data_31DC # _entry.id 31DC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.416 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 31DC pdb_000031dc 10.2210/pdb31dc/pdb WWPDB D_1292157373 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date _pdbx_audit_revision_history.part_number 1 'Structure model' 1 0 2026-08-19 ? 2 'Structure model' 1 1 2026-08-26 ? 3 'Structure model' 1 2 2026-09-02 ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' citation # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_ASTM' 4 2 'Structure model' '_citation.journal_id_CSD' 5 2 'Structure model' '_citation.journal_id_ISSN' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_citation_author.identifier_ORCID' 13 3 'Structure model' '_citation.journal_volume' 14 3 'Structure model' '_citation.title' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 31DC _pdbx_database_status.recvd_initial_deposition_date 2026-05-27 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_contact_author.id 2 _pdbx_contact_author.email hartmut.niemann@uni-bielefeld.de _pdbx_contact_author.name_first Hartmut _pdbx_contact_author.name_last Niemann _pdbx_contact_author.name_mi H. _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8582-0360 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Kowal, J.L.' 1 0000-0003-2797-4908 'Pietrowski, T.' 2 ? 'Niemann, H.H.' 3 0000-0002-8582-0360 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 438 _citation.language ? _citation.page_first 169987 _citation.page_last 169987 _citation.title ;New Structures of Human Formylglycine-generating Enzyme Reveal Features Important for Catalysis, Disease and Structure-based Drug Design. ; _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2026.169987 _citation.pdbx_database_id_PubMed 42580400 _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kowal, J.L.' 1 ? primary 'Alam, S.' 2 ? primary 'Radhakrishnan, K.' 3 ? primary 'Dickmanns, A.' 4 ? primary 'Neumann, P.' 5 ? primary 'Schlotawa, L.' 6 ? primary 'Ficner, R.' 7 ? primary 'Dierks, T.' 8 ? primary 'Rudolph, M.G.' 9 ? primary 'Niemann, H.H.' 10 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Formylglycine-generating enzyme' 36112.867 1 1.8.3.7 C336S ? 'ADLGSSMEF sequence from cloning vector, one loop is not visible, SGRGS linker and His7-tag, cysteine 336 mutated to serine' 2 polymer syn CYS-THR-PRO-SER-ARG 563.648 1 3.1.6.8 ? ? 'synthetic peptide derived from Arylsulfatase A sequence' 3 branched man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401 1 ? ? ? ? 4 non-polymer syn 'CALCIUM ION' 40.078 2 ? ? ? ? 5 water nat water 18.015 79 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'FGE,C-alpha-formylglycine-generating enzyme 1,Sulfatase-modifying factor 1' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;ADLGSSMEFEANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNST GYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGK RLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTS DWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMSHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMDSGRGSHHHH HHH ; ;ADLGSSMEFEANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNST GYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGK RLPTEAEWEYSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTS DWWTVHHSVEETLNPKGPPSGKDRVKKGGSYMSHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMDSGRGSHHHH HHH ; A ? 2 'polypeptide(L)' no no CTPSR CTPSR P ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 4 'CALCIUM ION' CA 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ASP n 1 3 LEU n 1 4 GLY n 1 5 SER n 1 6 SER n 1 7 MET n 1 8 GLU n 1 9 PHE n 1 10 GLU n 1 11 ALA n 1 12 ASN n 1 13 ALA n 1 14 PRO n 1 15 GLY n 1 16 PRO n 1 17 VAL n 1 18 PRO n 1 19 GLY n 1 20 GLU n 1 21 ARG n 1 22 GLN n 1 23 LEU n 1 24 ALA n 1 25 HIS n 1 26 SER n 1 27 LYS n 1 28 MET n 1 29 VAL n 1 30 PRO n 1 31 ILE n 1 32 PRO n 1 33 ALA n 1 34 GLY n 1 35 VAL n 1 36 PHE n 1 37 THR n 1 38 MET n 1 39 GLY n 1 40 THR n 1 41 ASP n 1 42 ASP n 1 43 PRO n 1 44 GLN n 1 45 ILE n 1 46 LYS n 1 47 GLN n 1 48 ASP n 1 49 GLY n 1 50 GLU n 1 51 ALA n 1 52 PRO n 1 53 ALA n 1 54 ARG n 1 55 ARG n 1 56 VAL n 1 57 THR n 1 58 ILE n 1 59 ASP n 1 60 ALA n 1 61 PHE n 1 62 TYR n 1 63 MET n 1 64 ASP n 1 65 ALA n 1 66 TYR n 1 67 GLU n 1 68 VAL n 1 69 SER n 1 70 ASN n 1 71 THR n 1 72 GLU n 1 73 PHE n 1 74 GLU n 1 75 LYS n 1 76 PHE n 1 77 VAL n 1 78 ASN n 1 79 SER n 1 80 THR n 1 81 GLY n 1 82 TYR n 1 83 LEU n 1 84 THR n 1 85 GLU n 1 86 ALA n 1 87 GLU n 1 88 LYS n 1 89 PHE n 1 90 GLY n 1 91 ASP n 1 92 SER n 1 93 PHE n 1 94 VAL n 1 95 PHE n 1 96 GLU n 1 97 GLY n 1 98 MET n 1 99 LEU n 1 100 SER n 1 101 GLU n 1 102 GLN n 1 103 VAL n 1 104 LYS n 1 105 THR n 1 106 ASN n 1 107 ILE n 1 108 GLN n 1 109 GLN n 1 110 ALA n 1 111 VAL n 1 112 ALA n 1 113 ALA n 1 114 ALA n 1 115 PRO n 1 116 TRP n 1 117 TRP n 1 118 LEU n 1 119 PRO n 1 120 VAL n 1 121 LYS n 1 122 GLY n 1 123 ALA n 1 124 ASN n 1 125 TRP n 1 126 ARG n 1 127 HIS n 1 128 PRO n 1 129 GLU n 1 130 GLY n 1 131 PRO n 1 132 ASP n 1 133 SER n 1 134 THR n 1 135 ILE n 1 136 LEU n 1 137 HIS n 1 138 ARG n 1 139 PRO n 1 140 ASP n 1 141 HIS n 1 142 PRO n 1 143 VAL n 1 144 LEU n 1 145 HIS n 1 146 VAL n 1 147 SER n 1 148 TRP n 1 149 ASN n 1 150 ASP n 1 151 ALA n 1 152 VAL n 1 153 ALA n 1 154 TYR n 1 155 CYS n 1 156 THR n 1 157 TRP n 1 158 ALA n 1 159 GLY n 1 160 LYS n 1 161 ARG n 1 162 LEU n 1 163 PRO n 1 164 THR n 1 165 GLU n 1 166 ALA n 1 167 GLU n 1 168 TRP n 1 169 GLU n 1 170 TYR n 1 171 SER n 1 172 CYS n 1 173 ARG n 1 174 GLY n 1 175 GLY n 1 176 LEU n 1 177 HIS n 1 178 ASN n 1 179 ARG n 1 180 LEU n 1 181 PHE n 1 182 PRO n 1 183 TRP n 1 184 GLY n 1 185 ASN n 1 186 LYS n 1 187 LEU n 1 188 GLN n 1 189 PRO n 1 190 LYS n 1 191 GLY n 1 192 GLN n 1 193 HIS n 1 194 TYR n 1 195 ALA n 1 196 ASN n 1 197 ILE n 1 198 TRP n 1 199 GLN n 1 200 GLY n 1 201 GLU n 1 202 PHE n 1 203 PRO n 1 204 VAL n 1 205 THR n 1 206 ASN n 1 207 THR n 1 208 GLY n 1 209 GLU n 1 210 ASP n 1 211 GLY n 1 212 PHE n 1 213 GLN n 1 214 GLY n 1 215 THR n 1 216 ALA n 1 217 PRO n 1 218 VAL n 1 219 ASP n 1 220 ALA n 1 221 PHE n 1 222 PRO n 1 223 PRO n 1 224 ASN n 1 225 GLY n 1 226 TYR n 1 227 GLY n 1 228 LEU n 1 229 TYR n 1 230 ASN n 1 231 ILE n 1 232 VAL n 1 233 GLY n 1 234 ASN n 1 235 ALA n 1 236 TRP n 1 237 GLU n 1 238 TRP n 1 239 THR n 1 240 SER n 1 241 ASP n 1 242 TRP n 1 243 TRP n 1 244 THR n 1 245 VAL n 1 246 HIS n 1 247 HIS n 1 248 SER n 1 249 VAL n 1 250 GLU n 1 251 GLU n 1 252 THR n 1 253 LEU n 1 254 ASN n 1 255 PRO n 1 256 LYS n 1 257 GLY n 1 258 PRO n 1 259 PRO n 1 260 SER n 1 261 GLY n 1 262 LYS n 1 263 ASP n 1 264 ARG n 1 265 VAL n 1 266 LYS n 1 267 LYS n 1 268 GLY n 1 269 GLY n 1 270 SER n 1 271 TYR n 1 272 MET n 1 273 SER n 1 274 HIS n 1 275 ARG n 1 276 SER n 1 277 TYR n 1 278 CYS n 1 279 TYR n 1 280 ARG n 1 281 TYR n 1 282 ARG n 1 283 CYS n 1 284 ALA n 1 285 ALA n 1 286 ARG n 1 287 SER n 1 288 GLN n 1 289 ASN n 1 290 THR n 1 291 PRO n 1 292 ASP n 1 293 SER n 1 294 SER n 1 295 ALA n 1 296 SER n 1 297 ASN n 1 298 LEU n 1 299 GLY n 1 300 PHE n 1 301 ARG n 1 302 CYS n 1 303 ALA n 1 304 ALA n 1 305 ASP n 1 306 ARG n 1 307 LEU n 1 308 PRO n 1 309 THR n 1 310 MET n 1 311 ASP n 1 312 SER n 1 313 GLY n 1 314 ARG n 1 315 GLY n 1 316 SER n 1 317 HIS n 1 318 HIS n 1 319 HIS n 1 320 HIS n 1 321 HIS n 1 322 HIS n 1 323 HIS n 2 1 CYS n 2 2 THR n 2 3 PRO n 2 4 SER n 2 5 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 323 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SUMF1, PSEC0152, UNQ3037/PRO9852' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Trichoplusia ni' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7111 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line Hi-Five _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 5 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details 'Uniprot P15289' # _pdbx_entity_branch.entity_id 3 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 3 DGlcpNAcb1-4DGlcpNAcb1-ROH 'Glycam Condensed Sequence' GMML 1.0 2 3 'WURCS=2.0/1,2,1/[a2122h-1b_1-5_2*NCC/3=O]/1-1/a4-b1' WURCS PDB2Glycan 1.1.0 3 3 '[][D-1-deoxy-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 3 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 NAG _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 NAG _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ;N-acetyl-beta-D-glucosamine; 2-acetamido-2-deoxy-beta-D-glucose; 2-acetamido-2-deoxy-D-glucose; 2-acetamido-2-deoxy-glucose; N-ACETYL-D-GLUCOSAMINE ; 'C8 H15 N O6' 221.208 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGlcpNAcb NAG 'COMMON NAME' GMML 1.0 N-acetyl-b-D-glucopyranosamine NAG 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-GlcpNAc NAG 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 GlcNAc # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 64 ? ? ? A . n A 1 2 ASP 2 65 ? ? ? A . n A 1 3 LEU 3 66 ? ? ? A . n A 1 4 GLY 4 67 ? ? ? A . n A 1 5 SER 5 68 ? ? ? A . n A 1 6 SER 6 69 ? ? ? A . n A 1 7 MET 7 70 ? ? ? A . n A 1 8 GLU 8 71 ? ? ? A . n A 1 9 PHE 9 72 ? ? ? A . n A 1 10 GLU 10 73 ? ? ? A . n A 1 11 ALA 11 74 ? ? ? A . n A 1 12 ASN 12 75 ? ? ? A . n A 1 13 ALA 13 76 ? ? ? A . n A 1 14 PRO 14 77 ? ? ? A . n A 1 15 GLY 15 78 ? ? ? A . n A 1 16 PRO 16 79 ? ? ? A . n A 1 17 VAL 17 80 ? ? ? A . n A 1 18 PRO 18 81 ? ? ? A . n A 1 19 GLY 19 82 ? ? ? A . n A 1 20 GLU 20 83 ? ? ? A . n A 1 21 ARG 21 84 ? ? ? A . n A 1 22 GLN 22 85 ? ? ? A . n A 1 23 LEU 23 86 ? ? ? A . n A 1 24 ALA 24 87 ? ? ? A . n A 1 25 HIS 25 88 88 HIS HIS A . n A 1 26 SER 26 89 89 SER SER A . n A 1 27 LYS 27 90 90 LYS LYS A . n A 1 28 MET 28 91 91 MET MET A . n A 1 29 VAL 29 92 92 VAL VAL A . n A 1 30 PRO 30 93 93 PRO PRO A . n A 1 31 ILE 31 94 94 ILE ILE A . n A 1 32 PRO 32 95 95 PRO PRO A . n A 1 33 ALA 33 96 96 ALA ALA A . n A 1 34 GLY 34 97 97 GLY GLY A . n A 1 35 VAL 35 98 98 VAL VAL A . n A 1 36 PHE 36 99 99 PHE PHE A . n A 1 37 THR 37 100 100 THR THR A . n A 1 38 MET 38 101 101 MET MET A . n A 1 39 GLY 39 102 102 GLY GLY A . n A 1 40 THR 40 103 103 THR THR A . n A 1 41 ASP 41 104 104 ASP ASP A . n A 1 42 ASP 42 105 105 ASP ASP A . n A 1 43 PRO 43 106 106 PRO PRO A . n A 1 44 GLN 44 107 107 GLN GLN A . n A 1 45 ILE 45 108 108 ILE ILE A . n A 1 46 LYS 46 109 109 LYS LYS A . n A 1 47 GLN 47 110 110 GLN GLN A . n A 1 48 ASP 48 111 111 ASP ASP A . n A 1 49 GLY 49 112 112 GLY GLY A . n A 1 50 GLU 50 113 113 GLU GLU A . n A 1 51 ALA 51 114 114 ALA ALA A . n A 1 52 PRO 52 115 115 PRO PRO A . n A 1 53 ALA 53 116 116 ALA ALA A . n A 1 54 ARG 54 117 117 ARG ARG A . n A 1 55 ARG 55 118 118 ARG ARG A . n A 1 56 VAL 56 119 119 VAL VAL A . n A 1 57 THR 57 120 120 THR THR A . n A 1 58 ILE 58 121 121 ILE ILE A . n A 1 59 ASP 59 122 122 ASP ASP A . n A 1 60 ALA 60 123 123 ALA ALA A . n A 1 61 PHE 61 124 124 PHE PHE A . n A 1 62 TYR 62 125 125 TYR TYR A . n A 1 63 MET 63 126 126 MET MET A . n A 1 64 ASP 64 127 127 ASP ASP A . n A 1 65 ALA 65 128 128 ALA ALA A . n A 1 66 TYR 66 129 129 TYR TYR A . n A 1 67 GLU 67 130 130 GLU GLU A . n A 1 68 VAL 68 131 131 VAL VAL A . n A 1 69 SER 69 132 132 SER SER A . n A 1 70 ASN 70 133 133 ASN ASN A . n A 1 71 THR 71 134 134 THR THR A . n A 1 72 GLU 72 135 135 GLU GLU A . n A 1 73 PHE 73 136 136 PHE PHE A . n A 1 74 GLU 74 137 137 GLU GLU A . n A 1 75 LYS 75 138 138 LYS LYS A . n A 1 76 PHE 76 139 139 PHE PHE A . n A 1 77 VAL 77 140 140 VAL VAL A . n A 1 78 ASN 78 141 141 ASN ASN A . n A 1 79 SER 79 142 142 SER SER A . n A 1 80 THR 80 143 143 THR THR A . n A 1 81 GLY 81 144 144 GLY GLY A . n A 1 82 TYR 82 145 145 TYR TYR A . n A 1 83 LEU 83 146 146 LEU LEU A . n A 1 84 THR 84 147 147 THR THR A . n A 1 85 GLU 85 148 148 GLU GLU A . n A 1 86 ALA 86 149 149 ALA ALA A . n A 1 87 GLU 87 150 150 GLU GLU A . n A 1 88 LYS 88 151 151 LYS LYS A . n A 1 89 PHE 89 152 152 PHE PHE A . n A 1 90 GLY 90 153 153 GLY GLY A . n A 1 91 ASP 91 154 154 ASP ASP A . n A 1 92 SER 92 155 155 SER SER A . n A 1 93 PHE 93 156 156 PHE PHE A . n A 1 94 VAL 94 157 157 VAL VAL A . n A 1 95 PHE 95 158 158 PHE PHE A . n A 1 96 GLU 96 159 159 GLU GLU A . n A 1 97 GLY 97 160 160 GLY GLY A . n A 1 98 MET 98 161 161 MET MET A . n A 1 99 LEU 99 162 162 LEU LEU A . n A 1 100 SER 100 163 163 SER SER A . n A 1 101 GLU 101 164 ? ? ? A . n A 1 102 GLN 102 165 ? ? ? A . n A 1 103 VAL 103 166 ? ? ? A . n A 1 104 LYS 104 167 ? ? ? A . n A 1 105 THR 105 168 ? ? ? A . n A 1 106 ASN 106 169 ? ? ? A . n A 1 107 ILE 107 170 ? ? ? A . n A 1 108 GLN 108 171 ? ? ? A . n A 1 109 GLN 109 172 ? ? ? A . n A 1 110 ALA 110 173 ? ? ? A . n A 1 111 VAL 111 174 ? ? ? A . n A 1 112 ALA 112 175 ? ? ? A . n A 1 113 ALA 113 176 176 ALA ALA A . n A 1 114 ALA 114 177 177 ALA ALA A . n A 1 115 PRO 115 178 178 PRO PRO A . n A 1 116 TRP 116 179 179 TRP TRP A . n A 1 117 TRP 117 180 180 TRP TRP A . n A 1 118 LEU 118 181 181 LEU LEU A . n A 1 119 PRO 119 182 182 PRO PRO A . n A 1 120 VAL 120 183 183 VAL VAL A . n A 1 121 LYS 121 184 184 LYS LYS A . n A 1 122 GLY 122 185 185 GLY GLY A . n A 1 123 ALA 123 186 186 ALA ALA A . n A 1 124 ASN 124 187 187 ASN ASN A . n A 1 125 TRP 125 188 188 TRP TRP A . n A 1 126 ARG 126 189 189 ARG ARG A . n A 1 127 HIS 127 190 190 HIS HIS A . n A 1 128 PRO 128 191 191 PRO PRO A . n A 1 129 GLU 129 192 192 GLU GLU A . n A 1 130 GLY 130 193 193 GLY GLY A . n A 1 131 PRO 131 194 194 PRO PRO A . n A 1 132 ASP 132 195 195 ASP ASP A . n A 1 133 SER 133 196 196 SER SER A . n A 1 134 THR 134 197 197 THR THR A . n A 1 135 ILE 135 198 198 ILE ILE A . n A 1 136 LEU 136 199 199 LEU LEU A . n A 1 137 HIS 137 200 200 HIS HIS A . n A 1 138 ARG 138 201 201 ARG ARG A . n A 1 139 PRO 139 202 202 PRO PRO A . n A 1 140 ASP 140 203 203 ASP ASP A . n A 1 141 HIS 141 204 204 HIS HIS A . n A 1 142 PRO 142 205 205 PRO PRO A . n A 1 143 VAL 143 206 206 VAL VAL A . n A 1 144 LEU 144 207 207 LEU LEU A . n A 1 145 HIS 145 208 208 HIS HIS A . n A 1 146 VAL 146 209 209 VAL VAL A . n A 1 147 SER 147 210 210 SER SER A . n A 1 148 TRP 148 211 211 TRP TRP A . n A 1 149 ASN 149 212 212 ASN ASN A . n A 1 150 ASP 150 213 213 ASP ASP A . n A 1 151 ALA 151 214 214 ALA ALA A . n A 1 152 VAL 152 215 215 VAL VAL A . n A 1 153 ALA 153 216 216 ALA ALA A . n A 1 154 TYR 154 217 217 TYR TYR A . n A 1 155 CYS 155 218 218 CYS CYS A . n A 1 156 THR 156 219 219 THR THR A . n A 1 157 TRP 157 220 220 TRP TRP A . n A 1 158 ALA 158 221 221 ALA ALA A . n A 1 159 GLY 159 222 222 GLY GLY A . n A 1 160 LYS 160 223 223 LYS LYS A . n A 1 161 ARG 161 224 224 ARG ARG A . n A 1 162 LEU 162 225 225 LEU LEU A . n A 1 163 PRO 163 226 226 PRO PRO A . n A 1 164 THR 164 227 227 THR THR A . n A 1 165 GLU 165 228 228 GLU GLU A . n A 1 166 ALA 166 229 229 ALA ALA A . n A 1 167 GLU 167 230 230 GLU GLU A . n A 1 168 TRP 168 231 231 TRP TRP A . n A 1 169 GLU 169 232 232 GLU GLU A . n A 1 170 TYR 170 233 233 TYR TYR A . n A 1 171 SER 171 234 234 SER SER A . n A 1 172 CYS 172 235 235 CYS CYS A . n A 1 173 ARG 173 236 236 ARG ARG A . n A 1 174 GLY 174 237 237 GLY GLY A . n A 1 175 GLY 175 238 238 GLY GLY A . n A 1 176 LEU 176 239 239 LEU LEU A . n A 1 177 HIS 177 240 240 HIS HIS A . n A 1 178 ASN 178 241 241 ASN ASN A . n A 1 179 ARG 179 242 242 ARG ARG A . n A 1 180 LEU 180 243 243 LEU LEU A . n A 1 181 PHE 181 244 244 PHE PHE A . n A 1 182 PRO 182 245 245 PRO PRO A . n A 1 183 TRP 183 246 246 TRP TRP A . n A 1 184 GLY 184 247 247 GLY GLY A . n A 1 185 ASN 185 248 248 ASN ASN A . n A 1 186 LYS 186 249 249 LYS LYS A . n A 1 187 LEU 187 250 250 LEU LEU A . n A 1 188 GLN 188 251 251 GLN GLN A . n A 1 189 PRO 189 252 252 PRO PRO A . n A 1 190 LYS 190 253 253 LYS LYS A . n A 1 191 GLY 191 254 254 GLY GLY A . n A 1 192 GLN 192 255 255 GLN GLN A . n A 1 193 HIS 193 256 256 HIS HIS A . n A 1 194 TYR 194 257 257 TYR TYR A . n A 1 195 ALA 195 258 258 ALA ALA A . n A 1 196 ASN 196 259 259 ASN ASN A . n A 1 197 ILE 197 260 260 ILE ILE A . n A 1 198 TRP 198 261 261 TRP TRP A . n A 1 199 GLN 199 262 262 GLN GLN A . n A 1 200 GLY 200 263 263 GLY GLY A . n A 1 201 GLU 201 264 264 GLU GLU A . n A 1 202 PHE 202 265 265 PHE PHE A . n A 1 203 PRO 203 266 266 PRO PRO A . n A 1 204 VAL 204 267 267 VAL VAL A . n A 1 205 THR 205 268 268 THR THR A . n A 1 206 ASN 206 269 269 ASN ASN A . n A 1 207 THR 207 270 270 THR THR A . n A 1 208 GLY 208 271 271 GLY GLY A . n A 1 209 GLU 209 272 272 GLU GLU A . n A 1 210 ASP 210 273 273 ASP ASP A . n A 1 211 GLY 211 274 274 GLY GLY A . n A 1 212 PHE 212 275 275 PHE PHE A . n A 1 213 GLN 213 276 276 GLN GLN A . n A 1 214 GLY 214 277 277 GLY GLY A . n A 1 215 THR 215 278 278 THR THR A . n A 1 216 ALA 216 279 279 ALA ALA A . n A 1 217 PRO 217 280 280 PRO PRO A . n A 1 218 VAL 218 281 281 VAL VAL A . n A 1 219 ASP 219 282 282 ASP ASP A . n A 1 220 ALA 220 283 283 ALA ALA A . n A 1 221 PHE 221 284 284 PHE PHE A . n A 1 222 PRO 222 285 285 PRO PRO A . n A 1 223 PRO 223 286 286 PRO PRO A . n A 1 224 ASN 224 287 287 ASN ASN A . n A 1 225 GLY 225 288 288 GLY GLY A . n A 1 226 TYR 226 289 289 TYR TYR A . n A 1 227 GLY 227 290 290 GLY GLY A . n A 1 228 LEU 228 291 291 LEU LEU A . n A 1 229 TYR 229 292 292 TYR TYR A . n A 1 230 ASN 230 293 293 ASN ASN A . n A 1 231 ILE 231 294 294 ILE ILE A . n A 1 232 VAL 232 295 295 VAL VAL A . n A 1 233 GLY 233 296 296 GLY GLY A . n A 1 234 ASN 234 297 297 ASN ASN A . n A 1 235 ALA 235 298 298 ALA ALA A . n A 1 236 TRP 236 299 299 TRP TRP A . n A 1 237 GLU 237 300 300 GLU GLU A . n A 1 238 TRP 238 301 301 TRP TRP A . n A 1 239 THR 239 302 302 THR THR A . n A 1 240 SER 240 303 303 SER SER A . n A 1 241 ASP 241 304 304 ASP ASP A . n A 1 242 TRP 242 305 305 TRP TRP A . n A 1 243 TRP 243 306 306 TRP TRP A . n A 1 244 THR 244 307 307 THR THR A . n A 1 245 VAL 245 308 308 VAL VAL A . n A 1 246 HIS 246 309 309 HIS HIS A . n A 1 247 HIS 247 310 310 HIS HIS A . n A 1 248 SER 248 311 311 SER SER A . n A 1 249 VAL 249 312 312 VAL VAL A . n A 1 250 GLU 250 313 313 GLU GLU A . n A 1 251 GLU 251 314 314 GLU GLU A . n A 1 252 THR 252 315 315 THR THR A . n A 1 253 LEU 253 316 316 LEU LEU A . n A 1 254 ASN 254 317 317 ASN ASN A . n A 1 255 PRO 255 318 318 PRO PRO A . n A 1 256 LYS 256 319 319 LYS LYS A . n A 1 257 GLY 257 320 320 GLY GLY A . n A 1 258 PRO 258 321 321 PRO PRO A . n A 1 259 PRO 259 322 322 PRO PRO A . n A 1 260 SER 260 323 323 SER SER A . n A 1 261 GLY 261 324 324 GLY GLY A . n A 1 262 LYS 262 325 325 LYS LYS A . n A 1 263 ASP 263 326 326 ASP ASP A . n A 1 264 ARG 264 327 327 ARG ARG A . n A 1 265 VAL 265 328 328 VAL VAL A . n A 1 266 LYS 266 329 329 LYS LYS A . n A 1 267 LYS 267 330 330 LYS LYS A . n A 1 268 GLY 268 331 331 GLY GLY A . n A 1 269 GLY 269 332 332 GLY GLY A . n A 1 270 SER 270 333 333 SER SER A . n A 1 271 TYR 271 334 334 TYR TYR A . n A 1 272 MET 272 335 335 MET MET A . n A 1 273 SER 273 336 336 SER SER A . n A 1 274 HIS 274 337 337 HIS HIS A . n A 1 275 ARG 275 338 338 ARG ARG A . n A 1 276 SER 276 339 339 SER SER A . n A 1 277 TYR 277 340 340 TYR TYR A . n A 1 278 CYS 278 341 341 CYS CYS A . n A 1 279 TYR 279 342 342 TYR TYR A . n A 1 280 ARG 280 343 343 ARG ARG A . n A 1 281 TYR 281 344 344 TYR TYR A . n A 1 282 ARG 282 345 345 ARG ARG A . n A 1 283 CYS 283 346 346 CYS CYS A . n A 1 284 ALA 284 347 347 ALA ALA A . n A 1 285 ALA 285 348 348 ALA ALA A . n A 1 286 ARG 286 349 349 ARG ARG A . n A 1 287 SER 287 350 350 SER SER A . n A 1 288 GLN 288 351 351 GLN GLN A . n A 1 289 ASN 289 352 352 ASN ASN A . n A 1 290 THR 290 353 353 THR THR A . n A 1 291 PRO 291 354 354 PRO PRO A . n A 1 292 ASP 292 355 355 ASP ASP A . n A 1 293 SER 293 356 356 SER SER A . n A 1 294 SER 294 357 357 SER SER A . n A 1 295 ALA 295 358 358 ALA ALA A . n A 1 296 SER 296 359 359 SER SER A . n A 1 297 ASN 297 360 360 ASN ASN A . n A 1 298 LEU 298 361 361 LEU LEU A . n A 1 299 GLY 299 362 362 GLY GLY A . n A 1 300 PHE 300 363 363 PHE PHE A . n A 1 301 ARG 301 364 364 ARG ARG A . n A 1 302 CYS 302 365 365 CYS CYS A . n A 1 303 ALA 303 366 366 ALA ALA A . n A 1 304 ALA 304 367 367 ALA ALA A . n A 1 305 ASP 305 368 368 ASP ASP A . n A 1 306 ARG 306 369 369 ARG ARG A . n A 1 307 LEU 307 370 370 LEU LEU A . n A 1 308 PRO 308 371 371 PRO PRO A . n A 1 309 THR 309 372 372 THR THR A . n A 1 310 MET 310 373 ? ? ? A . n A 1 311 ASP 311 374 ? ? ? A . n A 1 312 SER 312 375 ? ? ? A . n A 1 313 GLY 313 376 ? ? ? A . n A 1 314 ARG 314 377 ? ? ? A . n A 1 315 GLY 315 378 ? ? ? A . n A 1 316 SER 316 379 ? ? ? A . n A 1 317 HIS 317 380 ? ? ? A . n A 1 318 HIS 318 381 ? ? ? A . n A 1 319 HIS 319 382 ? ? ? A . n A 1 320 HIS 320 383 ? ? ? A . n A 1 321 HIS 321 384 ? ? ? A . n A 1 322 HIS 322 385 ? ? ? A . n A 1 323 HIS 323 386 ? ? ? A . n B 2 1 CYS 1 1 1 CYS CYS P . n B 2 2 THR 2 2 2 THR THR P . n B 2 3 PRO 3 3 3 PRO PRO P . n B 2 4 SER 4 4 4 SER SER P . n B 2 5 ARG 5 5 5 ARG ARG P . n # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero C 3 NAG 1 B NAG 1 B NAG 1 n C 3 NAG 2 B NAG 2 B NAG 2 n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 4 CA 1 401 1 CA CA A . E 4 CA 1 402 2 CA CA A . F 5 HOH 1 501 21 HOH HOH A . F 5 HOH 2 502 34 HOH HOH A . F 5 HOH 3 503 63 HOH HOH A . F 5 HOH 4 504 38 HOH HOH A . F 5 HOH 5 505 73 HOH HOH A . F 5 HOH 6 506 27 HOH HOH A . F 5 HOH 7 507 36 HOH HOH A . F 5 HOH 8 508 4 HOH HOH A . F 5 HOH 9 509 53 HOH HOH A . F 5 HOH 10 510 14 HOH HOH A . F 5 HOH 11 511 1 HOH HOH A . F 5 HOH 12 512 71 HOH HOH A . F 5 HOH 13 513 65 HOH HOH A . F 5 HOH 14 514 50 HOH HOH A . F 5 HOH 15 515 13 HOH HOH A . F 5 HOH 16 516 17 HOH HOH A . F 5 HOH 17 517 41 HOH HOH A . F 5 HOH 18 518 39 HOH HOH A . F 5 HOH 19 519 47 HOH HOH A . F 5 HOH 20 520 2 HOH HOH A . F 5 HOH 21 521 22 HOH HOH A . F 5 HOH 22 522 67 HOH HOH A . F 5 HOH 23 523 37 HOH HOH A . F 5 HOH 24 524 16 HOH HOH A . F 5 HOH 25 525 70 HOH HOH A . F 5 HOH 26 526 46 HOH HOH A . F 5 HOH 27 527 10 HOH HOH A . F 5 HOH 28 528 6 HOH HOH A . F 5 HOH 29 529 3 HOH HOH A . F 5 HOH 30 530 20 HOH HOH A . F 5 HOH 31 531 15 HOH HOH A . F 5 HOH 32 532 43 HOH HOH A . F 5 HOH 33 533 35 HOH HOH A . F 5 HOH 34 534 40 HOH HOH A . F 5 HOH 35 535 62 HOH HOH A . F 5 HOH 36 536 30 HOH HOH A . F 5 HOH 37 537 45 HOH HOH A . F 5 HOH 38 538 44 HOH HOH A . F 5 HOH 39 539 72 HOH HOH A . F 5 HOH 40 540 76 HOH HOH A . F 5 HOH 41 541 32 HOH HOH A . F 5 HOH 42 542 57 HOH HOH A . F 5 HOH 43 543 42 HOH HOH A . F 5 HOH 44 544 68 HOH HOH A . F 5 HOH 45 545 28 HOH HOH A . F 5 HOH 46 546 26 HOH HOH A . F 5 HOH 47 547 11 HOH HOH A . F 5 HOH 48 548 7 HOH HOH A . F 5 HOH 49 549 25 HOH HOH A . F 5 HOH 50 550 56 HOH HOH A . F 5 HOH 51 551 5 HOH HOH A . F 5 HOH 52 552 18 HOH HOH A . F 5 HOH 53 553 55 HOH HOH A . F 5 HOH 54 554 74 HOH HOH A . F 5 HOH 55 555 61 HOH HOH A . F 5 HOH 56 556 49 HOH HOH A . F 5 HOH 57 557 52 HOH HOH A . F 5 HOH 58 558 66 HOH HOH A . F 5 HOH 59 559 19 HOH HOH A . F 5 HOH 60 560 24 HOH HOH A . F 5 HOH 61 561 23 HOH HOH A . F 5 HOH 62 562 12 HOH HOH A . F 5 HOH 63 563 54 HOH HOH A . F 5 HOH 64 564 31 HOH HOH A . F 5 HOH 65 565 60 HOH HOH A . F 5 HOH 66 566 9 HOH HOH A . F 5 HOH 67 567 58 HOH HOH A . F 5 HOH 68 568 77 HOH HOH A . F 5 HOH 69 569 78 HOH HOH A . F 5 HOH 70 570 48 HOH HOH A . F 5 HOH 71 571 8 HOH HOH A . F 5 HOH 72 572 33 HOH HOH A . F 5 HOH 73 573 69 HOH HOH A . F 5 HOH 74 574 29 HOH HOH A . F 5 HOH 75 575 79 HOH HOH A . F 5 HOH 76 576 75 HOH HOH A . F 5 HOH 77 577 51 HOH HOH A . F 5 HOH 78 578 64 HOH HOH A . G 5 HOH 1 101 59 HOH HOH P . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 2.0_5936 ? 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? BUILT=20220220 ? 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? BUILT=20251103 ? 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . ? 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? 0.9.8.7 ? 5 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 31DC _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.746 _cell.length_a_esd ? _cell.length_b 109.466 _cell.length_b_esd ? _cell.length_c 43.438 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 31DC _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 31DC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.04 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.67 _exptl_crystal.description 'hexagonal prism' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 9.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'reservoir: 0.1 M Tris-HCl pH 9.0, 0.2 M CaCl2, 26% PEG 4000, 2.5% DMSO; 200 nl protein + 100 nl reservoir' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293.15 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 9M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-09-25 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.92 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID30B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.92 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID30B _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 38.72 _reflns.entry_id 31DC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 43.44 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13669 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.4 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 4.71 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.413 _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.992 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous ? _reflns.pdbx_CC_half_anomalous ? _reflns.pdbx_absDiff_over_sigma_anomalous ? _reflns.pdbx_percent_possible_anomalous ? _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.30 _reflns_shell.d_res_low 2.36 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 0.86 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 987 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 13.17 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 2.781 _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.549 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 99.9 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 31DC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.30 _refine.ls_d_res_low 43.44 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13593 _refine.ls_number_reflns_R_free 680 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.46 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2518 _refine.ls_R_factor_R_free 0.2878 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2499 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 34.68 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.39 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.details ? _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 43.44 _refine_hist.number_atoms_solvent 79 _refine_hist.number_atoms_total 2316 _refine_hist.number_reflns_all ? _refine_hist.number_reflns_obs ? _refine_hist.number_reflns_R_free ? _refine_hist.number_reflns_R_work ? _refine_hist.R_factor_all ? _refine_hist.R_factor_obs ? _refine_hist.R_factor_R_free ? _refine_hist.R_factor_R_work ? _refine_hist.pdbx_number_residues_total ? _refine_hist.pdbx_B_iso_mean_ligand ? _refine_hist.pdbx_B_iso_mean_solvent ? _refine_hist.pdbx_number_atoms_protein 2207 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 30 _refine_hist.pdbx_number_atoms_lipid ? _refine_hist.pdbx_number_atoms_carb ? _refine_hist.pdbx_pseudo_atom_details ? # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2340 ? f_bond_d ? ? ? 'X-RAY DIFFRACTION' ? 0.724 ? 3199 ? f_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 13.385 ? 865 ? f_dihedral_angle_d ? ? ? 'X-RAY DIFFRACTION' ? 0.045 ? 320 ? f_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 416 ? f_plane_restr ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.30 2.48 . . 131 2514 99.00 . . . . 0.3405 . . . . . . . . . . . . . . . 0.4128 'X-RAY DIFFRACTION' 2.48 2.73 . . 134 2543 99.00 . . . . 0.3019 . . . . . . . . . . . . . . . 0.3900 'X-RAY DIFFRACTION' 2.73 3.12 . . 135 2560 100.00 . . . . 0.2797 . . . . . . . . . . . . . . . 0.2854 'X-RAY DIFFRACTION' 3.12 3.93 . . 136 2588 100.00 . . . . 0.2317 . . . . . . . . . . . . . . . 0.2895 'X-RAY DIFFRACTION' 3.93 43.44 . . 144 2708 99.00 . . . . 0.2205 . . . . . . . . . . . . . . . 0.2394 # _struct.entry_id 31DC _struct.title 'Human formylglycine-generating enzyme FGE-C336S variant crystallized without elastase treatment, with peptide CTPSR' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 31DC _struct_keywords.text 'enzyme, multiple sulfatase deficiency, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 4 ? F N N 5 ? G N N 5 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP SUMF1_HUMAN Q8NBK3 ? 1 ;EANAPGPVPGERQLAHSKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKF GDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHRPDHPVLHVSWNDAVAYCTWAGKRLPTEAEWE YSCRGGLHNRLFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWTSDWWTVHHSV EETLNPKGPPSGKDRVKKGGSYMCHRSYCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD ; 73 2 PDB 31DC 31DC ? 2 ? 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 31DC A 10 ? 311 ? Q8NBK3 73 ? 374 ? 73 374 2 2 31DC P 1 ? 5 ? 31DC 1 ? 5 ? 1 5 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 31DC ALA A 1 ? UNP Q8NBK3 ? ? 'expression tag' 64 1 1 31DC ASP A 2 ? UNP Q8NBK3 ? ? 'expression tag' 65 2 1 31DC LEU A 3 ? UNP Q8NBK3 ? ? 'expression tag' 66 3 1 31DC GLY A 4 ? UNP Q8NBK3 ? ? 'expression tag' 67 4 1 31DC SER A 5 ? UNP Q8NBK3 ? ? 'expression tag' 68 5 1 31DC SER A 6 ? UNP Q8NBK3 ? ? 'expression tag' 69 6 1 31DC MET A 7 ? UNP Q8NBK3 ? ? 'expression tag' 70 7 1 31DC GLU A 8 ? UNP Q8NBK3 ? ? 'expression tag' 71 8 1 31DC PHE A 9 ? UNP Q8NBK3 ? ? 'expression tag' 72 9 1 31DC SER A 273 ? UNP Q8NBK3 CYS 336 'engineered mutation' 336 10 1 31DC SER A 312 ? UNP Q8NBK3 ? ? 'expression tag' 375 11 1 31DC GLY A 313 ? UNP Q8NBK3 ? ? 'expression tag' 376 12 1 31DC ARG A 314 ? UNP Q8NBK3 ? ? 'expression tag' 377 13 1 31DC GLY A 315 ? UNP Q8NBK3 ? ? 'expression tag' 378 14 1 31DC SER A 316 ? UNP Q8NBK3 ? ? 'expression tag' 379 15 1 31DC HIS A 317 ? UNP Q8NBK3 ? ? 'expression tag' 380 16 1 31DC HIS A 318 ? UNP Q8NBK3 ? ? 'expression tag' 381 17 1 31DC HIS A 319 ? UNP Q8NBK3 ? ? 'expression tag' 382 18 1 31DC HIS A 320 ? UNP Q8NBK3 ? ? 'expression tag' 383 19 1 31DC HIS A 321 ? UNP Q8NBK3 ? ? 'expression tag' 384 20 1 31DC HIS A 322 ? UNP Q8NBK3 ? ? 'expression tag' 385 21 1 31DC HIS A 323 ? UNP Q8NBK3 ? ? 'expression tag' 386 22 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 45 ? GLY A 49 ? ILE A 108 GLY A 112 5 ? 5 HELX_P HELX_P2 AA2 SER A 69 ? GLY A 81 ? SER A 132 GLY A 144 1 ? 13 HELX_P HELX_P3 AA3 THR A 84 ? GLY A 90 ? THR A 147 GLY A 153 1 ? 7 HELX_P HELX_P4 AA4 GLY A 97 ? LEU A 99 ? GLY A 160 LEU A 162 5 ? 3 HELX_P HELX_P5 AA5 SER A 147 ? ALA A 158 ? SER A 210 ALA A 221 1 ? 12 HELX_P HELX_P6 AA6 THR A 164 ? GLY A 174 ? THR A 227 GLY A 237 1 ? 11 HELX_P HELX_P7 AA7 GLN A 188 ? GLN A 192 ? GLN A 251 GLN A 255 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 155 SG ? ? ? 1_555 A CYS 302 SG ? ? A CYS 218 A CYS 365 1_555 ? ? ? ? ? ? ? 2.038 ? ? disulf2 disulf ? ? A CYS 172 SG ? ? ? 1_555 A CYS 283 SG ? ? A CYS 235 A CYS 346 1_555 ? ? ? ? ? ? ? 2.037 ? ? disulf3 disulf ? ? A CYS 278 SG ? ? ? 1_555 B CYS 1 SG ? ? A CYS 341 P CYS 1 1_555 ? ? ? ? ? ? ? 2.045 ? ? covale1 covale one ? A ASN 78 ND2 ? ? ? 1_555 C NAG . C1 ? ? A ASN 141 B NAG 1 1_555 ? ? ? ? ? ? ? 1.442 ? N-Glycosylation covale2 covale both ? C NAG . O4 ? ? ? 1_555 C NAG . C1 ? ? B NAG 1 B NAG 2 1_555 ? ? ? ? ? ? ? 1.447 ? ? metalc1 metalc ? ? A GLU 67 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 130 A CA 401 1_555 ? ? ? ? ? ? ? 2.293 ? ? metalc2 metalc ? ? A ASN 196 OD1 ? ? ? 1_555 E CA . CA ? ? A ASN 259 A CA 402 1_555 ? ? ? ? ? ? ? 2.209 ? ? metalc3 metalc ? ? A ILE 197 O ? ? ? 1_555 E CA . CA ? ? A ILE 260 A CA 402 1_555 ? ? ? ? ? ? ? 2.333 ? ? metalc4 metalc ? ? A ASP 210 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 273 A CA 402 1_555 ? ? ? ? ? ? ? 2.482 ? ? metalc5 metalc ? ? A ASP 210 OD2 ? ? ? 1_555 E CA . CA ? ? A ASP 273 A CA 402 1_555 ? ? ? ? ? ? ? 2.199 ? ? metalc6 metalc ? ? A PHE 212 O ? ? ? 1_555 E CA . CA ? ? A PHE 275 A CA 402 1_555 ? ? ? ? ? ? ? 2.319 ? ? metalc7 metalc ? ? A ASN 230 O ? ? ? 1_555 D CA . CA ? ? A ASN 293 A CA 401 1_555 ? ? ? ? ? ? ? 2.448 ? ? metalc8 metalc ? ? A GLY 233 O ? ? ? 1_555 D CA . CA ? ? A GLY 296 A CA 401 1_555 ? ? ? ? ? ? ? 2.433 ? ? metalc9 metalc ? ? A ALA 235 O ? ? ? 1_555 D CA . CA ? ? A ALA 298 A CA 401 1_555 ? ? ? ? ? ? ? 2.360 ? ? metalc10 metalc ? ? A GLU 237 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 300 A CA 401 1_555 ? ? ? ? ? ? ? 2.693 ? ? metalc11 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 402 A HOH 511 1_555 ? ? ? ? ? ? ? 2.226 ? ? metalc12 metalc ? ? E CA . CA ? ? ? 1_555 F HOH . O ? ? A CA 402 A HOH 513 1_555 ? ? ? ? ? ? ? 2.277 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 67 ? A GLU 130 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O ? A ASN 230 ? A ASN 293 ? 1_555 87.2 ? 2 OE2 ? A GLU 67 ? A GLU 130 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O ? A GLY 233 ? A GLY 296 ? 1_555 93.6 ? 3 O ? A ASN 230 ? A ASN 293 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O ? A GLY 233 ? A GLY 296 ? 1_555 86.7 ? 4 OE2 ? A GLU 67 ? A GLU 130 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O ? A ALA 235 ? A ALA 298 ? 1_555 84.4 ? 5 O ? A ASN 230 ? A ASN 293 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O ? A ALA 235 ? A ALA 298 ? 1_555 169.8 ? 6 O ? A GLY 233 ? A GLY 296 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 O ? A ALA 235 ? A ALA 298 ? 1_555 88.0 ? 7 OE2 ? A GLU 67 ? A GLU 130 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OE2 ? A GLU 237 ? A GLU 300 ? 1_555 93.1 ? 8 O ? A ASN 230 ? A ASN 293 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OE2 ? A GLU 237 ? A GLU 300 ? 1_555 75.6 ? 9 O ? A GLY 233 ? A GLY 296 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OE2 ? A GLU 237 ? A GLU 300 ? 1_555 160.7 ? 10 O ? A ALA 235 ? A ALA 298 ? 1_555 CA ? D CA . ? A CA 401 ? 1_555 OE2 ? A GLU 237 ? A GLU 300 ? 1_555 110.6 ? 11 OD1 ? A ASN 196 ? A ASN 259 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? A ILE 197 ? A ILE 260 ? 1_555 101.8 ? 12 OD1 ? A ASN 196 ? A ASN 259 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD1 ? A ASP 210 ? A ASP 273 ? 1_555 91.7 ? 13 O ? A ILE 197 ? A ILE 260 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD1 ? A ASP 210 ? A ASP 273 ? 1_555 126.7 ? 14 OD1 ? A ASN 196 ? A ASN 259 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD2 ? A ASP 210 ? A ASP 273 ? 1_555 84.7 ? 15 O ? A ILE 197 ? A ILE 260 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD2 ? A ASP 210 ? A ASP 273 ? 1_555 74.8 ? 16 OD1 ? A ASP 210 ? A ASP 273 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 OD2 ? A ASP 210 ? A ASP 273 ? 1_555 55.3 ? 17 OD1 ? A ASN 196 ? A ASN 259 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? A PHE 212 ? A PHE 275 ? 1_555 87.8 ? 18 O ? A ILE 197 ? A ILE 260 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? A PHE 212 ? A PHE 275 ? 1_555 157.1 ? 19 OD1 ? A ASP 210 ? A ASP 273 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? A PHE 212 ? A PHE 275 ? 1_555 73.0 ? 20 OD2 ? A ASP 210 ? A ASP 273 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? A PHE 212 ? A PHE 275 ? 1_555 127.3 ? 21 OD1 ? A ASN 196 ? A ASN 259 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 94.5 ? 22 O ? A ILE 197 ? A ILE 260 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 74.3 ? 23 OD1 ? A ASP 210 ? A ASP 273 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 156.3 ? 24 OD2 ? A ASP 210 ? A ASP 273 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 148.2 ? 25 O ? A PHE 212 ? A PHE 275 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 84.3 ? 26 OD1 ? A ASN 196 ? A ASN 259 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 513 ? 1_555 164.8 ? 27 O ? A ILE 197 ? A ILE 260 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 513 ? 1_555 93.3 ? 28 OD1 ? A ASP 210 ? A ASP 273 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 513 ? 1_555 77.9 ? 29 OD2 ? A ASP 210 ? A ASP 273 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 513 ? 1_555 98.0 ? 30 O ? A PHE 212 ? A PHE 275 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 513 ? 1_555 78.7 ? 31 O ? F HOH . ? A HOH 511 ? 1_555 CA ? E CA . ? A CA 402 ? 1_555 O ? F HOH . ? A HOH 513 ? 1_555 91.1 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 NAG C . ? ASN A 78 ? NAG B 1 ? 1_555 ASN A 141 ? 1_555 C1 ND2 ASN 1 NAG N-Glycosylation Carbohydrate 2 CYS A 155 ? CYS A 302 ? CYS A 218 ? 1_555 CYS A 365 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 172 ? CYS A 283 ? CYS A 235 ? 1_555 CYS A 346 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 278 ? CYS B 1 ? CYS A 341 ? 1_555 CYS P 1 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 51 A . ? ALA 114 A PRO 52 A ? PRO 115 A 1 -1.62 2 PHE 202 A . ? PHE 265 A PRO 203 A ? PRO 266 A 1 -1.22 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? AA3 ? 2 ? AA4 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA4 2 3 ? anti-parallel AA4 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 MET A 28 ? ILE A 31 ? MET A 91 ILE A 94 AA1 2 PHE A 61 ? ASP A 64 ? PHE A 124 ASP A 127 AA1 3 ALA A 303 ? ALA A 304 ? ALA A 366 ALA A 367 AA2 1 GLY A 34 ? MET A 38 ? GLY A 97 MET A 101 AA2 2 ARG A 54 ? ILE A 58 ? ARG A 117 ILE A 121 AA2 3 THR A 252 ? LEU A 253 ? THR A 315 LEU A 316 AA3 1 ASP A 91 ? PHE A 95 ? ASP A 154 PHE A 158 AA3 2 TRP A 117 ? LYS A 121 ? TRP A 180 LYS A 184 AA4 1 SER A 287 ? ASN A 289 ? SER A 350 ASN A 352 AA4 2 ARG A 264 ? LYS A 267 ? ARG A 327 LYS A 330 AA4 3 TRP A 236 ? TRP A 242 ? TRP A 299 TRP A 305 AA4 4 LEU A 298 ? GLY A 299 ? LEU A 361 GLY A 362 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 31 ? N ILE A 94 O PHE A 61 ? O PHE A 124 AA1 2 3 N TYR A 62 ? N TYR A 125 O ALA A 304 ? O ALA A 367 AA2 1 2 N GLY A 34 ? N GLY A 97 O ILE A 58 ? O ILE A 121 AA2 2 3 N THR A 57 ? N THR A 120 O THR A 252 ? O THR A 315 AA3 1 2 N SER A 92 ? N SER A 155 O VAL A 120 ? O VAL A 183 AA4 1 2 O ASN A 289 ? O ASN A 352 N ARG A 264 ? N ARG A 327 AA4 2 3 O VAL A 265 ? O VAL A 328 N ASP A 241 ? N ASP A 304 AA4 3 4 N TRP A 236 ? N TRP A 299 O GLY A 299 ? O GLY A 362 # _pdbx_entry_details.entry_id 31DC _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest N _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 223 ? ? -127.64 -161.20 2 1 ILE A 260 ? ? -127.45 -161.25 3 1 PHE A 284 ? ? 68.62 165.26 4 1 ASN A 297 ? ? 70.75 -99.89 5 1 TYR A 340 ? ? -138.93 -42.41 6 1 TYR A 340 ? ? -137.85 -44.33 7 1 TYR A 344 ? ? -85.07 37.87 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA 64 ? A ALA 1 2 1 Y 1 A ASP 65 ? A ASP 2 3 1 Y 1 A LEU 66 ? A LEU 3 4 1 Y 1 A GLY 67 ? A GLY 4 5 1 Y 1 A SER 68 ? A SER 5 6 1 Y 1 A SER 69 ? A SER 6 7 1 Y 1 A MET 70 ? A MET 7 8 1 Y 1 A GLU 71 ? A GLU 8 9 1 Y 1 A PHE 72 ? A PHE 9 10 1 Y 1 A GLU 73 ? A GLU 10 11 1 Y 1 A ALA 74 ? A ALA 11 12 1 Y 1 A ASN 75 ? A ASN 12 13 1 Y 1 A ALA 76 ? A ALA 13 14 1 Y 1 A PRO 77 ? A PRO 14 15 1 Y 1 A GLY 78 ? A GLY 15 16 1 Y 1 A PRO 79 ? A PRO 16 17 1 Y 1 A VAL 80 ? A VAL 17 18 1 Y 1 A PRO 81 ? A PRO 18 19 1 Y 1 A GLY 82 ? A GLY 19 20 1 Y 1 A GLU 83 ? A GLU 20 21 1 Y 1 A ARG 84 ? A ARG 21 22 1 Y 1 A GLN 85 ? A GLN 22 23 1 Y 1 A LEU 86 ? A LEU 23 24 1 Y 1 A ALA 87 ? A ALA 24 25 1 Y 1 A GLU 164 ? A GLU 101 26 1 Y 1 A GLN 165 ? A GLN 102 27 1 Y 1 A VAL 166 ? A VAL 103 28 1 Y 1 A LYS 167 ? A LYS 104 29 1 Y 1 A THR 168 ? A THR 105 30 1 Y 1 A ASN 169 ? A ASN 106 31 1 Y 1 A ILE 170 ? A ILE 107 32 1 Y 1 A GLN 171 ? A GLN 108 33 1 Y 1 A GLN 172 ? A GLN 109 34 1 Y 1 A ALA 173 ? A ALA 110 35 1 Y 1 A VAL 174 ? A VAL 111 36 1 Y 1 A ALA 175 ? A ALA 112 37 1 Y 1 A MET 373 ? A MET 310 38 1 Y 1 A ASP 374 ? A ASP 311 39 1 Y 1 A SER 375 ? A SER 312 40 1 Y 1 A GLY 376 ? A GLY 313 41 1 Y 1 A ARG 377 ? A ARG 314 42 1 Y 1 A GLY 378 ? A GLY 315 43 1 Y 1 A SER 379 ? A SER 316 44 1 Y 1 A HIS 380 ? A HIS 317 45 1 Y 1 A HIS 381 ? A HIS 318 46 1 Y 1 A HIS 382 ? A HIS 319 47 1 Y 1 A HIS 383 ? A HIS 320 48 1 Y 1 A HIS 384 ? A HIS 321 49 1 Y 1 A HIS 385 ? A HIS 322 50 1 Y 1 A HIS 386 ? A HIS 323 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CYS N N N N 75 CYS CA C N R 76 CYS C C N N 77 CYS O O N N 78 CYS CB C N N 79 CYS SG S N N 80 CYS OXT O N N 81 CYS H H N N 82 CYS H2 H N N 83 CYS HA H N N 84 CYS HB2 H N N 85 CYS HB3 H N N 86 CYS HG H N N 87 CYS HXT H N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HIS N N N N 138 HIS CA C N S 139 HIS C C N N 140 HIS O O N N 141 HIS CB C N N 142 HIS CG C Y N 143 HIS ND1 N Y N 144 HIS CD2 C Y N 145 HIS CE1 C Y N 146 HIS NE2 N Y N 147 HIS OXT O N N 148 HIS H H N N 149 HIS H2 H N N 150 HIS HA H N N 151 HIS HB2 H N N 152 HIS HB3 H N N 153 HIS HD1 H N N 154 HIS HD2 H N N 155 HIS HE1 H N N 156 HIS HE2 H N N 157 HIS HXT H N N 158 HOH O O N N 159 HOH H1 H N N 160 HOH H2 H N N 161 ILE N N N N 162 ILE CA C N S 163 ILE C C N N 164 ILE O O N N 165 ILE CB C N S 166 ILE CG1 C N N 167 ILE CG2 C N N 168 ILE CD1 C N N 169 ILE OXT O N N 170 ILE H H N N 171 ILE H2 H N N 172 ILE HA H N N 173 ILE HB H N N 174 ILE HG12 H N N 175 ILE HG13 H N N 176 ILE HG21 H N N 177 ILE HG22 H N N 178 ILE HG23 H N N 179 ILE HD11 H N N 180 ILE HD12 H N N 181 ILE HD13 H N N 182 ILE HXT H N N 183 LEU N N N N 184 LEU CA C N S 185 LEU C C N N 186 LEU O O N N 187 LEU CB C N N 188 LEU CG C N N 189 LEU CD1 C N N 190 LEU CD2 C N N 191 LEU OXT O N N 192 LEU H H N N 193 LEU H2 H N N 194 LEU HA H N N 195 LEU HB2 H N N 196 LEU HB3 H N N 197 LEU HG H N N 198 LEU HD11 H N N 199 LEU HD12 H N N 200 LEU HD13 H N N 201 LEU HD21 H N N 202 LEU HD22 H N N 203 LEU HD23 H N N 204 LEU HXT H N N 205 LYS N N N N 206 LYS CA C N S 207 LYS C C N N 208 LYS O O N N 209 LYS CB C N N 210 LYS CG C N N 211 LYS CD C N N 212 LYS CE C N N 213 LYS NZ N N N 214 LYS OXT O N N 215 LYS H H N N 216 LYS H2 H N N 217 LYS HA H N N 218 LYS HB2 H N N 219 LYS HB3 H N N 220 LYS HG2 H N N 221 LYS HG3 H N N 222 LYS HD2 H N N 223 LYS HD3 H N N 224 LYS HE2 H N N 225 LYS HE3 H N N 226 LYS HZ1 H N N 227 LYS HZ2 H N N 228 LYS HZ3 H N N 229 LYS HXT H N N 230 MET N N N N 231 MET CA C N S 232 MET C C N N 233 MET O O N N 234 MET CB C N N 235 MET CG C N N 236 MET SD S N N 237 MET CE C N N 238 MET OXT O N N 239 MET H H N N 240 MET H2 H N N 241 MET HA H N N 242 MET HB2 H N N 243 MET HB3 H N N 244 MET HG2 H N N 245 MET HG3 H N N 246 MET HE1 H N N 247 MET HE2 H N N 248 MET HE3 H N N 249 MET HXT H N N 250 NAG C1 C N R 251 NAG C2 C N R 252 NAG C3 C N R 253 NAG C4 C N S 254 NAG C5 C N R 255 NAG C6 C N N 256 NAG C7 C N N 257 NAG C8 C N N 258 NAG N2 N N N 259 NAG O1 O N N 260 NAG O3 O N N 261 NAG O4 O N N 262 NAG O5 O N N 263 NAG O6 O N N 264 NAG O7 O N N 265 NAG H1 H N N 266 NAG H2 H N N 267 NAG H3 H N N 268 NAG H4 H N N 269 NAG H5 H N N 270 NAG H61 H N N 271 NAG H62 H N N 272 NAG H81 H N N 273 NAG H82 H N N 274 NAG H83 H N N 275 NAG HN2 H N N 276 NAG HO1 H N N 277 NAG HO3 H N N 278 NAG HO4 H N N 279 NAG HO6 H N N 280 PHE N N N N 281 PHE CA C N S 282 PHE C C N N 283 PHE O O N N 284 PHE CB C N N 285 PHE CG C Y N 286 PHE CD1 C Y N 287 PHE CD2 C Y N 288 PHE CE1 C Y N 289 PHE CE2 C Y N 290 PHE CZ C Y N 291 PHE OXT O N N 292 PHE H H N N 293 PHE H2 H N N 294 PHE HA H N N 295 PHE HB2 H N N 296 PHE HB3 H N N 297 PHE HD1 H N N 298 PHE HD2 H N N 299 PHE HE1 H N N 300 PHE HE2 H N N 301 PHE HZ H N N 302 PHE HXT H N N 303 PRO N N N N 304 PRO CA C N S 305 PRO C C N N 306 PRO O O N N 307 PRO CB C N N 308 PRO CG C N N 309 PRO CD C N N 310 PRO OXT O N N 311 PRO H H N N 312 PRO HA H N N 313 PRO HB2 H N N 314 PRO HB3 H N N 315 PRO HG2 H N N 316 PRO HG3 H N N 317 PRO HD2 H N N 318 PRO HD3 H N N 319 PRO HXT H N N 320 SER N N N N 321 SER CA C N S 322 SER C C N N 323 SER O O N N 324 SER CB C N N 325 SER OG O N N 326 SER OXT O N N 327 SER H H N N 328 SER H2 H N N 329 SER HA H N N 330 SER HB2 H N N 331 SER HB3 H N N 332 SER HG H N N 333 SER HXT H N N 334 THR N N N N 335 THR CA C N S 336 THR C C N N 337 THR O O N N 338 THR CB C N R 339 THR OG1 O N N 340 THR CG2 C N N 341 THR OXT O N N 342 THR H H N N 343 THR H2 H N N 344 THR HA H N N 345 THR HB H N N 346 THR HG1 H N N 347 THR HG21 H N N 348 THR HG22 H N N 349 THR HG23 H N N 350 THR HXT H N N 351 TRP N N N N 352 TRP CA C N S 353 TRP C C N N 354 TRP O O N N 355 TRP CB C N N 356 TRP CG C Y N 357 TRP CD1 C Y N 358 TRP CD2 C Y N 359 TRP NE1 N Y N 360 TRP CE2 C Y N 361 TRP CE3 C Y N 362 TRP CZ2 C Y N 363 TRP CZ3 C Y N 364 TRP CH2 C Y N 365 TRP OXT O N N 366 TRP H H N N 367 TRP H2 H N N 368 TRP HA H N N 369 TRP HB2 H N N 370 TRP HB3 H N N 371 TRP HD1 H N N 372 TRP HE1 H N N 373 TRP HE3 H N N 374 TRP HZ2 H N N 375 TRP HZ3 H N N 376 TRP HH2 H N N 377 TRP HXT H N N 378 TYR N N N N 379 TYR CA C N S 380 TYR C C N N 381 TYR O O N N 382 TYR CB C N N 383 TYR CG C Y N 384 TYR CD1 C Y N 385 TYR CD2 C Y N 386 TYR CE1 C Y N 387 TYR CE2 C Y N 388 TYR CZ C Y N 389 TYR OH O N N 390 TYR OXT O N N 391 TYR H H N N 392 TYR H2 H N N 393 TYR HA H N N 394 TYR HB2 H N N 395 TYR HB3 H N N 396 TYR HD1 H N N 397 TYR HD2 H N N 398 TYR HE1 H N N 399 TYR HE2 H N N 400 TYR HH H N N 401 TYR HXT H N N 402 VAL N N N N 403 VAL CA C N S 404 VAL C C N N 405 VAL O O N N 406 VAL CB C N N 407 VAL CG1 C N N 408 VAL CG2 C N N 409 VAL OXT O N N 410 VAL H H N N 411 VAL H2 H N N 412 VAL HA H N N 413 VAL HB H N N 414 VAL HG11 H N N 415 VAL HG12 H N N 416 VAL HG13 H N N 417 VAL HG21 H N N 418 VAL HG22 H N N 419 VAL HG23 H N N 420 VAL HXT H N N 421 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 NAG C1 C2 sing N N 237 NAG C1 O1 sing N N 238 NAG C1 O5 sing N N 239 NAG C1 H1 sing N N 240 NAG C2 C3 sing N N 241 NAG C2 N2 sing N N 242 NAG C2 H2 sing N N 243 NAG C3 C4 sing N N 244 NAG C3 O3 sing N N 245 NAG C3 H3 sing N N 246 NAG C4 C5 sing N N 247 NAG C4 O4 sing N N 248 NAG C4 H4 sing N N 249 NAG C5 C6 sing N N 250 NAG C5 O5 sing N N 251 NAG C5 H5 sing N N 252 NAG C6 O6 sing N N 253 NAG C6 H61 sing N N 254 NAG C6 H62 sing N N 255 NAG C7 C8 sing N N 256 NAG C7 N2 sing N N 257 NAG C7 O7 doub N N 258 NAG C8 H81 sing N N 259 NAG C8 H82 sing N N 260 NAG C8 H83 sing N N 261 NAG N2 HN2 sing N N 262 NAG O1 HO1 sing N N 263 NAG O3 HO3 sing N N 264 NAG O4 HO4 sing N N 265 NAG O6 HO6 sing N N 266 PHE N CA sing N N 267 PHE N H sing N N 268 PHE N H2 sing N N 269 PHE CA C sing N N 270 PHE CA CB sing N N 271 PHE CA HA sing N N 272 PHE C O doub N N 273 PHE C OXT sing N N 274 PHE CB CG sing N N 275 PHE CB HB2 sing N N 276 PHE CB HB3 sing N N 277 PHE CG CD1 doub Y N 278 PHE CG CD2 sing Y N 279 PHE CD1 CE1 sing Y N 280 PHE CD1 HD1 sing N N 281 PHE CD2 CE2 doub Y N 282 PHE CD2 HD2 sing N N 283 PHE CE1 CZ doub Y N 284 PHE CE1 HE1 sing N N 285 PHE CE2 CZ sing Y N 286 PHE CE2 HE2 sing N N 287 PHE CZ HZ sing N N 288 PHE OXT HXT sing N N 289 PRO N CA sing N N 290 PRO N CD sing N N 291 PRO N H sing N N 292 PRO CA C sing N N 293 PRO CA CB sing N N 294 PRO CA HA sing N N 295 PRO C O doub N N 296 PRO C OXT sing N N 297 PRO CB CG sing N N 298 PRO CB HB2 sing N N 299 PRO CB HB3 sing N N 300 PRO CG CD sing N N 301 PRO CG HG2 sing N N 302 PRO CG HG3 sing N N 303 PRO CD HD2 sing N N 304 PRO CD HD3 sing N N 305 PRO OXT HXT sing N N 306 SER N CA sing N N 307 SER N H sing N N 308 SER N H2 sing N N 309 SER CA C sing N N 310 SER CA CB sing N N 311 SER CA HA sing N N 312 SER C O doub N N 313 SER C OXT sing N N 314 SER CB OG sing N N 315 SER CB HB2 sing N N 316 SER CB HB3 sing N N 317 SER OG HG sing N N 318 SER OXT HXT sing N N 319 THR N CA sing N N 320 THR N H sing N N 321 THR N H2 sing N N 322 THR CA C sing N N 323 THR CA CB sing N N 324 THR CA HA sing N N 325 THR C O doub N N 326 THR C OXT sing N N 327 THR CB OG1 sing N N 328 THR CB CG2 sing N N 329 THR CB HB sing N N 330 THR OG1 HG1 sing N N 331 THR CG2 HG21 sing N N 332 THR CG2 HG22 sing N N 333 THR CG2 HG23 sing N N 334 THR OXT HXT sing N N 335 TRP N CA sing N N 336 TRP N H sing N N 337 TRP N H2 sing N N 338 TRP CA C sing N N 339 TRP CA CB sing N N 340 TRP CA HA sing N N 341 TRP C O doub N N 342 TRP C OXT sing N N 343 TRP CB CG sing N N 344 TRP CB HB2 sing N N 345 TRP CB HB3 sing N N 346 TRP CG CD1 doub Y N 347 TRP CG CD2 sing Y N 348 TRP CD1 NE1 sing Y N 349 TRP CD1 HD1 sing N N 350 TRP CD2 CE2 doub Y N 351 TRP CD2 CE3 sing Y N 352 TRP NE1 CE2 sing Y N 353 TRP NE1 HE1 sing N N 354 TRP CE2 CZ2 sing Y N 355 TRP CE3 CZ3 doub Y N 356 TRP CE3 HE3 sing N N 357 TRP CZ2 CH2 doub Y N 358 TRP CZ2 HZ2 sing N N 359 TRP CZ3 CH2 sing Y N 360 TRP CZ3 HZ3 sing N N 361 TRP CH2 HH2 sing N N 362 TRP OXT HXT sing N N 363 TYR N CA sing N N 364 TYR N H sing N N 365 TYR N H2 sing N N 366 TYR CA C sing N N 367 TYR CA CB sing N N 368 TYR CA HA sing N N 369 TYR C O doub N N 370 TYR C OXT sing N N 371 TYR CB CG sing N N 372 TYR CB HB2 sing N N 373 TYR CB HB3 sing N N 374 TYR CG CD1 doub Y N 375 TYR CG CD2 sing Y N 376 TYR CD1 CE1 sing Y N 377 TYR CD1 HD1 sing N N 378 TYR CD2 CE2 doub Y N 379 TYR CD2 HD2 sing N N 380 TYR CE1 CZ doub Y N 381 TYR CE1 HE1 sing N N 382 TYR CE2 CZ sing Y N 383 TYR CE2 HE2 sing N N 384 TYR CZ OH sing N N 385 TYR OH HH sing N N 386 TYR OXT HXT sing N N 387 VAL N CA sing N N 388 VAL N H sing N N 389 VAL N H2 sing N N 390 VAL CA C sing N N 391 VAL CA CB sing N N 392 VAL CA HA sing N N 393 VAL C O doub N N 394 VAL C OXT sing N N 395 VAL CB CG1 sing N N 396 VAL CB CG2 sing N N 397 VAL CB HB sing N N 398 VAL CG1 HG11 sing N N 399 VAL CG1 HG12 sing N N 400 VAL CG1 HG13 sing N N 401 VAL CG2 HG21 sing N N 402 VAL CG2 HG22 sing N N 403 VAL CG2 HG23 sing N N 404 VAL OXT HXT sing N N 405 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Other government' Ireland HRCI-HRB-2020-013 1 'Other private' Ireland HRCI-HRB-2020-013 2 # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 3 NAG 1 n 3 NAG 2 n # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1Z70 _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 31DC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.016195 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009135 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.023021 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CA N O S # loop_ #