esd ? _cell.length_b 73.280 _cell.length_b_esd ? _cell.length_c 95.720 _cell.length_c_esd ? _cell.volume 514012.418 _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 31LQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall 'P 4abw 2nw' _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 31LQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.85 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.05 M Calcium acetate 0.1 M Imidazole pH 8.0 35% (v/v) 2-Ethoxyethanol ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2025-06-15 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.05965 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.05965 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P13 (MX1)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 42.26 _reflns.entry_id 31LQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.70 _reflns.d_resolution_low 47.86 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 29330 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 25.86 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 22.44 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.70 _reflns_shell.d_res_low 1.80 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 4635 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.889 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 45.71 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 31LQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.70 _refine.ls_d_res_low 34.22 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 29295 _refine.ls_number_reflns_R_free 1465 _refine.ls_number_reflns_R_work 27830 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.88 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1922 _refine.ls_R_factor_R_free 0.2098 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1912 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.1443 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2422 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 34.22 _refine_hist.number_atoms_solvent 70 _refine_hist.number_atoms_total 1607 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1507 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0056 ? 1597 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.8819 ? 2177 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0453 ? 245 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0066 ? 279 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 13.6315 ? 615 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.70 1.76 . . 143 2710 99.83 . . . . 0.4214 . . . . . . . . . . . . . . . 0.4441 'X-RAY DIFFRACTION' 1.76 1.83 . . 144 2737 99.97 . . . . 0.3234 . . . . . . . . . . . . . . . 0.3764 'X-RAY DIFFRACTION' 1.83 1.91 . . 145 2739 99.83 . . . . 0.2446 . . . . . . . . . . . . . . . 0.2788 'X-RAY DIFFRACTION' 1.91 2.02 . . 144 2734 99.72 . . . . 0.2169 . . . . . . . . . . . . . . . 0.2432 'X-RAY DIFFRACTION' 2.02 2.14 . . 144 2739 99.79 . . . . 0.2238 . . . . . . . . . . . . . . . 0.2248 'X-RAY DIFFRACTION' 2.14 2.31 . . 145 2767 99.83 . . . . 0.1845 . . . . . . . . . . . . . . . 0.2161 'X-RAY DIFFRACTION' 2.31 2.54 . . 146 2765 99.93 . . . . 0.1921 . . . . . . . . . . . . . . . 0.2260 'X-RAY DIFFRACTION' 2.54 2.91 . . 147 2802 100.00 . . . . 0.1983 . . . . . . . . . . . . . . . 0.2157 'X-RAY DIFFRACTION' 2.91 3.66 . . 150 2848 100.00 . . . . 0.1891 . . . . . . . . . . . . . . . 0.2032 'X-RAY DIFFRACTION' 3.66 34.22 . . 157 2989 99.94 . . . . 0.1659 . . . . . . . . . . . . . . . 0.1815 # _struct.entry_id 31LQ _struct.title 'Crystal structure of Geobacillus thermodenitrificans YqeK in complex with ADP' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 31LQ _struct_keywords.text 'Dinucleotides, Ap4N, Gram-positive bacteria, HYDROLASE' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? F N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A0ABY9QA59_GEOTD _struct_ref.pdbx_db_accession A0ABY9QA59 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EREQALRIVKEQLTEHRYEHTLGVVETAVKLAERYGADVKKAELAAIFHDYAKFRPVEEMKQLILAQNMPNDLLVYNSEL WHAPVGAYLVQTEVGLDDPEVLDAIRYHTSGRAGMTLLEKIIYLADYIEPGRRFPGVDDVRRLAEEDLNRALLQAVKNTI AFLLEKGQLIYPDTIHAYNSLVREVKGE ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 31LQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 190 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A0ABY9QA59 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 189 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 189 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 31LQ MET A 1 ? UNP A0ABY9QA59 ? ? 'initiating methionine' 0 1 1 31LQ GLY A 2 ? UNP A0ABY9QA59 ? ? 'expression tag' 1 2 1 31LQ HIS A 191 ? UNP A0ABY9QA59 ? ? 'expression tag' 190 3 1 31LQ HIS A 192 ? UNP A0ABY9QA59 ? ? 'expression tag' 191 4 1 31LQ HIS A 193 ? UNP A0ABY9QA59 ? ? 'expression tag' 192 5 1 31LQ HIS A 194 ? UNP A0ABY9QA59 ? ? 'expression tag' 193 6 1 31LQ HIS A 195 ? UNP A0ABY9QA59 ? ? 'expression tag' 194 7 1 31LQ HIS A 196 ? UNP A0ABY9QA59 ? ? 'expression tag' 195 8 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3620 ? 1 MORE -204 ? 1 'SSA (A^2)' 17090 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_665 -y+1,-x+1,-z+1/2 0.0000000000 -1.0000000000 0.0000000000 73.2800000000 -1.0000000000 0.0000000000 0.0000000000 73.2800000000 0.0000000000 0.0000000000 -1.0000000000 47.8600000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLU A 3 ? LEU A 15 ? GLU A 2 LEU A 14 1 ? 13 HELX_P HELX_P2 AA2 THR A 16 ? GLY A 38 ? THR A 15 GLY A 37 1 ? 23 HELX_P HELX_P3 AA3 ASP A 40 ? HIS A 51 ? ASP A 39 HIS A 50 1 ? 12 HELX_P HELX_P4 AA4 PRO A 58 ? GLN A 69 ? PRO A 57 GLN A 68 1 ? 12 HELX_P HELX_P5 AA5 PRO A 72 ? TYR A 78 ? PRO A 71 TYR A 77 5 ? 7 HELX_P HELX_P6 AA6 ASN A 79 ? LEU A 82 ? ASN A 78 LEU A 81 5 ? 4 HELX_P HELX_P7 AA7 TRP A 83 ? GLY A 97 ? TRP A 82 GLY A 96 1 ? 15 HELX_P HELX_P8 AA8 ASP A 100 ? TYR A 109 ? ASP A 99 TYR A 108 1 ? 10 HELX_P HELX_P9 AA9 THR A 118 ? GLU A 131 ? THR A 117 GLU A 130 1 ? 14 HELX_P HELX_P10 AB1 GLY A 138 ? GLU A 147 ? GLY A 137 GLU A 146 1 ? 10 HELX_P HELX_P11 AB2 ASP A 149 ? LYS A 168 ? ASP A 148 LYS A 167 1 ? 20 HELX_P HELX_P12 AB3 TYR A 173 ? GLY A 189 ? TYR A 172 GLY A 188 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 22 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 21 A ZN 201 1_555 ? ? ? ? ? ? ? 2.234 ? ? metalc2 metalc ? ? A HIS 51 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 50 A ZN 201 1_555 ? ? ? ? ? ? ? 2.279 ? ? metalc3 metalc ? ? A ASP 52 OD2 ? ? ? 1_555 C ZN . ZN ? ? A ASP 51 A ZN 201 1_555 ? ? ? ? ? ? ? 2.504 ? ? metalc4 metalc ? ? A ASP 52 OD1 ? ? ? 1_555 D ZN . ZN ? ? A ASP 51 A ZN 202 1_555 ? ? ? ? ? ? ? 2.484 ? ? metalc5 metalc ? ? A ILE 66 O ? ? ? 1_555 B CA . CA ? ? A ILE 65 A CA 200 1_555 ? ? ? ? ? ? ? 2.368 ? ? metalc6 metalc ? ? A GLN 69 O ? ? ? 1_555 B CA . CA ? ? A GLN 68 A CA 200 1_555 ? ? ? ? ? ? ? 2.274 ? ? metalc7 metalc ? ? A MET 71 O ? ? ? 1_555 B CA . CA ? ? A MET 70 A CA 200 1_555 ? ? ? ? ? ? ? 2.330 ? ? metalc8 metalc ? ? A ASN 73 OD1 ? ? ? 1_555 B CA . CA ? ? A ASN 72 A CA 200 1_555 ? ? ? ? ? ? ? 2.421 ? ? metalc9 metalc ? ? A HIS 84 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 83 A ZN 202 1_555 ? ? ? ? ? ? ? 2.328 ? ? metalc10 metalc ? ? A HIS 110 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 109 A ZN 202 1_555 ? ? ? ? ? ? ? 2.369 ? ? metalc11 metalc ? ? A ASP 128 OD1 ? ? ? 1_555 C ZN . ZN ? ? A ASP 127 A ZN 201 1_555 ? ? ? ? ? ? ? 2.401 ? ? metalc12 metalc ? ? B CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 200 A HOH 303 6_555 ? ? ? ? ? ? ? 2.481 ? ? metalc13 metalc ? ? B CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 200 A HOH 309 1_555 ? ? ? ? ? ? ? 2.438 ? ? metalc14 metalc ? ? C ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 201 A HOH 321 1_555 ? ? ? ? ? ? ? 1.852 ? ? metalc15 metalc ? ? D ZN . ZN ? ? ? 1_555 E ADP . O2A ? ? A ZN 202 A ADP 203 1_555 ? ? ? ? ? ? ? 2.371 ? ? metalc16 metalc ? ? D ZN . ZN ? ? ? 1_555 F HOH . O ? ? A ZN 202 A HOH 321 1_555 ? ? ? ? ? ? ? 2.296 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 22 ? A HIS 21 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 NE2 ? A HIS 51 ? A HIS 50 ? 1_555 104.4 ? 2 NE2 ? A HIS 22 ? A HIS 21 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OD2 ? A ASP 52 ? A ASP 51 ? 1_555 109.0 ? 3 NE2 ? A HIS 51 ? A HIS 50 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OD2 ? A ASP 52 ? A ASP 51 ? 1_555 94.0 ? 4 NE2 ? A HIS 22 ? A HIS 21 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OD1 ? A ASP 128 ? A ASP 127 ? 1_555 76.8 ? 5 NE2 ? A HIS 51 ? A HIS 50 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OD1 ? A ASP 128 ? A ASP 127 ? 1_555 93.6 ? 6 OD2 ? A ASP 52 ? A ASP 51 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 OD1 ? A ASP 128 ? A ASP 127 ? 1_555 169.0 ? 7 NE2 ? A HIS 22 ? A HIS 21 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? F HOH . ? A HOH 321 ? 1_555 123.3 ? 8 NE2 ? A HIS 51 ? A HIS 50 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? F HOH . ? A HOH 321 ? 1_555 127.3 ? 9 OD2 ? A ASP 52 ? A ASP 51 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? F HOH . ? A HOH 321 ? 1_555 90.7 ? 10 OD1 ? A ASP 128 ? A ASP 127 ? 1_555 ZN ? C ZN . ? A ZN 201 ? 1_555 O ? F HOH . ? A HOH 321 ? 1_555 78.3 ? 11 OD1 ? A ASP 52 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 84 ? A HIS 83 ? 1_555 83.3 ? 12 OD1 ? A ASP 52 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 110 ? A HIS 109 ? 1_555 100.1 ? 13 NE2 ? A HIS 84 ? A HIS 83 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 NE2 ? A HIS 110 ? A HIS 109 ? 1_555 102.4 ? 14 OD1 ? A ASP 52 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O2A ? E ADP . ? A ADP 203 ? 1_555 162.4 ? 15 NE2 ? A HIS 84 ? A HIS 83 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O2A ? E ADP . ? A ADP 203 ? 1_555 85.5 ? 16 NE2 ? A HIS 110 ? A HIS 109 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O2A ? E ADP . ? A ADP 203 ? 1_555 95.5 ? 17 OD1 ? A ASP 52 ? A ASP 51 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? F HOH . ? A HOH 321 ? 1_555 81.9 ? 18 NE2 ? A HIS 84 ? A HIS 83 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? F HOH . ? A HOH 321 ? 1_555 150.3 ? 19 NE2 ? A HIS 110 ? A HIS 109 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? F HOH . ? A HOH 321 ? 1_555 105.5 ? 20 O2A ? E ADP . ? A ADP 203 ? 1_555 ZN ? D ZN . ? A ZN 202 ? 1_555 O ? F HOH . ? A HOH 321 ? 1_555 101.8 ? 21 O ? A ILE 66 ? A ILE 65 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? A GLN 69 ? A GLN 68 ? 1_555 82.3 ? 22 O ? A ILE 66 ? A ILE 65 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? A MET 71 ? A MET 70 ? 1_555 96.8 ? 23 O ? A GLN 69 ? A GLN 68 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? A MET 71 ? A MET 70 ? 1_555 97.9 ? 24 O ? A ILE 66 ? A ILE 65 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 OD1 ? A ASN 73 ? A ASN 72 ? 1_555 82.4 ? 25 O ? A GLN 69 ? A GLN 68 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 OD1 ? A ASN 73 ? A ASN 72 ? 1_555 159.8 ? 26 O ? A MET 71 ? A MET 70 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 OD1 ? A ASN 73 ? A ASN 72 ? 1_555 96.9 ? 27 O ? A ILE 66 ? A ILE 65 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? F HOH . ? A HOH 303 ? 6_555 172.2 ? 28 O ? A GLN 69 ? A GLN 68 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? F HOH . ? A HOH 303 ? 6_555 105.3 ? 29 O ? A MET 71 ? A MET 70 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? F HOH . ? A HOH 303 ? 6_555 83.8 ? 30 OD1 ? A ASN 73 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? F HOH . ? A HOH 303 ? 6_555 89.8 ? 31 O ? A ILE 66 ? A ILE 65 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? F HOH . ? A HOH 309 ? 1_555 93.6 ? 32 O ? A GLN 69 ? A GLN 68 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? F HOH . ? A HOH 309 ? 1_555 86.9 ? 33 O ? A MET 71 ? A MET 70 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? F HOH . ? A HOH 309 ? 1_555 169.0 ? 34 OD1 ? A ASN 73 ? A ASN 72 ? 1_555 CA ? B CA . ? A CA 200 ? 1_555 O ? F HOH . ? A HOH 309 ? 1_555 80.9 ? 35 O ? F HOH . ? A HOH 303 ? 6_555 CA ? B CA . ? A CA 200 ? 1_555 O ? F HOH . ? A HOH 309 ? 1_555 85.4 ? # _pdbx_entry_details.entry_id 31LQ _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 20 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 301 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.19 # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -y+1/2,x+1/2,z+1/4 3 y+1/2,-x+1/2,z+3/4 4 x+1/2,-y+1/2,-z+3/4 5 -x+1/2,y+1/2,-z+1/4 6 -x,-y,z+1/2 7 y,x,-z 8 -y,-x,-z+1/2 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 20.9566974836 7.10798693465 39.7154315834 0.450600033191 ? -0.0383358100704 ? 0.0211387712112 ? 0.566301797954 ? 0.208248846711 ? 0.39431728316 ? 3.87782301913 ? 1.83991793237 ? 0.381314570043 ? 7.70244880857 ? 1.94698633183 ? 2.08312963851 ? 0.0961165670186 ? 0.0707741994487 ? -0.23531598239 ? 0.428055254081 ? -0.150807742845 ? -0.100919835255 ? 0.461874856048 ? -0.26811031591 ? 0.0552380113856 ? 2 'X-RAY DIFFRACTION' ? refined 17.9777827041 16.591593732 28.8290297106 0.309558679153 ? -0.032997664966 ? -0.0392370020475 ? 0.453548802089 ? 0.12739423993 ? 0.466283383643 ? 3.69844457827 ? -0.170843046325 ? -1.72632924834 ? 3.49753893038 ? 0.663150544616 ? 2.21923820087 ? -0.232885399001 ? 0.0699487275814 ? -0.0926551003343 ? -0.0206064122253 ? 0.00978006062618 ? 0.455910872572 ? -0.127440981367 ? -0.589478042498 ? 0.25742357017 ? 3 'X-RAY DIFFRACTION' ? refined 31.1651187106 13.5039385856 36.1633929798 0.350609513625 ? -0.0198035808804 ? -0.00991242489216 ? 0.413109370145 ? 0.165515423277 ? 0.433542812324 ? 2.92676764329 ? 0.518991043114 ? 0.470264938981 ? 1.95258960973 ? -0.084300162492 ? 1.91225358757 ? 0.136037554303 ? -0.524707498832 ? -0.532139438514 ? 0.284650548805 ? -0.0972620129532 ? -0.16884063577 ? 0.0951487021995 ? -0.0792976578171 ? -0.0618716195878 ? 4 'X-RAY DIFFRACTION' ? refined 43.4114206365 20.5096887142 36.1392514304 0.372755993003 ? -0.0451360589425 ? -0.0592525854622 ? 0.473536651705 ? 0.116456105848 ? 0.477804910167 ? 3.58989721147 ? -0.457763343468 ? 0.420738153434 ? 5.26770736288 ? -0.725810037803 ? 3.28991759946 ? 0.0221725951567 ? 0.190388031671 ? -0.205647417111 ? -0.132726478269 ? -0.170097956216 ? -0.225290931706 ? -0.182588370302 ? 0.341307346198 ? 0.092164297743 ? 5 'X-RAY DIFFRACTION' ? refined 35.3203580063 14.5374408862 37.3108587948 0.291459833621 ? -0.0087746916385 ? 0.00187571017105 ? 0.487444022743 ? 0.18200006834 ? 0.492473844949 ? 3.1396762638 ? 1.74281115192 ? 0.641342650336 ? 7.46679669643 ? -2.48641334695 ? 2.76061490505 ? 0.160277942489 ? -0.103491268399 ? -0.405179265515 ? 0.476088557444 ? 0.0745727487465 ? 0.653537035139 ? -0.0350662005777 ? -0.0104320102382 ? -0.212387400997 ? 6 'X-RAY DIFFRACTION' ? refined 33.653961518 12.6376344835 26.9059952668 0.302341537192 ? 0.0232361555469 ? 0.0478283631942 ? 0.342418967131 ? 0.0608178554621 ? 0.42873749612 ? 2.95059899723 ? -0.0803190450484 ? -0.530559240159 ? 3.69697272369 ? -0.758468243068 ? 3.20369531669 ? 0.116489241091 ? -0.00788623026893 ? -0.594079758292 ? -0.571160963497 ? -0.11668275328 ? -0.331814746142 ? 0.143341180534 ? 0.130081730068 ? 0.00269904737589 ? 7 'X-RAY DIFFRACTION' ? refined 22.9379687981 23.3930974029 26.4949284252 0.349021071949 ? 0.0141320084198 ? 0.0425846532268 ? 0.397991485126 ? 0.101004367552 ? 0.339018609171 ? 2.37018511183 ? 0.423024647182 ? -0.234393050478 ? 2.06149471582 ? -0.122992925284 ? 0.959798850271 ? 0.186198685761 ? -0.155999230479 ? 0.0480466947358 ? 0.0666716057035 ? -0.0327288538138 ? 0.0878278709543 ? -0.0961004618567 ? -0.22127173939 ? -0.142690268479 ? 8 'X-RAY DIFFRACTION' ? refined 18.3016574847 28.5293259125 18.6909456537 0.433956770216 ? 0.0408201163266 ? -0.0252636399737 ? 0.527641837449 ? 0.181894301062 ? 0.543859446518 ? 7.37233475903 ? -2.0572287367 ? -3.46309696142 ? 3.29380150347 ? 5.77409417449 ? 2.02487414679 ? 0.231461060021 ? 0.950645899138 ? 0.591596804913 ? -0.732547535898 ? -0.346668974948 ? 1.07561445424 ? -0.849325821258 ? -1.16770606497 ? 0.0879993837204 ? 9 'X-RAY DIFFRACTION' ? refined 29.5987501327 32.2028252598 23.3577205685 0.36846695978 ? 0.0651290064961 ? 0.0834685969093 ? 0.38552824573 ? 0.119916469983 ? 0.294017458431 ? 4.4651487326 ? 3.3327058754 ? 2.8210821447 ? 7.17211761134 ? 3.8935366418 ? 5.63142880891 ? -0.18660723886 ? 0.0940953292214 ? 0.366376900176 ? -0.396622531161 ? 0.101363956936 ? 0.44717986327 ? -0.352761504805 ? -0.103725050963 ? 0.0675183117922 ? 10 'X-RAY DIFFRACTION' ? refined 37.4041193719 28.3744582694 20.5904369651 0.386242528665 ? 0.0193718889484 ? 0.106818416522 ? 0.343175298832 ? 0.0657414679712 ? 0.298130202026 ? 3.4658647302 ? 0.98848446788 ? 1.797722408 ? 4.19380553497 ? 0.403426076546 ? 3.05223029145 ? 0.0528856621657 ? 0.095665910424 ? -0.139857824315 ? -0.240555982171 ? -0.0380524079862 ? -0.299775534639 ? -0.102817649333 ? 0.00301889140776 ? 0.0146917764406 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.beg_PDB_ins_code _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.end_PDB_ins_code _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 A 1 A 3 ? A 14 A 16 ? ? ;chain 'A' and (resid 3 through 16 ) ; 2 'X-RAY DIFFRACTION' 2 A 15 A 17 ? A 35 A 37 ? ? ;chain 'A' and (resid 17 through 37 ) ; 3 'X-RAY DIFFRACTION' 3 A 36 A 38 ? A 66 A 68 ? ? ;chain 'A' and (resid 38 through 68 ) ; 4 'X-RAY DIFFRACTION' 4 A 67 A 69 ? A 77 A 79 ? ? ;chain 'A' and (resid 69 through 79 ) ; 5 'X-RAY DIFFRACTION' 5 A 78 A 80 ? A 93 A 95 ? ? ;chain 'A' and (resid 80 through 95 ) ; 6 'X-RAY DIFFRACTION' 6 A 94 A 96 ? A 116 A 118 ? ? ;chain 'A' and (resid 96 through 118 ) ; 7 'X-RAY DIFFRACTION' 7 A 117 A 119 ? A 136 A 138 ? ? ;chain 'A' and (resid 119 through 138 ) ; 8 'X-RAY DIFFRACTION' 8 A 137 A 139 ? A 147 A 149 ? ? ;chain 'A' and (resid 139 through 149 ) ; 9 'X-RAY DIFFRACTION' 9 A 148 A 150 ? A 166 A 168 ? ? ;chain 'A' and (resid 150 through 168 ) ; 10 'X-RAY DIFFRACTION' 10 A 167 A 169 ? A 187 A 189 ? ? ;chain 'A' and (resid 169 through 189 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 0 ? A MET 1 2 1 Y 1 A GLY 1 ? A GLY 2 3 1 Y 1 A GLU 189 ? A GLU 190 4 1 Y 1 A HIS 190 ? A HIS 191 5 1 Y 1 A HIS 191 ? A HIS 192 6 1 Y 1 A HIS 192 ? A HIS 193 7 1 Y 1 A HIS 193 ? A HIS 194 8 1 Y 1 A HIS 194 ? A HIS 195 9 1 Y 1 A HIS 195 ? A HIS 196 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ADP PB P N N 1 ADP O1B O N N 2 ADP O2B O N N 3 ADP O3B O N N 4 ADP PA P N S 5 ADP O1A O N N 6 ADP O2A O N N 7 ADP O3A O N N 8 ADP "O5'" O N N 9 ADP "C5'" C N N 10 ADP "C4'" C N R 11 ADP "O4'" O N N 12 ADP "C3'" C N S 13 ADP "O3'" O N N 14 ADP "C2'" C N R 15 ADP "O2'" O N N 16 ADP "C1'" C N R 17 ADP N9 N Y N 18 ADP C8 C Y N 19 ADP N7 N Y N 20 ADP C5 C Y N 21 ADP C6 C Y N 22 ADP N6 N N N 23 ADP N1 N Y N 24 ADP C2 C Y N 25 ADP N3 N Y N 26 ADP C4 C Y N 27 ADP HOB2 H N N 28 ADP HOB3 H N N 29 ADP HOA2 H N N 30 ADP "H5'1" H N N 31 ADP "H5'2" H N N 32 ADP "H4'" H N N 33 ADP "H3'" H N N 34 ADP "HO3'" H N N 35 ADP "H2'" H N N 36 ADP "HO2'" H N N 37 ADP "H1'" H N N 38 ADP H8 H N N 39 ADP HN61 H N N 40 ADP HN62 H N N 41 ADP H2 H N N 42 ALA N N N N 43 ALA CA C N S 44 ALA C C N N 45 ALA O O N N 46 ALA CB C N N 47 ALA OXT O N N 48 ALA H H N N 49 ALA H2 H N N 50 ALA HA H N N 51 ALA HB1 H N N 52 ALA HB2 H N N 53 ALA HB3 H N N 54 ALA HXT H N N 55 ARG N N N N 56 ARG CA C N S 57 ARG C C N N 58 ARG O O N N 59 ARG CB C N N 60 ARG CG C N N 61 ARG CD C N N 62 ARG NE N N N 63 ARG CZ C N N 64 ARG NH1 N N N 65 ARG NH2 N N N 66 ARG OXT O N N 67 ARG H H N N 68 ARG H2 H N N 69 ARG HA H N N 70 ARG HB2 H N N 71 ARG HB3 H N N 72 ARG HG2 H N N 73 ARG HG3 H N N 74 ARG HD2 H N N 75 ARG HD3 H N N 76 ARG HE H N N 77 ARG HH11 H N N 78 ARG HH12 H N N 79 ARG HH21 H N N 80 ARG HH22 H N N 81 ARG HXT H N N 82 ASN N N N N 83 ASN CA C N S 84 ASN C C N N 85 ASN O O N N 86 ASN CB C N N 87 ASN CG C N N 88 ASN OD1 O N N 89 ASN ND2 N N N 90 ASN OXT O N N 91 ASN H H N N 92 ASN H2 H N N 93 ASN HA H N N 94 ASN HB2 H N N 95 ASN HB3 H N N 96 ASN HD21 H N N 97 ASN HD22 H N N 98 ASN HXT H N N 99 ASP N N N N 100 ASP CA C N S 101 ASP C C N N 102 ASP O O N N 103 ASP CB C N N 104 ASP CG C N N 105 ASP OD1 O N N 106 ASP OD2 O N N 107 ASP OXT O N N 108 ASP H H N N 109 ASP H2 H N N 110 ASP HA H N N 111 ASP HB2 H N N 112 ASP HB3 H N N 113 ASP HD2 H N N 114 ASP HXT H N N 115 CA CA CA N N 116 GLN N N N N 117 GLN CA C N S 118 GLN C C N N 119 GLN O O N N 120 GLN CB C N N 121 GLN CG C N N 122 GLN CD C N N 123 GLN OE1 O N N 124 GLN NE2 N N N 125 GLN OXT O N N 126 GLN H H N N 127 GLN H2 H N N 128 GLN HA H N N 129 GLN HB2 H N N 130 GLN HB3 H N N 131 GLN HG2 H N N 132 GLN HG3 H N N 133 GLN HE21 H N N 134 GLN HE22 H N N 135 GLN HXT H N N 136 GLU N N N N 137 GLU CA C N S 138 GLU C C N N 139 GLU O O N N 140 GLU CB C N N 141 GLU CG C N N 142 GLU CD C N N 143 GLU OE1 O N N 144 GLU OE2 O N N 145 GLU OXT O N N 146 GLU H H N N 147 GLU H2 H N N 148 GLU HA H N N 149 GLU HB2 H N N 150 GLU HB3 H N N 151 GLU HG2 H N N 152 GLU HG3 H N N 153 GLU HE2 H N N 154 GLU HXT H N N 155 GLY N N N N 156 GLY CA C N N 157 GLY C C N N 158 GLY O O N N 159 GLY OXT O N N 160 GLY H H N N 161 GLY H2 H N N 162 GLY HA2 H N N 163 GLY HA3 H N N 164 GLY HXT H N N 165 HIS N N N N 166 HIS CA C N S 167 HIS C C N N 168 HIS O O N N 169 HIS CB C N N 170 HIS CG C Y N 171 HIS ND1 N Y N 172 HIS CD2 C Y N 173 HIS CE1 C Y N 174 HIS NE2 N Y N 175 HIS OXT O N N 176 HIS H H N N 177 HIS H2 H N N 178 HIS HA H N N 179 HIS HB2 H N N 180 HIS HB3 H N N 181 HIS HD1 H N N 182 HIS HD2 H N N 183 HIS HE1 H N N 184 HIS HE2 H N N 185 HIS HXT H N N 186 HOH O O N N 187 HOH H1 H N N 188 HOH H2 H N N 189 ILE N N N N 190 ILE CA C N S 191 ILE C C N N 192 ILE O O N N 193 ILE CB C N S 194 ILE CG1 C N N 195 ILE CG2 C N N 196 ILE CD1 C N N 197 ILE OXT O N N 198 ILE H H N N 199 ILE H2 H N N 200 ILE HA H N N 201 ILE HB H N N 202 ILE HG12 H N N 203 ILE HG13 H N N 204 ILE HG21 H N N 205 ILE HG22 H N N 206 ILE HG23 H N N 207 ILE HD11 H N N 208 ILE HD12 H N N 209 ILE HD13 H N N 210 ILE HXT H N N 211 LEU N N N N 212 LEU CA C N S 213 LEU C C N N 214 LEU O O N N 215 LEU CB C N N 216 LEU CG C N N 217 LEU CD1 C N N 218 LEU CD2 C N N 219 LEU OXT O N N 220 LEU H H N N 221 LEU H2 H N N 222 LEU HA H N N 223 LEU HB2 H N N 224 LEU HB3 H N N 225 LEU HG H N N 226 LEU HD11 H N N 227 LEU HD12 H N N 228 LEU HD13 H N N 229 LEU HD21 H N N 230 LEU HD22 H N N 231 LEU HD23 H N N 232 LEU HXT H N N 233 LYS N N N N 234 LYS CA C N S 235 LYS C C N N 236 LYS O O N N 237 LYS CB C N N 238 LYS CG C N N 239 LYS CD C N N 240 LYS CE C N N 241 LYS NZ N N N 242 LYS OXT O N N 243 LYS H H N N 244 LYS H2 H N N 245 LYS HA H N N 246 LYS HB2 H N N 247 LYS HB3 H N N 248 LYS HG2 H N N 249 LYS HG3 H N N 250 LYS HD2 H N N 251 LYS HD3 H N N 252 LYS HE2 H N N 253 LYS HE3 H N N 254 LYS HZ1 H N N 255 LYS HZ2 H N N 256 LYS HZ3 H N N 257 LYS HXT H N N 258 MET N N N N 259 MET CA C N S 260 MET C C N N 261 MET O O N N 262 MET CB C N N 263 MET CG C N N 264 MET SD S N N 265 MET CE C N N 266 MET OXT O N N 267 MET H H N N 268 MET H2 H N N 269 MET HA H N N 270 MET HB2 H N N 271 MET HB3 H N N 272 MET HG2 H N N 273 MET HG3 H N N 274 MET HE1 H N N 275 MET HE2 H N N 276 MET HE3 H N N 277 MET HXT H N N 278 PHE N N N N 279 PHE CA C N S 280 PHE C C N N 281 PHE O O N N 282 PHE CB C N N 283 PHE CG C Y N 284 PHE CD1 C Y N 285 PHE CD2 C Y N 286 PHE CE1 C Y N 287 PHE CE2 C Y N 288 PHE CZ C Y N 289 PHE OXT O N N 290 PHE H H N N 291 PHE H2 H N N 292 PHE HA H N N 293 PHE HB2 H N N 294 PHE HB3 H N N 295 PHE HD1 H N N 296 PHE HD2 H N N 297 PHE HE1 H N N 298 PHE HE2 H N N 299 PHE HZ H N N 300 PHE HXT H N N 301 PRO N N N N 302 PRO CA C N S 303 PRO C C N N 304 PRO O O N N 305 PRO CB C N N 306 PRO CG C N N 307 PRO CD C N N 308 PRO OXT O N N 309 PRO H H N N 310 PRO HA H N N 311 PRO HB2 H N N 312 PRO HB3 H N N 313 PRO HG2 H N N 314 PRO HG3 H N N 315 PRO HD2 H N N 316 PRO HD3 H N N 317 PRO HXT H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 ZN ZN ZN N N 420 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ADP PB O1B doub N N 1 ADP PB O2B sing N N 2 ADP PB O3B sing N N 3 ADP PB O3A sing N N 4 ADP O2B HOB2 sing N N 5 ADP O3B HOB3 sing N N 6 ADP PA O1A doub N N 7 ADP PA O2A sing N N 8 ADP PA O3A sing N N 9 ADP PA "O5'" sing N N 10 ADP O2A HOA2 sing N N 11 ADP "O5'" "C5'" sing N N 12 ADP "C5'" "C4'" sing N N 13 ADP "C5'" "H5'1" sing N N 14 ADP "C5'" "H5'2" sing N N 15 ADP "C4'" "O4'" sing N N 16 ADP "C4'" "C3'" sing N N 17 ADP "C4'" "H4'" sing N N 18 ADP "O4'" "C1'" sing N N 19 ADP "C3'" "O3'" sing N N 20 ADP "C3'" "C2'" sing N N 21 ADP "C3'" "H3'" sing N N 22 ADP "O3'" "HO3'" sing N N 23 ADP "C2'" "O2'" sing N N 24 ADP "C2'" "C1'" sing N N 25 ADP "C2'" "H2'" sing N N 26 ADP "O2'" "HO2'" sing N N 27 ADP "C1'" N9 sing N N 28 ADP "C1'" "H1'" sing N N 29 ADP N9 C8 sing Y N 30 ADP N9 C4 sing Y N 31 ADP C8 N7 doub Y N 32 ADP C8 H8 sing N N 33 ADP N7 C5 sing Y N 34 ADP C5 C6 sing Y N 35 ADP C5 C4 doub Y N 36 ADP C6 N6 sing N N 37 ADP C6 N1 doub Y N 38 ADP N6 HN61 sing N N 39 ADP N6 HN62 sing N N 40 ADP N1 C2 sing Y N 41 ADP C2 N3 doub Y N 42 ADP C2 H2 sing N N 43 ADP N3 C4 sing Y N 44 ALA N CA sing N N 45 ALA N H sing N N 46 ALA N H2 sing N N 47 ALA CA C sing N N 48 ALA CA CB sing N N 49 ALA CA HA sing N N 50 ALA C O doub N N 51 ALA C OXT sing N N 52 ALA CB HB1 sing N N 53 ALA CB HB2 sing N N 54 ALA CB HB3 sing N N 55 ALA OXT HXT sing N N 56 ARG N CA sing N N 57 ARG N H sing N N 58 ARG N H2 sing N N 59 ARG CA C sing N N 60 ARG CA CB sing N N 61 ARG CA HA sing N N 62 ARG C O doub N N 63 ARG C OXT sing N N 64 ARG CB CG sing N N 65 ARG CB HB2 sing N N 66 ARG CB HB3 sing N N 67 ARG CG CD sing N N 68 ARG CG HG2 sing N N 69 ARG CG HG3 sing N N 70 ARG CD NE sing N N 71 ARG CD HD2 sing N N 72 ARG CD HD3 sing N N 73 ARG NE CZ sing N N 74 ARG NE HE sing N N 75 ARG CZ NH1 sing N N 76 ARG CZ NH2 doub N N 77 ARG NH1 HH11 sing N N 78 ARG NH1 HH12 sing N N 79 ARG NH2 HH21 sing N N 80 ARG NH2 HH22 sing N N 81 ARG OXT HXT sing N N 82 ASN N CA sing N N 83 ASN N H sing N N 84 ASN N H2 sing N N 85 ASN CA C sing N N 86 ASN CA CB sing N N 87 ASN CA HA sing N N 88 ASN C O doub N N 89 ASN C OXT sing N N 90 ASN CB CG sing N N 91 ASN CB HB2 sing N N 92 ASN CB HB3 sing N N 93 ASN CG OD1 doub N N 94 ASN CG ND2 sing N N 95 ASN ND2 HD21 sing N N 96 ASN ND2 HD22 sing N N 97 ASN OXT HXT sing N N 98 ASP N CA sing N N 99 ASP N H sing N N 100 ASP N H2 sing N N 101 ASP CA C sing N N 102 ASP CA CB sing N N 103 ASP CA HA sing N N 104 ASP C O doub N N 105 ASP C OXT sing N N 106 ASP CB CG sing N N 107 ASP CB HB2 sing N N 108 ASP CB HB3 sing N N 109 ASP CG OD1 doub N N 110 ASP CG OD2 sing N N 111 ASP OD2 HD2 sing N N 112 ASP OXT HXT sing N N 113 GLN N CA sing N N 114 GLN N H sing N N 115 GLN N H2 sing N N 116 GLN CA C sing N N 117 GLN CA CB sing N N 118 GLN CA HA sing N N 119 GLN C O doub N N 120 GLN C OXT sing N N 121 GLN CB CG sing N N 122 GLN CB HB2 sing N N 123 GLN CB HB3 sing N N 124 GLN CG CD sing N N 125 GLN CG HG2 sing N N 126 GLN CG HG3 sing N N 127 GLN CD OE1 doub N N 128 GLN CD NE2 sing N N 129 GLN NE2 HE21 sing N N 130 GLN NE2 HE22 sing N N 131 GLN OXT HXT sing N N 132 GLU N CA sing N N 133 GLU N H sing N N 134 GLU N H2 sing N N 135 GLU CA C sing N N 136 GLU CA CB sing N N 137 GLU CA HA sing N N 138 GLU C O doub N N 139 GLU C OXT sing N N 140 GLU CB CG sing N N 141 GLU CB HB2 sing N N 142 GLU CB HB3 sing N N 143 GLU CG CD sing N N 144 GLU CG HG2 sing N N 145 GLU CG HG3 sing N N 146 GLU CD OE1 doub N N 147 GLU CD OE2 sing N N 148 GLU OE2 HE2 sing N N 149 GLU OXT HXT sing N N 150 GLY N CA sing N N 151 GLY N H sing N N 152 GLY N H2 sing N N 153 GLY CA C sing N N 154 GLY CA HA2 sing N N 155 GLY CA HA3 sing N N 156 GLY C O doub N N 157 GLY C OXT sing N N 158 GLY OXT HXT sing N N 159 HIS N CA sing N N 160 HIS N H sing N N 161 HIS N H2 sing N N 162 HIS CA C sing N N 163 HIS CA CB sing N N 164 HIS CA HA sing N N 165 HIS C O doub N N 166 HIS C OXT sing N N 167 HIS CB CG sing N N 168 HIS CB HB2 sing N N 169 HIS CB HB3 sing N N 170 HIS CG ND1 sing Y N 171 HIS CG CD2 doub Y N 172 HIS ND1 CE1 doub Y N 173 HIS ND1 HD1 sing N N 174 HIS CD2 NE2 sing Y N 175 HIS CD2 HD2 sing N N 176 HIS CE1 NE2 sing Y N 177 HIS CE1 HE1 sing N N 178 HIS NE2 HE2 sing N N 179 HIS OXT HXT sing N N 180 HOH O H1 sing N N 181 HOH O H2 sing N N 182 ILE N CA sing N N 183 ILE N H sing N N 184 ILE N H2 sing N N 185 ILE CA C sing N N 186 ILE CA CB sing N N 187 ILE CA HA sing N N 188 ILE C O doub N N 189 ILE C OXT sing N N 190 ILE CB CG1 sing N N 191 ILE CB CG2 sing N N 192 ILE CB HB sing N N 193 ILE CG1 CD1 sing N N 194 ILE CG1 HG12 sing N N 195 ILE CG1 HG13 sing N N 196 ILE CG2 HG21 sing N N 197 ILE CG2 HG22 sing N N 198 ILE CG2 HG23 sing N N 199 ILE CD1 HD11 sing N N 200 ILE CD1 HD12 sing N N 201 ILE CD1 HD13 sing N N 202 ILE OXT HXT sing N N 203 LEU N CA sing N N 204 LEU N H sing N N 205 LEU N H2 sing N N 206 LEU CA C sing N N 207 LEU CA CB sing N N 208 LEU CA HA sing N N 209 LEU C O doub N N 210 LEU C OXT sing N N 211 LEU CB CG sing N N 212 LEU CB HB2 sing N N 213 LEU CB HB3 sing N N 214 LEU CG CD1 sing N N 215 LEU CG CD2 sing N N 216 LEU CG HG sing N N 217 LEU CD1 HD11 sing N N 218 LEU CD1 HD12 sing N N 219 LEU CD1 HD13 sing N N 220 LEU CD2 HD21 sing N N 221 LEU CD2 HD22 sing N N 222 LEU CD2 HD23 sing N N 223 LEU OXT HXT sing N N 224 LYS N CA sing N N 225 LYS N H sing N N 226 LYS N H2 sing N N 227 LYS CA C sing N N 228 LYS CA CB sing N N 229 LYS CA HA sing N N 230 LYS C O doub N N 231 LYS C OXT sing N N 232 LYS CB CG sing N N 233 LYS CB HB2 sing N N 234 LYS CB HB3 sing N N 235 LYS CG CD sing N N 236 LYS CG HG2 sing N N 237 LYS CG HG3 sing N N 238 LYS CD CE sing N N 239 LYS CD HD2 sing N N 240 LYS CD HD3 sing N N 241 LYS CE NZ sing N N 242 LYS CE HE2 sing N N 243 LYS CE HE3 sing N N 244 LYS NZ HZ1 sing N N 245 LYS NZ HZ2 sing N N 246 LYS NZ HZ3 sing N N 247 LYS OXT HXT sing N N 248 MET N CA sing N N 249 MET N H sing N N 250 MET N H2 sing N N 251 MET CA C sing N N 252 MET CA CB sing N N 253 MET CA HA sing N N 254 MET C O doub N N 255 MET C OXT sing N N 256 MET CB CG sing N N 257 MET CB HB2 sing N N 258 MET CB HB3 sing N N 259 MET CG SD sing N N 260 MET CG HG2 sing N N 261 MET CG HG3 sing N N 262 MET SD CE sing N N 263 MET CE HE1 sing N N 264 MET CE HE2 sing N N 265 MET CE HE3 sing N N 266 MET OXT HXT sing N N 267 PHE N CA sing N N 268 PHE N H sing N N 269 PHE N H2 sing N N 270 PHE CA C sing N N 271 PHE CA CB sing N N 272 PHE CA HA sing N N 273 PHE C O doub N N 274 PHE C OXT sing N N 275 PHE CB CG sing N N 276 PHE CB HB2 sing N N 277 PHE CB HB3 sing N N 278 PHE CG CD1 doub Y N 279 PHE CG CD2 sing Y N 280 PHE CD1 CE1 sing Y N 281 PHE CD1 HD1 sing N N 282 PHE CD2 CE2 doub Y N 283 PHE CD2 HD2 sing N N 284 PHE CE1 CZ doub Y N 285 PHE CE1 HE1 sing N N 286 PHE CE2 CZ sing Y N 287 PHE CE2 HE2 sing N N 288 PHE CZ HZ sing N N 289 PHE OXT HXT sing N N 290 PRO N CA sing N N 291 PRO N CD sing N N 292 PRO N H sing N N 293 PRO CA C sing N N 294 PRO CA CB sing N N 295 PRO CA HA sing N N 296 PRO C O doub N N 297 PRO C OXT sing N N 298 PRO CB CG sing N N 299 PRO CB HB2 sing N N 300 PRO CB HB3 sing N N 301 PRO CG CD sing N N 302 PRO CG HG2 sing N N 303 PRO CG HG3 sing N N 304 PRO CD HD2 sing N N 305 PRO CD HD3 sing N N 306 PRO OXT HXT sing N N 307 SER N CA sing N N 308 SER N H sing N N 309 SER N H2 sing N N 310 SER CA C sing N N 311 SER CA CB sing N N 312 SER CA HA sing N N 313 SER C O doub N N 314 SER C OXT sing N N 315 SER CB OG sing N N 316 SER CB HB2 sing N N 317 SER CB HB3 sing N N 318 SER OG HG sing N N 319 SER OXT HXT sing N N 320 THR N CA sing N N 321 THR N H sing N N 322 THR N H2 sing N N 323 THR CA C sing N N 324 THR CA CB sing N N 325 THR CA HA sing N N 326 THR C O doub N N 327 THR C OXT sing N N 328 THR CB OG1 sing N N 329 THR CB CG2 sing N N 330 THR CB HB sing N N 331 THR OG1 HG1 sing N N 332 THR CG2 HG21 sing N N 333 THR CG2 HG22 sing N N 334 THR CG2 HG23 sing N N 335 THR OXT HXT sing N N 336 TRP N CA sing N N 337 TRP N H sing N N 338 TRP N H2 sing N N 339 TRP CA C sing N N 340 TRP CA CB sing N N 341 TRP CA HA sing N N 342 TRP C O doub N N 343 TRP C OXT sing N N 344 TRP CB CG sing N N 345 TRP CB HB2 sing N N 346 TRP CB HB3 sing N N 347 TRP CG CD1 doub Y N 348 TRP CG CD2 sing Y N 349 TRP CD1 NE1 sing Y N 350 TRP CD1 HD1 sing N N 351 TRP CD2 CE2 doub Y N 352 TRP CD2 CE3 sing Y N 353 TRP NE1 CE2 sing Y N 354 TRP NE1 HE1 sing N N 355 TRP CE2 CZ2 sing Y N 356 TRP CE3 CZ3 doub Y N 357 TRP CE3 HE3 sing N N 358 TRP CZ2 CH2 doub Y N 359 TRP CZ2 HZ2 sing N N 360 TRP CZ3 CH2 sing Y N 361 TRP CZ3 HZ3 sing N N 362 TRP CH2 HH2 sing N N 363 TRP OXT HXT sing N N 364 TYR N CA sing N N 365 TYR N H sing N N 366 TYR N H2 sing N N 367 TYR CA C sing N N 368 TYR CA CB sing N N 369 TYR CA HA sing N N 370 TYR C O doub N N 371 TYR C OXT sing N N 372 TYR CB CG sing N N 373 TYR CB HB2 sing N N 374 TYR CB HB3 sing N N 375 TYR CG CD1 doub Y N 376 TYR CG CD2 sing Y N 377 TYR CD1 CE1 sing Y N 378 TYR CD1 HD1 sing N N 379 TYR CD2 CE2 doub Y N 380 TYR CD2 HD2 sing N N 381 TYR CE1 CZ doub Y N 382 TYR CE1 HE1 sing N N 383 TYR CE2 CZ sing Y N 384 TYR CE2 HE2 sing N N 385 TYR CZ OH sing N N 386 TYR OH HH sing N N 387 TYR OXT HXT sing N N 388 VAL N CA sing N N 389 VAL N H sing N N 390 VAL N H2 sing N N 391 VAL CA C sing N N 392 VAL CA CB sing N N 393 VAL CA HA sing N N 394 VAL C O doub N N 395 VAL C OXT sing N N 396 VAL CB CG1 sing N N 397 VAL CB CG2 sing N N 398 VAL CB HB sing N N 399 VAL CG1 HG11 sing N N 400 VAL CG1 HG12 sing N N 401 VAL CG1 HG13 sing N N 402 VAL CG2 HG21 sing N N 403 VAL CG2 HG22 sing N N 404 VAL CG2 HG23 sing N N 405 VAL OXT HXT sing N N 406 # _pdbx_audit_support.funding_organization 'German Research Foundation (DFG)' _pdbx_audit_support.country Germany _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'apo structure' # _space_group.name_H-M_alt 'P 41 21 2' _space_group.name_Hall 'P 4abw 2nw' _space_group.IT_number 92 _space_group.crystal_system tetragonal _space_group.id 1 # _atom_sites.entry_id 31LQ _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.013646 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013646 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010447 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? CA ? ? 16.26893 3.65395 ? ? 3.58509 77.28589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? P ? ? 9.51135 5.44231 ? ? 1.42069 35.72801 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? ZN ? ? 24.64596 5.25405 ? ? 2.14387 29.76375 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #