data_31NV # _entry.id 31NV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 31NV pdb_000031nv 10.2210/pdb31nv/pdb WWPDB D_1292158117 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-08-26 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 31NV _pdbx_database_status.recvd_initial_deposition_date 2026-06-15 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email ddleonidas@bio.uth.gr _pdbx_contact_author.name_first Demetres _pdbx_contact_author.name_last Leonidas _pdbx_contact_author.name_mi D _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-3874-2523 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Tsagkarakou, A.S.' 1 0000-0003-1723-7840 'Kantsadi, A.L.' 2 0000-0003-1996-7054 'Leonidas, D.D.' 3 0000-0002-3874-2523 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Chemmedchem _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1860-7187 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 21 _citation.language ? _citation.page_first e70439 _citation.page_last e70439 _citation.title ;Structural and Biophysical Characterization of C-Glycosylic 1,2-Thiodisaccharides Reveals Determinants of Selective Binding to Galectin-7 and Galectin-8N. ; _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/cmdc.70439 _citation.pdbx_database_id_PubMed 42603778 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tsagkarakou, A.S.' 1 0000-0003-1723-7840 primary 'Kantsadi, A.L.' 2 ? primary 'Theodoridou, V.I.' 3 ? primary 'Veliotis, N.' 4 0009-0002-7812-7290 primary 'Lazar, L.' 5 ? primary 'Jozsef, J.' 6 ? primary 'Juhasz, L.' 7 0000-0002-7462-7944 primary 'Kontopidis, G.' 8 ? primary 'Leffler, H.' 9 0000-0003-4482-8945 primary 'Nilsson, U.J.' 10 0000-0001-5815-9522 primary 'Somsak, L.' 11 0000-0002-9103-9845 primary 'Leonidas, D.D.' 12 0000-0002-3874-2523 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Galectin-8 35854.055 1 ? ? ? ? 2 branched syn '1-thio-beta-D-galactopyranose-(1-1)-beta-D-galactopyranose' 358.362 1 ? ? ? ? 3 water nat water 18.015 66 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Gal-8,Po66 carbohydrate-binding protein,Po66-CBP,Prostate carcinoma tumor antigen 1,PCTA-1' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNT LINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQST QASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFV RNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW ; _entity_poly.pdbx_seq_one_letter_code_can ;MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNT LINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQST QASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFV RNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 MET n 1 3 LEU n 1 4 SER n 1 5 LEU n 1 6 ASN n 1 7 ASN n 1 8 LEU n 1 9 GLN n 1 10 ASN n 1 11 ILE n 1 12 ILE n 1 13 TYR n 1 14 ASN n 1 15 PRO n 1 16 VAL n 1 17 ILE n 1 18 PRO n 1 19 PHE n 1 20 VAL n 1 21 GLY n 1 22 THR n 1 23 ILE n 1 24 PRO n 1 25 ASP n 1 26 GLN n 1 27 LEU n 1 28 ASP n 1 29 PRO n 1 30 GLY n 1 31 THR n 1 32 LEU n 1 33 ILE n 1 34 VAL n 1 35 ILE n 1 36 ARG n 1 37 GLY n 1 38 HIS n 1 39 VAL n 1 40 PRO n 1 41 SER n 1 42 ASP n 1 43 ALA n 1 44 ASP n 1 45 ARG n 1 46 PHE n 1 47 GLN n 1 48 VAL n 1 49 ASP n 1 50 LEU n 1 51 GLN n 1 52 ASN n 1 53 GLY n 1 54 SER n 1 55 SER n 1 56 MET n 1 57 LYS n 1 58 PRO n 1 59 ARG n 1 60 ALA n 1 61 ASP n 1 62 VAL n 1 63 ALA n 1 64 PHE n 1 65 HIS n 1 66 PHE n 1 67 ASN n 1 68 PRO n 1 69 ARG n 1 70 PHE n 1 71 LYS n 1 72 ARG n 1 73 ALA n 1 74 GLY n 1 75 CYS n 1 76 ILE n 1 77 VAL n 1 78 CYS n 1 79 ASN n 1 80 THR n 1 81 LEU n 1 82 ILE n 1 83 ASN n 1 84 GLU n 1 85 LYS n 1 86 TRP n 1 87 GLY n 1 88 ARG n 1 89 GLU n 1 90 GLU n 1 91 ILE n 1 92 THR n 1 93 TYR n 1 94 ASP n 1 95 THR n 1 96 PRO n 1 97 PHE n 1 98 LYS n 1 99 ARG n 1 100 GLU n 1 101 LYS n 1 102 SER n 1 103 PHE n 1 104 GLU n 1 105 ILE n 1 106 VAL n 1 107 ILE n 1 108 MET n 1 109 VAL n 1 110 LEU n 1 111 LYS n 1 112 ASP n 1 113 LYS n 1 114 PHE n 1 115 GLN n 1 116 VAL n 1 117 ALA n 1 118 VAL n 1 119 ASN n 1 120 GLY n 1 121 LYS n 1 122 HIS n 1 123 THR n 1 124 LEU n 1 125 LEU n 1 126 TYR n 1 127 GLY n 1 128 HIS n 1 129 ARG n 1 130 ILE n 1 131 GLY n 1 132 PRO n 1 133 GLU n 1 134 LYS n 1 135 ILE n 1 136 ASP n 1 137 THR n 1 138 LEU n 1 139 GLY n 1 140 ILE n 1 141 TYR n 1 142 GLY n 1 143 LYS n 1 144 VAL n 1 145 ASN n 1 146 ILE n 1 147 HIS n 1 148 SER n 1 149 ILE n 1 150 GLY n 1 151 PHE n 1 152 SER n 1 153 PHE n 1 154 SER n 1 155 SER n 1 156 ASP n 1 157 LEU n 1 158 GLN n 1 159 SER n 1 160 THR n 1 161 GLN n 1 162 ALA n 1 163 SER n 1 164 SER n 1 165 LEU n 1 166 GLU n 1 167 LEU n 1 168 THR n 1 169 GLU n 1 170 ILE n 1 171 SER n 1 172 ARG n 1 173 GLU n 1 174 ASN n 1 175 VAL n 1 176 PRO n 1 177 LYS n 1 178 SER n 1 179 GLY n 1 180 THR n 1 181 PRO n 1 182 GLN n 1 183 LEU n 1 184 ARG n 1 185 LEU n 1 186 PRO n 1 187 PHE n 1 188 ALA n 1 189 ALA n 1 190 ARG n 1 191 LEU n 1 192 ASN n 1 193 THR n 1 194 PRO n 1 195 MET n 1 196 GLY n 1 197 PRO n 1 198 GLY n 1 199 ARG n 1 200 THR n 1 201 VAL n 1 202 VAL n 1 203 VAL n 1 204 LYS n 1 205 GLY n 1 206 GLU n 1 207 VAL n 1 208 ASN n 1 209 ALA n 1 210 ASN n 1 211 ALA n 1 212 LYS n 1 213 SER n 1 214 PHE n 1 215 ASN n 1 216 VAL n 1 217 ASP n 1 218 LEU n 1 219 LEU n 1 220 ALA n 1 221 GLY n 1 222 LYS n 1 223 SER n 1 224 LYS n 1 225 ASP n 1 226 ILE n 1 227 ALA n 1 228 LEU n 1 229 HIS n 1 230 LEU n 1 231 ASN n 1 232 PRO n 1 233 ARG n 1 234 LEU n 1 235 ASN n 1 236 ILE n 1 237 LYS n 1 238 ALA n 1 239 PHE n 1 240 VAL n 1 241 ARG n 1 242 ASN n 1 243 SER n 1 244 PHE n 1 245 LEU n 1 246 GLN n 1 247 GLU n 1 248 SER n 1 249 TRP n 1 250 GLY n 1 251 GLU n 1 252 GLU n 1 253 GLU n 1 254 ARG n 1 255 ASN n 1 256 ILE n 1 257 THR n 1 258 SER n 1 259 PHE n 1 260 PRO n 1 261 PHE n 1 262 SER n 1 263 PRO n 1 264 GLY n 1 265 MET n 1 266 TYR n 1 267 PHE n 1 268 GLU n 1 269 MET n 1 270 ILE n 1 271 ILE n 1 272 TYR n 1 273 CYS n 1 274 ASP n 1 275 VAL n 1 276 ARG n 1 277 GLU n 1 278 PHE n 1 279 LYS n 1 280 VAL n 1 281 ALA n 1 282 VAL n 1 283 ASN n 1 284 GLY n 1 285 VAL n 1 286 HIS n 1 287 SER n 1 288 LEU n 1 289 GLU n 1 290 TYR n 1 291 LYS n 1 292 HIS n 1 293 ARG n 1 294 PHE n 1 295 LYS n 1 296 GLU n 1 297 LEU n 1 298 SER n 1 299 SER n 1 300 ILE n 1 301 ASP n 1 302 THR n 1 303 LEU n 1 304 GLU n 1 305 ILE n 1 306 ASN n 1 307 GLY n 1 308 ASP n 1 309 ILE n 1 310 HIS n 1 311 LEU n 1 312 LEU n 1 313 GLU n 1 314 VAL n 1 315 ARG n 1 316 SER n 1 317 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 317 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LGALS8 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'WURCS=2.0/1,2,1/[a2112h-1b_1-5]/1-1/a1-b1*S*' WURCS PDB2Glycan 1.1.0 2 2 '[][b-D-Galp1SH]{[(1+S)][b-D-Galp]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 1 _pdbx_entity_branch_link.comp_id_1 GAL _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 2 _pdbx_entity_branch_link.comp_id_2 YIO _pdbx_entity_branch_link.atom_id_2 S1 _pdbx_entity_branch_link.leaving_atom_id_2 HS1 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GAL 'D-saccharide, beta linking' . beta-D-galactopyranose 'beta-D-galactose; D-galactose; galactose' 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 YIO 'D-saccharide, beta linking' . 1-thio-beta-D-galactopyranose '(2R,3R,4S,5R,6S)-2-(HYDROXYMETHYL)-6-SULFANYL-OXANE-3,4,5-TRIOL; 1-thio-beta-D-galactose; 1-thio-D-galactose; 1-thio-galactose' 'C6 H12 O5 S' 196.221 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal YIO 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp1SH # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 MET 2 2 ? ? ? A . n A 1 3 LEU 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 LEU 5 5 ? ? ? A . n A 1 6 ASN 6 6 ? ? ? A . n A 1 7 ASN 7 7 ? ? ? A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 GLN 9 9 9 GLN GLN A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 TYR 13 13 13 TYR TYR A . n A 1 14 ASN 14 14 14 ASN ASN A . n A 1 15 PRO 15 15 15 PRO PRO A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 PHE 19 19 19 PHE PHE A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ILE 23 23 23 ILE ILE A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 ASP 28 28 28 ASP ASP A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 ILE 35 35 35 ILE ILE A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 GLY 37 37 37 GLY GLY A . n A 1 38 HIS 38 38 38 HIS HIS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 PRO 40 40 40 PRO PRO A . n A 1 41 SER 41 41 41 SER SER A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 PHE 46 46 46 PHE PHE A . n A 1 47 GLN 47 47 47 GLN GLN A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLN 51 51 51 GLN GLN A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 GLY 53 53 53 GLY GLY A . n A 1 54 SER 54 54 54 SER SER A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 MET 56 56 56 MET MET A . n A 1 57 LYS 57 57 57 LYS LYS A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 ARG 59 59 59 ARG ARG A . n A 1 60 ALA 60 60 60 ALA ALA A . n A 1 61 ASP 61 61 61 ASP ASP A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 ALA 63 63 63 ALA ALA A . n A 1 64 PHE 64 64 64 PHE PHE A . n A 1 65 HIS 65 65 65 HIS HIS A . n A 1 66 PHE 66 66 66 PHE PHE A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 LYS 71 71 71 LYS LYS A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 CYS 75 75 75 CYS CYS A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 CYS 78 78 78 CYS CYS A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 LYS 85 85 85 LYS LYS A . n A 1 86 TRP 86 86 86 TRP TRP A . n A 1 87 GLY 87 87 87 GLY GLY A . n A 1 88 ARG 88 88 88 ARG ARG A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 GLU 90 90 90 GLU GLU A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 THR 92 92 92 THR THR A . n A 1 93 TYR 93 93 93 TYR TYR A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 THR 95 95 95 THR THR A . n A 1 96 PRO 96 96 96 PRO PRO A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 ARG 99 99 99 ARG ARG A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 PHE 103 103 103 PHE PHE A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 VAL 106 106 106 VAL VAL A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 MET 108 108 108 MET MET A . n A 1 109 VAL 109 109 109 VAL VAL A . n A 1 110 LEU 110 110 110 LEU LEU A . n A 1 111 LYS 111 111 111 LYS LYS A . n A 1 112 ASP 112 112 112 ASP ASP A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 GLN 115 115 115 GLN GLN A . n A 1 116 VAL 116 116 116 VAL VAL A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 ASN 119 119 119 ASN ASN A . n A 1 120 GLY 120 120 120 GLY GLY A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 THR 123 123 123 THR THR A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 TYR 126 126 126 TYR TYR A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 PRO 132 132 132 PRO PRO A . n A 1 133 GLU 133 133 133 GLU GLU A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 ILE 135 135 135 ILE ILE A . n A 1 136 ASP 136 136 136 ASP ASP A . n A 1 137 THR 137 137 137 THR THR A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 ILE 140 140 140 ILE ILE A . n A 1 141 TYR 141 141 141 TYR TYR A . n A 1 142 GLY 142 142 142 GLY GLY A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 VAL 144 144 144 VAL VAL A . n A 1 145 ASN 145 145 145 ASN ASN A . n A 1 146 ILE 146 146 146 ILE ILE A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 SER 148 148 148 SER SER A . n A 1 149 ILE 149 149 149 ILE ILE A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 PHE 151 151 151 PHE PHE A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 PHE 153 153 153 PHE PHE A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 SER 155 155 ? ? ? A . n A 1 156 ASP 156 156 ? ? ? A . n A 1 157 LEU 157 157 ? ? ? A . n A 1 158 GLN 158 158 ? ? ? A . n A 1 159 SER 159 159 ? ? ? A . n A 1 160 THR 160 160 ? ? ? A . n A 1 161 GLN 161 161 ? ? ? A . n A 1 162 ALA 162 162 ? ? ? A . n A 1 163 SER 163 163 ? ? ? A . n A 1 164 SER 164 164 ? ? ? A . n A 1 165 LEU 165 165 ? ? ? A . n A 1 166 GLU 166 166 ? ? ? A . n A 1 167 LEU 167 167 ? ? ? A . n A 1 168 THR 168 168 ? ? ? A . n A 1 169 GLU 169 169 ? ? ? A . n A 1 170 ILE 170 170 ? ? ? A . n A 1 171 SER 171 171 ? ? ? A . n A 1 172 ARG 172 172 ? ? ? A . n A 1 173 GLU 173 173 ? ? ? A . n A 1 174 ASN 174 174 ? ? ? A . n A 1 175 VAL 175 175 ? ? ? A . n A 1 176 PRO 176 176 ? ? ? A . n A 1 177 LYS 177 177 ? ? ? A . n A 1 178 SER 178 178 ? ? ? A . n A 1 179 GLY 179 179 ? ? ? A . n A 1 180 THR 180 180 ? ? ? A . n A 1 181 PRO 181 181 ? ? ? A . n A 1 182 GLN 182 182 ? ? ? A . n A 1 183 LEU 183 183 ? ? ? A . n A 1 184 ARG 184 184 ? ? ? A . n A 1 185 LEU 185 185 ? ? ? A . n A 1 186 PRO 186 186 ? ? ? A . n A 1 187 PHE 187 187 ? ? ? A . n A 1 188 ALA 188 188 ? ? ? A . n A 1 189 ALA 189 189 ? ? ? A . n A 1 190 ARG 190 190 ? ? ? A . n A 1 191 LEU 191 191 ? ? ? A . n A 1 192 ASN 192 192 ? ? ? A . n A 1 193 THR 193 193 ? ? ? A . n A 1 194 PRO 194 194 ? ? ? A . n A 1 195 MET 195 195 ? ? ? A . n A 1 196 GLY 196 196 ? ? ? A . n A 1 197 PRO 197 197 ? ? ? A . n A 1 198 GLY 198 198 ? ? ? A . n A 1 199 ARG 199 199 ? ? ? A . n A 1 200 THR 200 200 ? ? ? A . n A 1 201 VAL 201 201 ? ? ? A . n A 1 202 VAL 202 202 ? ? ? A . n A 1 203 VAL 203 203 ? ? ? A . n A 1 204 LYS 204 204 ? ? ? A . n A 1 205 GLY 205 205 ? ? ? A . n A 1 206 GLU 206 206 ? ? ? A . n A 1 207 VAL 207 207 ? ? ? A . n A 1 208 ASN 208 208 ? ? ? A . n A 1 209 ALA 209 209 ? ? ? A . n A 1 210 ASN 210 210 ? ? ? A . n A 1 211 ALA 211 211 ? ? ? A . n A 1 212 LYS 212 212 ? ? ? A . n A 1 213 SER 213 213 ? ? ? A . n A 1 214 PHE 214 214 ? ? ? A . n A 1 215 ASN 215 215 ? ? ? A . n A 1 216 VAL 216 216 ? ? ? A . n A 1 217 ASP 217 217 ? ? ? A . n A 1 218 LEU 218 218 ? ? ? A . n A 1 219 LEU 219 219 ? ? ? A . n A 1 220 ALA 220 220 ? ? ? A . n A 1 221 GLY 221 221 ? ? ? A . n A 1 222 LYS 222 222 ? ? ? A . n A 1 223 SER 223 223 ? ? ? A . n A 1 224 LYS 224 224 ? ? ? A . n A 1 225 ASP 225 225 ? ? ? A . n A 1 226 ILE 226 226 ? ? ? A . n A 1 227 ALA 227 227 ? ? ? A . n A 1 228 LEU 228 228 ? ? ? A . n A 1 229 HIS 229 229 ? ? ? A . n A 1 230 LEU 230 230 ? ? ? A . n A 1 231 ASN 231 231 ? ? ? A . n A 1 232 PRO 232 232 ? ? ? A . n A 1 233 ARG 233 233 ? ? ? A . n A 1 234 LEU 234 234 ? ? ? A . n A 1 235 ASN 235 235 ? ? ? A . n A 1 236 ILE 236 236 ? ? ? A . n A 1 237 LYS 237 237 ? ? ? A . n A 1 238 ALA 238 238 ? ? ? A . n A 1 239 PHE 239 239 ? ? ? A . n A 1 240 VAL 240 240 ? ? ? A . n A 1 241 ARG 241 241 ? ? ? A . n A 1 242 ASN 242 242 ? ? ? A . n A 1 243 SER 243 243 ? ? ? A . n A 1 244 PHE 244 244 ? ? ? A . n A 1 245 LEU 245 245 ? ? ? A . n A 1 246 GLN 246 246 ? ? ? A . n A 1 247 GLU 247 247 ? ? ? A . n A 1 248 SER 248 248 ? ? ? A . n A 1 249 TRP 249 249 ? ? ? A . n A 1 250 GLY 250 250 ? ? ? A . n A 1 251 GLU 251 251 ? ? ? A . n A 1 252 GLU 252 252 ? ? ? A . n A 1 253 GLU 253 253 ? ? ? A . n A 1 254 ARG 254 254 ? ? ? A . n A 1 255 ASN 255 255 ? ? ? A . n A 1 256 ILE 256 256 ? ? ? A . n A 1 257 THR 257 257 ? ? ? A . n A 1 258 SER 258 258 ? ? ? A . n A 1 259 PHE 259 259 ? ? ? A . n A 1 260 PRO 260 260 ? ? ? A . n A 1 261 PHE 261 261 ? ? ? A . n A 1 262 SER 262 262 ? ? ? A . n A 1 263 PRO 263 263 ? ? ? A . n A 1 264 GLY 264 264 ? ? ? A . n A 1 265 MET 265 265 ? ? ? A . n A 1 266 TYR 266 266 ? ? ? A . n A 1 267 PHE 267 267 ? ? ? A . n A 1 268 GLU 268 268 ? ? ? A . n A 1 269 MET 269 269 ? ? ? A . n A 1 270 ILE 270 270 ? ? ? A . n A 1 271 ILE 271 271 ? ? ? A . n A 1 272 TYR 272 272 ? ? ? A . n A 1 273 CYS 273 273 ? ? ? A . n A 1 274 ASP 274 274 ? ? ? A . n A 1 275 VAL 275 275 ? ? ? A . n A 1 276 ARG 276 276 ? ? ? A . n A 1 277 GLU 277 277 ? ? ? A . n A 1 278 PHE 278 278 ? ? ? A . n A 1 279 LYS 279 279 ? ? ? A . n A 1 280 VAL 280 280 ? ? ? A . n A 1 281 ALA 281 281 ? ? ? A . n A 1 282 VAL 282 282 ? ? ? A . n A 1 283 ASN 283 283 ? ? ? A . n A 1 284 GLY 284 284 ? ? ? A . n A 1 285 VAL 285 285 ? ? ? A . n A 1 286 HIS 286 286 ? ? ? A . n A 1 287 SER 287 287 ? ? ? A . n A 1 288 LEU 288 288 ? ? ? A . n A 1 289 GLU 289 289 ? ? ? A . n A 1 290 TYR 290 290 ? ? ? A . n A 1 291 LYS 291 291 ? ? ? A . n A 1 292 HIS 292 292 ? ? ? A . n A 1 293 ARG 293 293 ? ? ? A . n A 1 294 PHE 294 294 ? ? ? A . n A 1 295 LYS 295 295 ? ? ? A . n A 1 296 GLU 296 296 ? ? ? A . n A 1 297 LEU 297 297 ? ? ? A . n A 1 298 SER 298 298 ? ? ? A . n A 1 299 SER 299 299 ? ? ? A . n A 1 300 ILE 300 300 ? ? ? A . n A 1 301 ASP 301 301 ? ? ? A . n A 1 302 THR 302 302 ? ? ? A . n A 1 303 LEU 303 303 ? ? ? A . n A 1 304 GLU 304 304 ? ? ? A . n A 1 305 ILE 305 305 ? ? ? A . n A 1 306 ASN 306 306 ? ? ? A . n A 1 307 GLY 307 307 ? ? ? A . n A 1 308 ASP 308 308 ? ? ? A . n A 1 309 ILE 309 309 ? ? ? A . n A 1 310 HIS 310 310 ? ? ? A . n A 1 311 LEU 311 311 ? ? ? A . n A 1 312 LEU 312 312 ? ? ? A . n A 1 313 GLU 313 313 ? ? ? A . n A 1 314 VAL 314 314 ? ? ? A . n A 1 315 ARG 315 315 ? ? ? A . n A 1 316 SER 316 316 ? ? ? A . n A 1 317 TRP 317 317 ? ? ? A . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero B 2 GAL 1 B GAL 1 A TDG 201 n B 2 YIO 2 B YIO 2 A TDG 201 n # loop_ _pdbx_entity_instance_feature.ordinal _pdbx_entity_instance_feature.comp_id _pdbx_entity_instance_feature.asym_id _pdbx_entity_instance_feature.seq_num _pdbx_entity_instance_feature.auth_comp_id _pdbx_entity_instance_feature.auth_asym_id _pdbx_entity_instance_feature.auth_seq_num _pdbx_entity_instance_feature.feature_type _pdbx_entity_instance_feature.details 1 GAL ? ? GAL ? ? 'SUBJECT OF INVESTIGATION' ? 2 YIO ? ? YIO ? ? 'SUBJECT OF INVESTIGATION' ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 501 17 HOH HOH A . C 3 HOH 2 502 40 HOH HOH A . C 3 HOH 3 503 49 HOH HOH A . C 3 HOH 4 504 9 HOH HOH A . C 3 HOH 5 505 14 HOH HOH A . C 3 HOH 6 506 41 HOH HOH A . C 3 HOH 7 507 21 HOH HOH A . C 3 HOH 8 508 10 HOH HOH A . C 3 HOH 9 509 33 HOH HOH A . C 3 HOH 10 510 57 HOH HOH A . C 3 HOH 11 511 13 HOH HOH A . C 3 HOH 12 512 48 HOH HOH A . C 3 HOH 13 513 37 HOH HOH A . C 3 HOH 14 514 46 HOH HOH A . C 3 HOH 15 515 5 HOH HOH A . C 3 HOH 16 516 66 HOH HOH A . C 3 HOH 17 517 32 HOH HOH A . C 3 HOH 18 518 35 HOH HOH A . C 3 HOH 19 519 54 HOH HOH A . C 3 HOH 20 520 24 HOH HOH A . C 3 HOH 21 521 20 HOH HOH A . C 3 HOH 22 522 42 HOH HOH A . C 3 HOH 23 523 12 HOH HOH A . C 3 HOH 24 524 1 HOH HOH A . C 3 HOH 25 525 53 HOH HOH A . C 3 HOH 26 526 63 HOH HOH A . C 3 HOH 27 527 29 HOH HOH A . C 3 HOH 28 528 15 HOH HOH A . C 3 HOH 29 529 26 HOH HOH A . C 3 HOH 30 530 6 HOH HOH A . C 3 HOH 31 531 7 HOH HOH A . C 3 HOH 32 532 25 HOH HOH A . C 3 HOH 33 533 4 HOH HOH A . C 3 HOH 34 534 8 HOH HOH A . C 3 HOH 35 535 31 HOH HOH A . C 3 HOH 36 536 34 HOH HOH A . C 3 HOH 37 537 28 HOH HOH A . C 3 HOH 38 538 58 HOH HOH A . C 3 HOH 39 539 16 HOH HOH A . C 3 HOH 40 540 61 HOH HOH A . C 3 HOH 41 541 43 HOH HOH A . C 3 HOH 42 542 27 HOH HOH A . C 3 HOH 43 543 44 HOH HOH A . C 3 HOH 44 544 62 HOH HOH A . C 3 HOH 45 545 50 HOH HOH A . C 3 HOH 46 546 47 HOH HOH A . C 3 HOH 47 547 36 HOH HOH A . C 3 HOH 48 548 52 HOH HOH A . C 3 HOH 49 549 64 HOH HOH A . C 3 HOH 50 550 3 HOH HOH A . C 3 HOH 51 551 30 HOH HOH A . C 3 HOH 52 552 45 HOH HOH A . C 3 HOH 53 553 39 HOH HOH A . C 3 HOH 54 554 60 HOH HOH A . C 3 HOH 55 555 38 HOH HOH A . C 3 HOH 56 556 23 HOH HOH A . C 3 HOH 57 557 55 HOH HOH A . C 3 HOH 58 558 59 HOH HOH A . C 3 HOH 59 559 22 HOH HOH A . C 3 HOH 60 560 11 HOH HOH A . C 3 HOH 61 561 51 HOH HOH A . C 3 HOH 62 562 19 HOH HOH A . C 3 HOH 63 563 56 HOH HOH A . C 3 HOH 64 564 2 HOH HOH A . C 3 HOH 65 565 18 HOH HOH A . C 3 HOH 66 566 65 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 2.1_6048 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . ? 4 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 107.483 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 31NV _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.030 _cell.length_a_esd ? _cell.length_b 39.194 _cell.length_b_esd ? _cell.length_c 55.734 _cell.length_c_esd ? _cell.volume 122991.653 _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 31NV _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall 'C 2y' _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 31NV _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews ? _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol ? _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.6 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;Galecin-8N 10 mg/mL in PBS (pH 7.4) was mixed 1:1 with reservoir solution containing 0.1 M Tris/sodium citrate (pH 5.6), 20% (v/v) 2- propanol, 20 % (w/v) PEG4000 and 1 mM TDG. ; _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 289 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-03-14 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97626 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97626 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 'P13 (MX1)' _diffrn_source.pdbx_synchrotron_site 'PETRA III, EMBL c/o DESY' # _reflns.B_iso_Wilson_estimate 25.48 _reflns.entry_id 31NV _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.71 _reflns.d_resolution_low 60 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12509 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 6.8 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 6.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.973 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.214 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 1.71 _reflns_shell.d_res_low 1.74 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 573 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 6.5 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.503 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 84.1 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.306 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean 40.20 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 31NV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.71 _refine.ls_d_res_low 29.89 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12483 _refine.ls_number_reflns_R_free 615 _refine.ls_number_reflns_R_work 11868 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.55 _refine.ls_percent_reflns_R_free 4.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2432 _refine.ls_R_factor_R_free 0.2926 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2407 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'GeoStd + Monomer Library + CDL v1.2' _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1000 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.9124 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2282 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 1.71 _refine_hist.d_res_low 29.89 _refine_hist.number_atoms_solvent 66 _refine_hist.number_atoms_total 1264 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 1175 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 23 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.0039 ? 1250 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.7138 ? 1697 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.0561 ? 191 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.0061 ? 218 ? f_plane_restr ? ? ? 'X-RAY DIFFRACTION' ? 16.2832 ? 509 ? f_dihedral_angle_d ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 1.71 1.88 . . 152 2916 93.00 . . . . 0.3002 . . . . . . . . . . . . . . . 0.3207 'X-RAY DIFFRACTION' 1.88 2.15 . . 131 2919 92.45 . . . . 0.2749 . . . . . . . . . . . . . . . 0.2887 'X-RAY DIFFRACTION' 2.15 2.71 . . 166 3006 94.71 . . . . 0.2779 . . . . . . . . . . . . . . . 0.3343 'X-RAY DIFFRACTION' 2.71 29.89 . . 166 3027 93.99 . . . . 0.2125 . . . . . . . . . . . . . . . 0.2720 # _struct.entry_id 31NV _struct.title 'Crystal structure of the complex of galectin-8N-TDG' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 31NV _struct_keywords.text 'galectin-8N, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LEG8_HUMAN _struct_ref.pdbx_db_accession O00214 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNT LINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQST QASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFV RNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 31NV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 317 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O00214 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 317 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 317 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 350 ? 1 MORE 2 ? 1 'SSA (A^2)' 7580 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'gel filtration' _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 131 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ILE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 135 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 131 _struct_conf.end_auth_comp_id ILE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 135 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id GAL _struct_conn.ptnr1_label_seq_id . _struct_conn.ptnr1_label_atom_id C1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id YIO _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id S1 _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id B _struct_conn.ptnr1_auth_comp_id GAL _struct_conn.ptnr1_auth_seq_id 1 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id YIO _struct_conn.ptnr2_auth_seq_id 2 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.817 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ILE _struct_mon_prot_cis.label_seq_id 17 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ILE _struct_mon_prot_cis.auth_seq_id 17 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 18 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 18 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 5.87 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 6 ? AA3 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLN A 9 ? TYR A 13 ? GLN A 9 TYR A 13 AA1 2 ASN A 145 ? SER A 152 ? ASN A 145 SER A 152 AA1 3 LEU A 32 ? VAL A 39 ? LEU A 32 VAL A 39 AA1 4 LYS A 101 ? VAL A 109 ? LYS A 101 VAL A 109 AA1 5 LYS A 113 ? VAL A 118 ? LYS A 113 VAL A 118 AA1 6 LYS A 121 ? GLY A 127 ? LYS A 121 GLY A 127 AA2 1 PHE A 19 ? THR A 22 ? PHE A 19 THR A 22 AA2 2 THR A 137 ? GLY A 142 ? THR A 137 GLY A 142 AA2 3 PHE A 46 ? GLN A 51 ? PHE A 46 GLN A 51 AA2 4 VAL A 62 ? ARG A 69 ? VAL A 62 ARG A 69 AA2 5 CYS A 75 ? ILE A 82 ? CYS A 75 ILE A 82 AA2 6 LYS A 85 ? TRP A 86 ? LYS A 85 TRP A 86 AA3 1 PHE A 19 ? THR A 22 ? PHE A 19 THR A 22 AA3 2 THR A 137 ? GLY A 142 ? THR A 137 GLY A 142 AA3 3 PHE A 46 ? GLN A 51 ? PHE A 46 GLN A 51 AA3 4 VAL A 62 ? ARG A 69 ? VAL A 62 ARG A 69 AA3 5 CYS A 75 ? ILE A 82 ? CYS A 75 ILE A 82 AA3 6 GLU A 90 ? THR A 92 ? GLU A 90 THR A 92 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 12 ? N ILE A 12 O ILE A 149 ? O ILE A 149 AA1 2 3 O SER A 152 ? O SER A 152 N LEU A 32 ? N LEU A 32 AA1 3 4 N ILE A 35 ? N ILE A 35 O ILE A 105 ? O ILE A 105 AA1 4 5 N MET A 108 ? N MET A 108 O GLN A 115 ? O GLN A 115 AA1 5 6 N VAL A 116 ? N VAL A 116 O LEU A 124 ? O LEU A 124 AA2 1 2 N GLY A 21 ? N GLY A 21 O LEU A 138 ? O LEU A 138 AA2 2 3 O GLY A 139 ? O GLY A 139 N ASP A 49 ? N ASP A 49 AA2 3 4 N VAL A 48 ? N VAL A 48 O PHE A 66 ? O PHE A 66 AA2 4 5 N ARG A 69 ? N ARG A 69 O CYS A 75 ? O CYS A 75 AA2 5 6 N ILE A 82 ? N ILE A 82 O LYS A 85 ? O LYS A 85 AA3 1 2 N GLY A 21 ? N GLY A 21 O LEU A 138 ? O LEU A 138 AA3 2 3 O GLY A 139 ? O GLY A 139 N ASP A 49 ? N ASP A 49 AA3 3 4 N VAL A 48 ? N VAL A 48 O PHE A 66 ? O PHE A 66 AA3 4 5 N ARG A 69 ? N ARG A 69 O CYS A 75 ? O CYS A 75 AA3 5 6 N ILE A 76 ? N ILE A 76 O THR A 92 ? O THR A 92 # _pdbx_entry_details.entry_id 31NV _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 14 ? ? 39.93 52.21 2 1 ARG A 72 ? ? 63.89 -141.47 3 1 SER A 152 ? ? -167.20 117.59 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 560 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id C _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _space_group_symop.id _space_group_symop.operation_xyz 1 x,y,z 2 -x,y,-z 3 x+1/2,y+1/2,z 4 -x+1/2,y+1/2,-z # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 14.680751654006237 _pdbx_refine_tls.origin_y 5.583287154438007 _pdbx_refine_tls.origin_z 11.98281151089597 _pdbx_refine_tls.T[1][1] 0.4350077185523569 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.047642404028680835 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.08932616676634925 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.31405461321022615 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.01221296520077033 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] -0.03497077072114251 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.7121522042508714 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.18894067981696333 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.8474118980459493 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 4.144591181369714 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -1.4335857865633441 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 4.9888266151268725 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.08606345081976956 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] 0.19701519260273118 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.08236961013383853 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.5581346777562503 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.04377717353836726 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] 0.06866100946529519 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.2871363398847437 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.08261141575624883 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0868294586975914 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id A _pdbx_refine_tls_group.beg_label_seq_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 8 _pdbx_refine_tls_group.beg_PDB_ins_code ? _pdbx_refine_tls_group.end_label_asym_id A _pdbx_refine_tls_group.end_label_seq_id 147 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 154 _pdbx_refine_tls_group.end_PDB_ins_code ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '(chain A and resseq 8:154)' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A MET 2 ? A MET 2 3 1 Y 1 A LEU 3 ? A LEU 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A LEU 5 ? A LEU 5 6 1 Y 1 A ASN 6 ? A ASN 6 7 1 Y 1 A ASN 7 ? A ASN 7 8 1 Y 1 A SER 155 ? A SER 155 9 1 Y 1 A ASP 156 ? A ASP 156 10 1 Y 1 A LEU 157 ? A LEU 157 11 1 Y 1 A GLN 158 ? A GLN 158 12 1 Y 1 A SER 159 ? A SER 159 13 1 Y 1 A THR 160 ? A THR 160 14 1 Y 1 A GLN 161 ? A GLN 161 15 1 Y 1 A ALA 162 ? A ALA 162 16 1 Y 1 A SER 163 ? A SER 163 17 1 Y 1 A SER 164 ? A SER 164 18 1 Y 1 A LEU 165 ? A LEU 165 19 1 Y 1 A GLU 166 ? A GLU 166 20 1 Y 1 A LEU 167 ? A LEU 167 21 1 Y 1 A THR 168 ? A THR 168 22 1 Y 1 A GLU 169 ? A GLU 169 23 1 Y 1 A ILE 170 ? A ILE 170 24 1 Y 1 A SER 171 ? A SER 171 25 1 Y 1 A ARG 172 ? A ARG 172 26 1 Y 1 A GLU 173 ? A GLU 173 27 1 Y 1 A ASN 174 ? A ASN 174 28 1 Y 1 A VAL 175 ? A VAL 175 29 1 Y 1 A PRO 176 ? A PRO 176 30 1 Y 1 A LYS 177 ? A LYS 177 31 1 Y 1 A SER 178 ? A SER 178 32 1 Y 1 A GLY 179 ? A GLY 179 33 1 Y 1 A THR 180 ? A THR 180 34 1 Y 1 A PRO 181 ? A PRO 181 35 1 Y 1 A GLN 182 ? A GLN 182 36 1 Y 1 A LEU 183 ? A LEU 183 37 1 Y 1 A ARG 184 ? A ARG 184 38 1 Y 1 A LEU 185 ? A LEU 185 39 1 Y 1 A PRO 186 ? A PRO 186 40 1 Y 1 A PHE 187 ? A PHE 187 41 1 Y 1 A ALA 188 ? A ALA 188 42 1 Y 1 A ALA 189 ? A ALA 189 43 1 Y 1 A ARG 190 ? A ARG 190 44 1 Y 1 A LEU 191 ? A LEU 191 45 1 Y 1 A ASN 192 ? A ASN 192 46 1 Y 1 A THR 193 ? A THR 193 47 1 Y 1 A PRO 194 ? A PRO 194 48 1 Y 1 A MET 195 ? A MET 195 49 1 Y 1 A GLY 196 ? A GLY 196 50 1 Y 1 A PRO 197 ? A PRO 197 51 1 Y 1 A GLY 198 ? A GLY 198 52 1 Y 1 A ARG 199 ? A ARG 199 53 1 Y 1 A THR 200 ? A THR 200 54 1 Y 1 A VAL 201 ? A VAL 201 55 1 Y 1 A VAL 202 ? A VAL 202 56 1 Y 1 A VAL 203 ? A VAL 203 57 1 Y 1 A LYS 204 ? A LYS 204 58 1 Y 1 A GLY 205 ? A GLY 205 59 1 Y 1 A GLU 206 ? A GLU 206 60 1 Y 1 A VAL 207 ? A VAL 207 61 1 Y 1 A ASN 208 ? A ASN 208 62 1 Y 1 A ALA 209 ? A ALA 209 63 1 Y 1 A ASN 210 ? A ASN 210 64 1 Y 1 A ALA 211 ? A ALA 211 65 1 Y 1 A LYS 212 ? A LYS 212 66 1 Y 1 A SER 213 ? A SER 213 67 1 Y 1 A PHE 214 ? A PHE 214 68 1 Y 1 A ASN 215 ? A ASN 215 69 1 Y 1 A VAL 216 ? A VAL 216 70 1 Y 1 A ASP 217 ? A ASP 217 71 1 Y 1 A LEU 218 ? A LEU 218 72 1 Y 1 A LEU 219 ? A LEU 219 73 1 Y 1 A ALA 220 ? A ALA 220 74 1 Y 1 A GLY 221 ? A GLY 221 75 1 Y 1 A LYS 222 ? A LYS 222 76 1 Y 1 A SER 223 ? A SER 223 77 1 Y 1 A LYS 224 ? A LYS 224 78 1 Y 1 A ASP 225 ? A ASP 225 79 1 Y 1 A ILE 226 ? A ILE 226 80 1 Y 1 A ALA 227 ? A ALA 227 81 1 Y 1 A LEU 228 ? A LEU 228 82 1 Y 1 A HIS 229 ? A HIS 229 83 1 Y 1 A LEU 230 ? A LEU 230 84 1 Y 1 A ASN 231 ? A ASN 231 85 1 Y 1 A PRO 232 ? A PRO 232 86 1 Y 1 A ARG 233 ? A ARG 233 87 1 Y 1 A LEU 234 ? A LEU 234 88 1 Y 1 A ASN 235 ? A ASN 235 89 1 Y 1 A ILE 236 ? A ILE 236 90 1 Y 1 A LYS 237 ? A LYS 237 91 1 Y 1 A ALA 238 ? A ALA 238 92 1 Y 1 A PHE 239 ? A PHE 239 93 1 Y 1 A VAL 240 ? A VAL 240 94 1 Y 1 A ARG 241 ? A ARG 241 95 1 Y 1 A ASN 242 ? A ASN 242 96 1 Y 1 A SER 243 ? A SER 243 97 1 Y 1 A PHE 244 ? A PHE 244 98 1 Y 1 A LEU 245 ? A LEU 245 99 1 Y 1 A GLN 246 ? A GLN 246 100 1 Y 1 A GLU 247 ? A GLU 247 101 1 Y 1 A SER 248 ? A SER 248 102 1 Y 1 A TRP 249 ? A TRP 249 103 1 Y 1 A GLY 250 ? A GLY 250 104 1 Y 1 A GLU 251 ? A GLU 251 105 1 Y 1 A GLU 252 ? A GLU 252 106 1 Y 1 A GLU 253 ? A GLU 253 107 1 Y 1 A ARG 254 ? A ARG 254 108 1 Y 1 A ASN 255 ? A ASN 255 109 1 Y 1 A ILE 256 ? A ILE 256 110 1 Y 1 A THR 257 ? A THR 257 111 1 Y 1 A SER 258 ? A SER 258 112 1 Y 1 A PHE 259 ? A PHE 259 113 1 Y 1 A PRO 260 ? A PRO 260 114 1 Y 1 A PHE 261 ? A PHE 261 115 1 Y 1 A SER 262 ? A SER 262 116 1 Y 1 A PRO 263 ? A PRO 263 117 1 Y 1 A GLY 264 ? A GLY 264 118 1 Y 1 A MET 265 ? A MET 265 119 1 Y 1 A TYR 266 ? A TYR 266 120 1 Y 1 A PHE 267 ? A PHE 267 121 1 Y 1 A GLU 268 ? A GLU 268 122 1 Y 1 A MET 269 ? A MET 269 123 1 Y 1 A ILE 270 ? A ILE 270 124 1 Y 1 A ILE 271 ? A ILE 271 125 1 Y 1 A TYR 272 ? A TYR 272 126 1 Y 1 A CYS 273 ? A CYS 273 127 1 Y 1 A ASP 274 ? A ASP 274 128 1 Y 1 A VAL 275 ? A VAL 275 129 1 Y 1 A ARG 276 ? A ARG 276 130 1 Y 1 A GLU 277 ? A GLU 277 131 1 Y 1 A PHE 278 ? A PHE 278 132 1 Y 1 A LYS 279 ? A LYS 279 133 1 Y 1 A VAL 280 ? A VAL 280 134 1 Y 1 A ALA 281 ? A ALA 281 135 1 Y 1 A VAL 282 ? A VAL 282 136 1 Y 1 A ASN 283 ? A ASN 283 137 1 Y 1 A GLY 284 ? A GLY 284 138 1 Y 1 A VAL 285 ? A VAL 285 139 1 Y 1 A HIS 286 ? A HIS 286 140 1 Y 1 A SER 287 ? A SER 287 141 1 Y 1 A LEU 288 ? A LEU 288 142 1 Y 1 A GLU 289 ? A GLU 289 143 1 Y 1 A TYR 290 ? A TYR 290 144 1 Y 1 A LYS 291 ? A LYS 291 145 1 Y 1 A HIS 292 ? A HIS 292 146 1 Y 1 A ARG 293 ? A ARG 293 147 1 Y 1 A PHE 294 ? A PHE 294 148 1 Y 1 A LYS 295 ? A LYS 295 149 1 Y 1 A GLU 296 ? A GLU 296 150 1 Y 1 A LEU 297 ? A LEU 297 151 1 Y 1 A SER 298 ? A SER 298 152 1 Y 1 A SER 299 ? A SER 299 153 1 Y 1 A ILE 300 ? A ILE 300 154 1 Y 1 A ASP 301 ? A ASP 301 155 1 Y 1 A THR 302 ? A THR 302 156 1 Y 1 A LEU 303 ? A LEU 303 157 1 Y 1 A GLU 304 ? A GLU 304 158 1 Y 1 A ILE 305 ? A ILE 305 159 1 Y 1 A ASN 306 ? A ASN 306 160 1 Y 1 A GLY 307 ? A GLY 307 161 1 Y 1 A ASP 308 ? A ASP 308 162 1 Y 1 A ILE 309 ? A ILE 309 163 1 Y 1 A HIS 310 ? A HIS 310 164 1 Y 1 A LEU 311 ? A LEU 311 165 1 Y 1 A LEU 312 ? A LEU 312 166 1 Y 1 A GLU 313 ? A GLU 313 167 1 Y 1 A VAL 314 ? A VAL 314 168 1 Y 1 A ARG 315 ? A ARG 315 169 1 Y 1 A SER 316 ? A SER 316 170 1 Y 1 A TRP 317 ? A TRP 317 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GAL C1 C N R 88 GAL C2 C N R 89 GAL C3 C N S 90 GAL C4 C N R 91 GAL C5 C N R 92 GAL C6 C N N 93 GAL O1 O N N 94 GAL O2 O N N 95 GAL O3 O N N 96 GAL O4 O N N 97 GAL O5 O N N 98 GAL O6 O N N 99 GAL H1 H N N 100 GAL H2 H N N 101 GAL H3 H N N 102 GAL H4 H N N 103 GAL H5 H N N 104 GAL H61 H N N 105 GAL H62 H N N 106 GAL HO1 H N N 107 GAL HO2 H N N 108 GAL HO3 H N N 109 GAL HO4 H N N 110 GAL HO6 H N N 111 GLN N N N N 112 GLN CA C N S 113 GLN C C N N 114 GLN O O N N 115 GLN CB C N N 116 GLN CG C N N 117 GLN CD C N N 118 GLN OE1 O N N 119 GLN NE2 N N N 120 GLN OXT O N N 121 GLN H H N N 122 GLN H2 H N N 123 GLN HA H N N 124 GLN HB2 H N N 125 GLN HB3 H N N 126 GLN HG2 H N N 127 GLN HG3 H N N 128 GLN HE21 H N N 129 GLN HE22 H N N 130 GLN HXT H N N 131 GLU N N N N 132 GLU CA C N S 133 GLU C C N N 134 GLU O O N N 135 GLU CB C N N 136 GLU CG C N N 137 GLU CD C N N 138 GLU OE1 O N N 139 GLU OE2 O N N 140 GLU OXT O N N 141 GLU H H N N 142 GLU H2 H N N 143 GLU HA H N N 144 GLU HB2 H N N 145 GLU HB3 H N N 146 GLU HG2 H N N 147 GLU HG3 H N N 148 GLU HE2 H N N 149 GLU HXT H N N 150 GLY N N N N 151 GLY CA C N N 152 GLY C C N N 153 GLY O O N N 154 GLY OXT O N N 155 GLY H H N N 156 GLY H2 H N N 157 GLY HA2 H N N 158 GLY HA3 H N N 159 GLY HXT H N N 160 HIS N N N N 161 HIS CA C N S 162 HIS C C N N 163 HIS O O N N 164 HIS CB C N N 165 HIS CG C Y N 166 HIS ND1 N Y N 167 HIS CD2 C Y N 168 HIS CE1 C Y N 169 HIS NE2 N Y N 170 HIS OXT O N N 171 HIS H H N N 172 HIS H2 H N N 173 HIS HA H N N 174 HIS HB2 H N N 175 HIS HB3 H N N 176 HIS HD1 H N N 177 HIS HD2 H N N 178 HIS HE1 H N N 179 HIS HE2 H N N 180 HIS HXT H N N 181 HOH O O N N 182 HOH H1 H N N 183 HOH H2 H N N 184 ILE N N N N 185 ILE CA C N S 186 ILE C C N N 187 ILE O O N N 188 ILE CB C N S 189 ILE CG1 C N N 190 ILE CG2 C N N 191 ILE CD1 C N N 192 ILE OXT O N N 193 ILE H H N N 194 ILE H2 H N N 195 ILE HA H N N 196 ILE HB H N N 197 ILE HG12 H N N 198 ILE HG13 H N N 199 ILE HG21 H N N 200 ILE HG22 H N N 201 ILE HG23 H N N 202 ILE HD11 H N N 203 ILE HD12 H N N 204 ILE HD13 H N N 205 ILE HXT H N N 206 LEU N N N N 207 LEU CA C N S 208 LEU C C N N 209 LEU O O N N 210 LEU CB C N N 211 LEU CG C N N 212 LEU CD1 C N N 213 LEU CD2 C N N 214 LEU OXT O N N 215 LEU H H N N 216 LEU H2 H N N 217 LEU HA H N N 218 LEU HB2 H N N 219 LEU HB3 H N N 220 LEU HG H N N 221 LEU HD11 H N N 222 LEU HD12 H N N 223 LEU HD13 H N N 224 LEU HD21 H N N 225 LEU HD22 H N N 226 LEU HD23 H N N 227 LEU HXT H N N 228 LYS N N N N 229 LYS CA C N S 230 LYS C C N N 231 LYS O O N N 232 LYS CB C N N 233 LYS CG C N N 234 LYS CD C N N 235 LYS CE C N N 236 LYS NZ N N N 237 LYS OXT O N N 238 LYS H H N N 239 LYS H2 H N N 240 LYS HA H N N 241 LYS HB2 H N N 242 LYS HB3 H N N 243 LYS HG2 H N N 244 LYS HG3 H N N 245 LYS HD2 H N N 246 LYS HD3 H N N 247 LYS HE2 H N N 248 LYS HE3 H N N 249 LYS HZ1 H N N 250 LYS HZ2 H N N 251 LYS HZ3 H N N 252 LYS HXT H N N 253 MET N N N N 254 MET CA C N S 255 MET C C N N 256 MET O O N N 257 MET CB C N N 258 MET CG C N N 259 MET SD S N N 260 MET CE C N N 261 MET OXT O N N 262 MET H H N N 263 MET H2 H N N 264 MET HA H N N 265 MET HB2 H N N 266 MET HB3 H N N 267 MET HG2 H N N 268 MET HG3 H N N 269 MET HE1 H N N 270 MET HE2 H N N 271 MET HE3 H N N 272 MET HXT H N N 273 PHE N N N N 274 PHE CA C N S 275 PHE C C N N 276 PHE O O N N 277 PHE CB C N N 278 PHE CG C Y N 279 PHE CD1 C Y N 280 PHE CD2 C Y N 281 PHE CE1 C Y N 282 PHE CE2 C Y N 283 PHE CZ C Y N 284 PHE OXT O N N 285 PHE H H N N 286 PHE H2 H N N 287 PHE HA H N N 288 PHE HB2 H N N 289 PHE HB3 H N N 290 PHE HD1 H N N 291 PHE HD2 H N N 292 PHE HE1 H N N 293 PHE HE2 H N N 294 PHE HZ H N N 295 PHE HXT H N N 296 PRO N N N N 297 PRO CA C N S 298 PRO C C N N 299 PRO O O N N 300 PRO CB C N N 301 PRO CG C N N 302 PRO CD C N N 303 PRO OXT O N N 304 PRO H H N N 305 PRO HA H N N 306 PRO HB2 H N N 307 PRO HB3 H N N 308 PRO HG2 H N N 309 PRO HG3 H N N 310 PRO HD2 H N N 311 PRO HD3 H N N 312 PRO HXT H N N 313 SER N N N N 314 SER CA C N S 315 SER C C N N 316 SER O O N N 317 SER CB C N N 318 SER OG O N N 319 SER OXT O N N 320 SER H H N N 321 SER H2 H N N 322 SER HA H N N 323 SER HB2 H N N 324 SER HB3 H N N 325 SER HG H N N 326 SER HXT H N N 327 THR N N N N 328 THR CA C N S 329 THR C C N N 330 THR O O N N 331 THR CB C N R 332 THR OG1 O N N 333 THR CG2 C N N 334 THR OXT O N N 335 THR H H N N 336 THR H2 H N N 337 THR HA H N N 338 THR HB H N N 339 THR HG1 H N N 340 THR HG21 H N N 341 THR HG22 H N N 342 THR HG23 H N N 343 THR HXT H N N 344 TRP N N N N 345 TRP CA C N S 346 TRP C C N N 347 TRP O O N N 348 TRP CB C N N 349 TRP CG C Y N 350 TRP CD1 C Y N 351 TRP CD2 C Y N 352 TRP NE1 N Y N 353 TRP CE2 C Y N 354 TRP CE3 C Y N 355 TRP CZ2 C Y N 356 TRP CZ3 C Y N 357 TRP CH2 C Y N 358 TRP OXT O N N 359 TRP H H N N 360 TRP H2 H N N 361 TRP HA H N N 362 TRP HB2 H N N 363 TRP HB3 H N N 364 TRP HD1 H N N 365 TRP HE1 H N N 366 TRP HE3 H N N 367 TRP HZ2 H N N 368 TRP HZ3 H N N 369 TRP HH2 H N N 370 TRP HXT H N N 371 TYR N N N N 372 TYR CA C N S 373 TYR C C N N 374 TYR O O N N 375 TYR CB C N N 376 TYR CG C Y N 377 TYR CD1 C Y N 378 TYR CD2 C Y N 379 TYR CE1 C Y N 380 TYR CE2 C Y N 381 TYR CZ C Y N 382 TYR OH O N N 383 TYR OXT O N N 384 TYR H H N N 385 TYR H2 H N N 386 TYR HA H N N 387 TYR HB2 H N N 388 TYR HB3 H N N 389 TYR HD1 H N N 390 TYR HD2 H N N 391 TYR HE1 H N N 392 TYR HE2 H N N 393 TYR HH H N N 394 TYR HXT H N N 395 VAL N N N N 396 VAL CA C N S 397 VAL C C N N 398 VAL O O N N 399 VAL CB C N N 400 VAL CG1 C N N 401 VAL CG2 C N N 402 VAL OXT O N N 403 VAL H H N N 404 VAL H2 H N N 405 VAL HA H N N 406 VAL HB H N N 407 VAL HG11 H N N 408 VAL HG12 H N N 409 VAL HG13 H N N 410 VAL HG21 H N N 411 VAL HG22 H N N 412 VAL HG23 H N N 413 VAL HXT H N N 414 YIO C1 C N S 415 YIO C2 C N R 416 YIO C3 C N S 417 YIO C4 C N R 418 YIO C5 C N R 419 YIO C6 C N N 420 YIO O2 O N N 421 YIO O3 O N N 422 YIO O4 O N N 423 YIO O5 O N N 424 YIO O6 O N N 425 YIO S1 S N N 426 YIO H1 H N N 427 YIO H2 H N N 428 YIO H3 H N N 429 YIO HO2 H N N 430 YIO H4 H N N 431 YIO HO3 H N N 432 YIO H5 H N N 433 YIO HO4 H N N 434 YIO H61 H N N 435 YIO H62 H N N 436 YIO HO6 H N N 437 YIO HS1 H N N 438 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GAL C1 C2 sing N N 83 GAL C1 O1 sing N N 84 GAL C1 O5 sing N N 85 GAL C1 H1 sing N N 86 GAL C2 C3 sing N N 87 GAL C2 O2 sing N N 88 GAL C2 H2 sing N N 89 GAL C3 C4 sing N N 90 GAL C3 O3 sing N N 91 GAL C3 H3 sing N N 92 GAL C4 C5 sing N N 93 GAL C4 O4 sing N N 94 GAL C4 H4 sing N N 95 GAL C5 C6 sing N N 96 GAL C5 O5 sing N N 97 GAL C5 H5 sing N N 98 GAL C6 O6 sing N N 99 GAL C6 H61 sing N N 100 GAL C6 H62 sing N N 101 GAL O1 HO1 sing N N 102 GAL O2 HO2 sing N N 103 GAL O3 HO3 sing N N 104 GAL O4 HO4 sing N N 105 GAL O6 HO6 sing N N 106 GLN N CA sing N N 107 GLN N H sing N N 108 GLN N H2 sing N N 109 GLN CA C sing N N 110 GLN CA CB sing N N 111 GLN CA HA sing N N 112 GLN C O doub N N 113 GLN C OXT sing N N 114 GLN CB CG sing N N 115 GLN CB HB2 sing N N 116 GLN CB HB3 sing N N 117 GLN CG CD sing N N 118 GLN CG HG2 sing N N 119 GLN CG HG3 sing N N 120 GLN CD OE1 doub N N 121 GLN CD NE2 sing N N 122 GLN NE2 HE21 sing N N 123 GLN NE2 HE22 sing N N 124 GLN OXT HXT sing N N 125 GLU N CA sing N N 126 GLU N H sing N N 127 GLU N H2 sing N N 128 GLU CA C sing N N 129 GLU CA CB sing N N 130 GLU CA HA sing N N 131 GLU C O doub N N 132 GLU C OXT sing N N 133 GLU CB CG sing N N 134 GLU CB HB2 sing N N 135 GLU CB HB3 sing N N 136 GLU CG CD sing N N 137 GLU CG HG2 sing N N 138 GLU CG HG3 sing N N 139 GLU CD OE1 doub N N 140 GLU CD OE2 sing N N 141 GLU OE2 HE2 sing N N 142 GLU OXT HXT sing N N 143 GLY N CA sing N N 144 GLY N H sing N N 145 GLY N H2 sing N N 146 GLY CA C sing N N 147 GLY CA HA2 sing N N 148 GLY CA HA3 sing N N 149 GLY C O doub N N 150 GLY C OXT sing N N 151 GLY OXT HXT sing N N 152 HIS N CA sing N N 153 HIS N H sing N N 154 HIS N H2 sing N N 155 HIS CA C sing N N 156 HIS CA CB sing N N 157 HIS CA HA sing N N 158 HIS C O doub N N 159 HIS C OXT sing N N 160 HIS CB CG sing N N 161 HIS CB HB2 sing N N 162 HIS CB HB3 sing N N 163 HIS CG ND1 sing Y N 164 HIS CG CD2 doub Y N 165 HIS ND1 CE1 doub Y N 166 HIS ND1 HD1 sing N N 167 HIS CD2 NE2 sing Y N 168 HIS CD2 HD2 sing N N 169 HIS CE1 NE2 sing Y N 170 HIS CE1 HE1 sing N N 171 HIS NE2 HE2 sing N N 172 HIS OXT HXT sing N N 173 HOH O H1 sing N N 174 HOH O H2 sing N N 175 ILE N CA sing N N 176 ILE N H sing N N 177 ILE N H2 sing N N 178 ILE CA C sing N N 179 ILE CA CB sing N N 180 ILE CA HA sing N N 181 ILE C O doub N N 182 ILE C OXT sing N N 183 ILE CB CG1 sing N N 184 ILE CB CG2 sing N N 185 ILE CB HB sing N N 186 ILE CG1 CD1 sing N N 187 ILE CG1 HG12 sing N N 188 ILE CG1 HG13 sing N N 189 ILE CG2 HG21 sing N N 190 ILE CG2 HG22 sing N N 191 ILE CG2 HG23 sing N N 192 ILE CD1 HD11 sing N N 193 ILE CD1 HD12 sing N N 194 ILE CD1 HD13 sing N N 195 ILE OXT HXT sing N N 196 LEU N CA sing N N 197 LEU N H sing N N 198 LEU N H2 sing N N 199 LEU CA C sing N N 200 LEU CA CB sing N N 201 LEU CA HA sing N N 202 LEU C O doub N N 203 LEU C OXT sing N N 204 LEU CB CG sing N N 205 LEU CB HB2 sing N N 206 LEU CB HB3 sing N N 207 LEU CG CD1 sing N N 208 LEU CG CD2 sing N N 209 LEU CG HG sing N N 210 LEU CD1 HD11 sing N N 211 LEU CD1 HD12 sing N N 212 LEU CD1 HD13 sing N N 213 LEU CD2 HD21 sing N N 214 LEU CD2 HD22 sing N N 215 LEU CD2 HD23 sing N N 216 LEU OXT HXT sing N N 217 LYS N CA sing N N 218 LYS N H sing N N 219 LYS N H2 sing N N 220 LYS CA C sing N N 221 LYS CA CB sing N N 222 LYS CA HA sing N N 223 LYS C O doub N N 224 LYS C OXT sing N N 225 LYS CB CG sing N N 226 LYS CB HB2 sing N N 227 LYS CB HB3 sing N N 228 LYS CG CD sing N N 229 LYS CG HG2 sing N N 230 LYS CG HG3 sing N N 231 LYS CD CE sing N N 232 LYS CD HD2 sing N N 233 LYS CD HD3 sing N N 234 LYS CE NZ sing N N 235 LYS CE HE2 sing N N 236 LYS CE HE3 sing N N 237 LYS NZ HZ1 sing N N 238 LYS NZ HZ2 sing N N 239 LYS NZ HZ3 sing N N 240 LYS OXT HXT sing N N 241 MET N CA sing N N 242 MET N H sing N N 243 MET N H2 sing N N 244 MET CA C sing N N 245 MET CA CB sing N N 246 MET CA HA sing N N 247 MET C O doub N N 248 MET C OXT sing N N 249 MET CB CG sing N N 250 MET CB HB2 sing N N 251 MET CB HB3 sing N N 252 MET CG SD sing N N 253 MET CG HG2 sing N N 254 MET CG HG3 sing N N 255 MET SD CE sing N N 256 MET CE HE1 sing N N 257 MET CE HE2 sing N N 258 MET CE HE3 sing N N 259 MET OXT HXT sing N N 260 PHE N CA sing N N 261 PHE N H sing N N 262 PHE N H2 sing N N 263 PHE CA C sing N N 264 PHE CA CB sing N N 265 PHE CA HA sing N N 266 PHE C O doub N N 267 PHE C OXT sing N N 268 PHE CB CG sing N N 269 PHE CB HB2 sing N N 270 PHE CB HB3 sing N N 271 PHE CG CD1 doub Y N 272 PHE CG CD2 sing Y N 273 PHE CD1 CE1 sing Y N 274 PHE CD1 HD1 sing N N 275 PHE CD2 CE2 doub Y N 276 PHE CD2 HD2 sing N N 277 PHE CE1 CZ doub Y N 278 PHE CE1 HE1 sing N N 279 PHE CE2 CZ sing Y N 280 PHE CE2 HE2 sing N N 281 PHE CZ HZ sing N N 282 PHE OXT HXT sing N N 283 PRO N CA sing N N 284 PRO N CD sing N N 285 PRO N H sing N N 286 PRO CA C sing N N 287 PRO CA CB sing N N 288 PRO CA HA sing N N 289 PRO C O doub N N 290 PRO C OXT sing N N 291 PRO CB CG sing N N 292 PRO CB HB2 sing N N 293 PRO CB HB3 sing N N 294 PRO CG CD sing N N 295 PRO CG HG2 sing N N 296 PRO CG HG3 sing N N 297 PRO CD HD2 sing N N 298 PRO CD HD3 sing N N 299 PRO OXT HXT sing N N 300 SER N CA sing N N 301 SER N H sing N N 302 SER N H2 sing N N 303 SER CA C sing N N 304 SER CA CB sing N N 305 SER CA HA sing N N 306 SER C O doub N N 307 SER C OXT sing N N 308 SER CB OG sing N N 309 SER CB HB2 sing N N 310 SER CB HB3 sing N N 311 SER OG HG sing N N 312 SER OXT HXT sing N N 313 THR N CA sing N N 314 THR N H sing N N 315 THR N H2 sing N N 316 THR CA C sing N N 317 THR CA CB sing N N 318 THR CA HA sing N N 319 THR C O doub N N 320 THR C OXT sing N N 321 THR CB OG1 sing N N 322 THR CB CG2 sing N N 323 THR CB HB sing N N 324 THR OG1 HG1 sing N N 325 THR CG2 HG21 sing N N 326 THR CG2 HG22 sing N N 327 THR CG2 HG23 sing N N 328 THR OXT HXT sing N N 329 TRP N CA sing N N 330 TRP N H sing N N 331 TRP N H2 sing N N 332 TRP CA C sing N N 333 TRP CA CB sing N N 334 TRP CA HA sing N N 335 TRP C O doub N N 336 TRP C OXT sing N N 337 TRP CB CG sing N N 338 TRP CB HB2 sing N N 339 TRP CB HB3 sing N N 340 TRP CG CD1 doub Y N 341 TRP CG CD2 sing Y N 342 TRP CD1 NE1 sing Y N 343 TRP CD1 HD1 sing N N 344 TRP CD2 CE2 doub Y N 345 TRP CD2 CE3 sing Y N 346 TRP NE1 CE2 sing Y N 347 TRP NE1 HE1 sing N N 348 TRP CE2 CZ2 sing Y N 349 TRP CE3 CZ3 doub Y N 350 TRP CE3 HE3 sing N N 351 TRP CZ2 CH2 doub Y N 352 TRP CZ2 HZ2 sing N N 353 TRP CZ3 CH2 sing Y N 354 TRP CZ3 HZ3 sing N N 355 TRP CH2 HH2 sing N N 356 TRP OXT HXT sing N N 357 TYR N CA sing N N 358 TYR N H sing N N 359 TYR N H2 sing N N 360 TYR CA C sing N N 361 TYR CA CB sing N N 362 TYR CA HA sing N N 363 TYR C O doub N N 364 TYR C OXT sing N N 365 TYR CB CG sing N N 366 TYR CB HB2 sing N N 367 TYR CB HB3 sing N N 368 TYR CG CD1 doub Y N 369 TYR CG CD2 sing Y N 370 TYR CD1 CE1 sing Y N 371 TYR CD1 HD1 sing N N 372 TYR CD2 CE2 doub Y N 373 TYR CD2 HD2 sing N N 374 TYR CE1 CZ doub Y N 375 TYR CE1 HE1 sing N N 376 TYR CE2 CZ sing Y N 377 TYR CE2 HE2 sing N N 378 TYR CZ OH sing N N 379 TYR OH HH sing N N 380 TYR OXT HXT sing N N 381 VAL N CA sing N N 382 VAL N H sing N N 383 VAL N H2 sing N N 384 VAL CA C sing N N 385 VAL CA CB sing N N 386 VAL CA HA sing N N 387 VAL C O doub N N 388 VAL C OXT sing N N 389 VAL CB CG1 sing N N 390 VAL CB CG2 sing N N 391 VAL CB HB sing N N 392 VAL CG1 HG11 sing N N 393 VAL CG1 HG12 sing N N 394 VAL CG1 HG13 sing N N 395 VAL CG2 HG21 sing N N 396 VAL CG2 HG22 sing N N 397 VAL CG2 HG23 sing N N 398 VAL OXT HXT sing N N 399 YIO C1 C2 sing N N 400 YIO C1 O5 sing N N 401 YIO C1 S1 sing N N 402 YIO C2 C3 sing N N 403 YIO C2 O2 sing N N 404 YIO C3 C4 sing N N 405 YIO C3 O3 sing N N 406 YIO C4 C5 sing N N 407 YIO C4 O4 sing N N 408 YIO C5 C6 sing N N 409 YIO C5 O5 sing N N 410 YIO C6 O6 sing N N 411 YIO C1 H1 sing N N 412 YIO C2 H2 sing N N 413 YIO C3 H3 sing N N 414 YIO O2 HO2 sing N N 415 YIO C4 H4 sing N N 416 YIO O3 HO3 sing N N 417 YIO C5 H5 sing N N 418 YIO O4 HO4 sing N N 419 YIO C6 H61 sing N N 420 YIO C6 H62 sing N N 421 YIO S1 HS1 sing N N 422 YIO O6 HO6 sing N N 423 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 GAL 1 n 2 YIO 2 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 5T7S _pdbx_initial_refinement_model.details ? # _space_group.crystal_system monoclinic _space_group.IT_number 5 _space_group.name_H-M_alt 'C 1 2 1' _space_group.name_Hall 'C 2y' _space_group.id 1 # _atom_sites.entry_id 31NV _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.016941 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.005336 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025514 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018811 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.scat_dispersion_real _atom_type.scat_dispersion_imag _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c _atom_type.scat_source _atom_type.scat_dispersion_source C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? N ? ? 4.01032 2.96436 ? ? 19.97189 1.75589 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? O ? ? 4.49882 3.47563 ? ? 15.80542 1.70748 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? S ? ? 9.55732 6.39887 ? ? 1.23737 29.19336 ? ? 0.0 ;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31. ; ? # loop_ # loop_ #