data_34AF # _entry.id 34AF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 34AF pdb_000034af 10.2210/pdb34af/pdb WWPDB D_1292160185 ? ? BMRB 35086 ? 10.13018/BMR35086 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-09-16 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 34AF _pdbx_database_status.recvd_initial_deposition_date 2026-09-03 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBE _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB-Dev . D_1292160191 unspecified PDB-Dev . D_1292160382 unspecified BMRB 'Cu(II)-bound alpha-synuclein monomer complex - local structure of N-terminal binding site' 35086 unspecified # _pdbx_contact_author.id 2 _pdbx_contact_author.email axel.abelein@ki.se _pdbx_contact_author.name_first Axel _pdbx_contact_author.name_last Abelein _pdbx_contact_author.name_mi ? _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0002-8079-3017 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Adam, L.' 1 ? 'Giachetti, A.' 2 ? 'Piccioli, M.' 3 ? 'Ciofi-Baffoni, S.' 4 ? 'Abelein, A.' 5 0000-0002-8079-3017 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Cu(II)-bound alpha-synuclein monomer complex - local structure of N-terminal binding site' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Adam, L.' 1 ? primary 'Giachetti, A.' 2 ? primary 'Piccioli, M.' 3 ? primary 'Ciofi-Baffoni, S.' 4 ? primary 'Abelein, A.' 5 0000-0002-8079-3017 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Alpha-synuclein 14476.108 1 ? ? ? ? 2 non-polymer syn 'COPPER (II) ION' 63.546 1 ? ? ? ? 3 water nat water 18.015 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Non-A beta component of AD amyloid,Non-A4 component of amyloid precursor,NACP' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; _entity_poly.pdbx_seq_one_letter_code_can ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'COPPER (II) ION' CU 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 VAL n 1 4 PHE n 1 5 MET n 1 6 LYS n 1 7 GLY n 1 8 LEU n 1 9 SER n 1 10 LYS n 1 11 ALA n 1 12 LYS n 1 13 GLU n 1 14 GLY n 1 15 VAL n 1 16 VAL n 1 17 ALA n 1 18 ALA n 1 19 ALA n 1 20 GLU n 1 21 LYS n 1 22 THR n 1 23 LYS n 1 24 GLN n 1 25 GLY n 1 26 VAL n 1 27 ALA n 1 28 GLU n 1 29 ALA n 1 30 ALA n 1 31 GLY n 1 32 LYS n 1 33 THR n 1 34 LYS n 1 35 GLU n 1 36 GLY n 1 37 VAL n 1 38 LEU n 1 39 TYR n 1 40 VAL n 1 41 GLY n 1 42 SER n 1 43 LYS n 1 44 THR n 1 45 LYS n 1 46 GLU n 1 47 GLY n 1 48 VAL n 1 49 VAL n 1 50 HIS n 1 51 GLY n 1 52 VAL n 1 53 ALA n 1 54 THR n 1 55 VAL n 1 56 ALA n 1 57 GLU n 1 58 LYS n 1 59 THR n 1 60 LYS n 1 61 GLU n 1 62 GLN n 1 63 VAL n 1 64 THR n 1 65 ASN n 1 66 VAL n 1 67 GLY n 1 68 GLY n 1 69 ALA n 1 70 VAL n 1 71 VAL n 1 72 THR n 1 73 GLY n 1 74 VAL n 1 75 THR n 1 76 ALA n 1 77 VAL n 1 78 ALA n 1 79 GLN n 1 80 LYS n 1 81 THR n 1 82 VAL n 1 83 GLU n 1 84 GLY n 1 85 ALA n 1 86 GLY n 1 87 SER n 1 88 ILE n 1 89 ALA n 1 90 ALA n 1 91 ALA n 1 92 THR n 1 93 GLY n 1 94 PHE n 1 95 VAL n 1 96 LYS n 1 97 LYS n 1 98 ASP n 1 99 GLN n 1 100 LEU n 1 101 GLY n 1 102 LYS n 1 103 ASN n 1 104 GLU n 1 105 GLU n 1 106 GLY n 1 107 ALA n 1 108 PRO n 1 109 GLN n 1 110 GLU n 1 111 GLY n 1 112 ILE n 1 113 LEU n 1 114 GLU n 1 115 ASP n 1 116 MET n 1 117 PRO n 1 118 VAL n 1 119 ASP n 1 120 PRO n 1 121 ASP n 1 122 ASN n 1 123 GLU n 1 124 ALA n 1 125 TYR n 1 126 GLU n 1 127 MET n 1 128 PRO n 1 129 SER n 1 130 GLU n 1 131 GLU n 1 132 GLY n 1 133 TYR n 1 134 GLN n 1 135 ASP n 1 136 TYR n 1 137 GLU n 1 138 PRO n 1 139 GLU n 1 140 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 140 _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'SNCA, NACP, PARK1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CU non-polymer . 'COPPER (II) ION' ? 'Cu 2' 63.546 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 1 MET MET A . n A 1 2 ASP 2 2 2 ASP ASP A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 MET 5 5 5 MET MET A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLY 7 7 7 GLY GLY A . n A 1 8 LEU 8 8 8 LEU LEU A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 ALA 11 11 11 ALA ALA A . n A 1 12 LYS 12 12 12 LYS LYS A . n A 1 13 GLU 13 13 13 GLU GLU A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ALA 17 17 17 ALA ALA A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 VAL 26 26 ? ? ? A . n A 1 27 ALA 27 27 ? ? ? A . n A 1 28 GLU 28 28 ? ? ? A . n A 1 29 ALA 29 29 ? ? ? A . n A 1 30 ALA 30 30 ? ? ? A . n A 1 31 GLY 31 31 ? ? ? A . n A 1 32 LYS 32 32 ? ? ? A . n A 1 33 THR 33 33 ? ? ? A . n A 1 34 LYS 34 34 ? ? ? A . n A 1 35 GLU 35 35 ? ? ? A . n A 1 36 GLY 36 36 ? ? ? A . n A 1 37 VAL 37 37 ? ? ? A . n A 1 38 LEU 38 38 ? ? ? A . n A 1 39 TYR 39 39 ? ? ? A . n A 1 40 VAL 40 40 ? ? ? A . n A 1 41 GLY 41 41 ? ? ? A . n A 1 42 SER 42 42 ? ? ? A . n A 1 43 LYS 43 43 ? ? ? A . n A 1 44 THR 44 44 ? ? ? A . n A 1 45 LYS 45 45 ? ? ? A . n A 1 46 GLU 46 46 ? ? ? A . n A 1 47 GLY 47 47 ? ? ? A . n A 1 48 VAL 48 48 ? ? ? A . n A 1 49 VAL 49 49 ? ? ? A . n A 1 50 HIS 50 50 ? ? ? A . n A 1 51 GLY 51 51 ? ? ? A . n A 1 52 VAL 52 52 ? ? ? A . n A 1 53 ALA 53 53 ? ? ? A . n A 1 54 THR 54 54 ? ? ? A . n A 1 55 VAL 55 55 ? ? ? A . n A 1 56 ALA 56 56 ? ? ? A . n A 1 57 GLU 57 57 ? ? ? A . n A 1 58 LYS 58 58 ? ? ? A . n A 1 59 THR 59 59 ? ? ? A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 GLU 61 61 ? ? ? A . n A 1 62 GLN 62 62 ? ? ? A . n A 1 63 VAL 63 63 ? ? ? A . n A 1 64 THR 64 64 ? ? ? A . n A 1 65 ASN 65 65 ? ? ? A . n A 1 66 VAL 66 66 ? ? ? A . n A 1 67 GLY 67 67 ? ? ? A . n A 1 68 GLY 68 68 ? ? ? A . n A 1 69 ALA 69 69 ? ? ? A . n A 1 70 VAL 70 70 ? ? ? A . n A 1 71 VAL 71 71 ? ? ? A . n A 1 72 THR 72 72 ? ? ? A . n A 1 73 GLY 73 73 ? ? ? A . n A 1 74 VAL 74 74 ? ? ? A . n A 1 75 THR 75 75 ? ? ? A . n A 1 76 ALA 76 76 ? ? ? A . n A 1 77 VAL 77 77 ? ? ? A . n A 1 78 ALA 78 78 ? ? ? A . n A 1 79 GLN 79 79 ? ? ? A . n A 1 80 LYS 80 80 ? ? ? A . n A 1 81 THR 81 81 ? ? ? A . n A 1 82 VAL 82 82 ? ? ? A . n A 1 83 GLU 83 83 ? ? ? A . n A 1 84 GLY 84 84 ? ? ? A . n A 1 85 ALA 85 85 ? ? ? A . n A 1 86 GLY 86 86 ? ? ? A . n A 1 87 SER 87 87 ? ? ? A . n A 1 88 ILE 88 88 ? ? ? A . n A 1 89 ALA 89 89 ? ? ? A . n A 1 90 ALA 90 90 ? ? ? A . n A 1 91 ALA 91 91 ? ? ? A . n A 1 92 THR 92 92 ? ? ? A . n A 1 93 GLY 93 93 ? ? ? A . n A 1 94 PHE 94 94 ? ? ? A . n A 1 95 VAL 95 95 ? ? ? A . n A 1 96 LYS 96 96 ? ? ? A . n A 1 97 LYS 97 97 ? ? ? A . n A 1 98 ASP 98 98 ? ? ? A . n A 1 99 GLN 99 99 ? ? ? A . n A 1 100 LEU 100 100 ? ? ? A . n A 1 101 GLY 101 101 ? ? ? A . n A 1 102 LYS 102 102 ? ? ? A . n A 1 103 ASN 103 103 ? ? ? A . n A 1 104 GLU 104 104 ? ? ? A . n A 1 105 GLU 105 105 ? ? ? A . n A 1 106 GLY 106 106 ? ? ? A . n A 1 107 ALA 107 107 ? ? ? A . n A 1 108 PRO 108 108 ? ? ? A . n A 1 109 GLN 109 109 ? ? ? A . n A 1 110 GLU 110 110 ? ? ? A . n A 1 111 GLY 111 111 ? ? ? A . n A 1 112 ILE 112 112 ? ? ? A . n A 1 113 LEU 113 113 ? ? ? A . n A 1 114 GLU 114 114 ? ? ? A . n A 1 115 ASP 115 115 ? ? ? A . n A 1 116 MET 116 116 ? ? ? A . n A 1 117 PRO 117 117 ? ? ? A . n A 1 118 VAL 118 118 ? ? ? A . n A 1 119 ASP 119 119 ? ? ? A . n A 1 120 PRO 120 120 ? ? ? A . n A 1 121 ASP 121 121 ? ? ? A . n A 1 122 ASN 122 122 ? ? ? A . n A 1 123 GLU 123 123 ? ? ? A . n A 1 124 ALA 124 124 ? ? ? A . n A 1 125 TYR 125 125 ? ? ? A . n A 1 126 GLU 126 126 ? ? ? A . n A 1 127 MET 127 127 ? ? ? A . n A 1 128 PRO 128 128 ? ? ? A . n A 1 129 SER 129 129 ? ? ? A . n A 1 130 GLU 130 130 ? ? ? A . n A 1 131 GLU 131 131 ? ? ? A . n A 1 132 GLY 132 132 ? ? ? A . n A 1 133 TYR 133 133 ? ? ? A . n A 1 134 GLN 134 134 ? ? ? A . n A 1 135 ASP 135 135 ? ? ? A . n A 1 136 TYR 136 136 ? ? ? A . n A 1 137 GLU 137 137 ? ? ? A . n A 1 138 PRO 138 138 ? ? ? A . n A 1 139 GLU 139 139 ? ? ? A . n A 1 140 ALA 140 140 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CU 1 201 27 CU CU2 A . C 3 HOH 1 301 26 HOH WC1 A . # _cell.angle_alpha 109.47 _cell.angle_alpha_esd ? _cell.angle_beta 109.47 _cell.angle_beta_esd ? _cell.angle_gamma 109.47 _cell.angle_gamma_esd ? _cell.entry_id 34AF _cell.details ? _cell.formula_units_Z ? _cell.length_a 58.878 _cell.length_a_esd ? _cell.length_b 58.878 _cell.length_b_esd ? _cell.length_c 58.878 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 1 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 34AF _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 34AF _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 34AF _struct.title 'Cu(II)-bound alpha-synuclein monomer complex - local structure of N-terminal binding site' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 34AF _struct_keywords.text 'alpha-synuclein, amyloid, copper, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code SYUA_HUMAN _struct_ref.pdbx_db_accession P37840 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQK TVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 34AF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P37840 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 140 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 140 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details 'not applicable' # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A MET 1 N ? ? ? 1_555 B CU . CU ? ? A MET 1 A CU 201 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc2 metalc ? ? A ASP 2 N ? ? ? 1_555 B CU . CU ? ? A ASP 2 A CU 201 1_555 ? ? ? ? ? ? ? 1.872 ? ? metalc3 metalc ? ? A ASP 2 OD1 ? ? ? 1_555 B CU . CU ? ? A ASP 2 A CU 201 1_555 ? ? ? ? ? ? ? 1.876 ? ? metalc4 metalc ? ? B CU . CU ? ? ? 1_555 C HOH . O ? ? A CU 201 A HOH 301 1_555 ? ? ? ? ? ? ? 2.196 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 N ? A MET 1 ? A MET 1 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 N ? A ASP 2 ? A ASP 2 ? 1_555 82.5 ? 2 N ? A MET 1 ? A MET 1 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 OD1 ? A ASP 2 ? A ASP 2 ? 1_555 154.0 ? 3 N ? A ASP 2 ? A ASP 2 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 OD1 ? A ASP 2 ? A ASP 2 ? 1_555 89.4 ? 4 N ? A MET 1 ? A MET 1 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 O ? C HOH . ? A HOH 301 ? 1_555 108.0 ? 5 N ? A ASP 2 ? A ASP 2 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 O ? C HOH . ? A HOH 301 ? 1_555 153.6 ? 6 OD1 ? A ASP 2 ? A ASP 2 ? 1_555 CU ? B CU . ? A CU 201 ? 1_555 O ? C HOH . ? A HOH 301 ? 1_555 90.1 ? # _pdbx_entry_details.entry_id 34AF _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A ASP 2 ? ? CA A ASP 2 ? ? CB A ASP 2 ? ? 95.01 110.60 -15.59 1.80 N 2 2 CB A ASP 2 ? ? CA A ASP 2 ? ? C A ASP 2 ? ? 122.83 110.40 12.43 2.00 N 3 2 N A ASP 2 ? ? CA A ASP 2 ? ? CB A ASP 2 ? ? 95.21 110.60 -15.39 1.80 N 4 2 CB A ASP 2 ? ? CG A ASP 2 ? ? OD1 A ASP 2 ? ? 112.72 118.30 -5.58 0.90 N 5 3 CB A ASP 2 ? ? CA A ASP 2 ? ? C A ASP 2 ? ? 123.15 110.40 12.75 2.00 N 6 3 N A ASP 2 ? ? CA A ASP 2 ? ? CB A ASP 2 ? ? 98.39 110.60 -12.21 1.80 N 7 4 N A ASP 2 ? ? CA A ASP 2 ? ? CB A ASP 2 ? ? 97.47 110.60 -13.13 1.80 N 8 5 CB A ASP 2 ? ? CA A ASP 2 ? ? C A ASP 2 ? ? 125.24 110.40 14.84 2.00 N 9 5 CB A ASP 2 ? ? CG A ASP 2 ? ? OD1 A ASP 2 ? ? 112.70 118.30 -5.60 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 2 ? ? -138.70 -123.70 2 1 VAL A 3 ? ? -153.14 -0.68 3 1 LYS A 10 ? ? 46.08 -137.66 4 1 GLU A 13 ? ? 63.33 -126.29 5 1 VAL A 15 ? ? -145.58 41.90 6 1 ALA A 17 ? ? 61.93 -161.53 7 1 LYS A 23 ? ? -171.45 99.99 8 2 ASP A 2 ? ? -27.39 -81.34 9 2 VAL A 3 ? ? -94.21 40.70 10 2 PHE A 4 ? ? -147.25 -55.53 11 2 MET A 5 ? ? -142.34 51.33 12 2 LYS A 6 ? ? 79.86 135.56 13 2 SER A 9 ? ? 50.86 74.31 14 2 GLU A 13 ? ? 73.83 -26.89 15 2 LYS A 21 ? ? 64.33 -164.06 16 3 VAL A 3 ? ? 91.35 -26.33 17 3 LYS A 6 ? ? 47.05 74.16 18 3 LYS A 10 ? ? -154.15 -107.15 19 3 ALA A 17 ? ? 66.36 -167.01 20 3 LYS A 21 ? ? 84.70 -50.03 21 3 THR A 22 ? ? 159.41 147.10 22 4 ASP A 2 ? ? -37.12 -89.03 23 4 PHE A 4 ? ? -163.84 -147.35 24 4 MET A 5 ? ? -120.53 -50.96 25 4 LEU A 8 ? ? -139.45 -39.25 26 4 SER A 9 ? ? 40.66 77.89 27 4 LYS A 12 ? ? -145.95 -2.38 28 4 VAL A 16 ? ? -146.61 -38.35 29 4 ALA A 19 ? ? 90.65 140.94 30 4 GLU A 20 ? ? 77.44 -136.87 31 4 LYS A 23 ? ? 74.77 96.56 32 5 VAL A 3 ? ? -84.96 -128.00 33 5 MET A 5 ? ? 84.60 -59.97 34 5 ALA A 11 ? ? 71.49 -52.79 35 5 ALA A 17 ? ? -172.24 -154.51 36 5 GLU A 20 ? ? -126.28 -92.30 37 5 LYS A 23 ? ? 70.46 44.02 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 5 _pdbx_validate_peptide_omega.auth_comp_id_1 MET _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 1 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 ASP _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 2 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -107.90 # _pdbx_nmr_ensemble.entry_id 34AF _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 5 _pdbx_nmr_ensemble.conformer_selection_criteria 'target function' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 34AF _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # _pdbx_nmr_sample_details.solution_id 1 _pdbx_nmr_sample_details.contents '90 uM [U-13C; U-15N] Alpha-synuclein, 20 mM sodium phosphate, 0.02 % v/v sodium azide, 10 % v/v D2O, 90% H2O/10% D2O' _pdbx_nmr_sample_details.solvent_system '90% H2O/10% D2O' _pdbx_nmr_sample_details.label 13C_15N_sample _pdbx_nmr_sample_details.type solution _pdbx_nmr_sample_details.details '90 uM 13C-15N alpha-synuclein in 20 mM sodium phosphate buffer, 0.02% sodium azide, pH 7.4, 10% D2O' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Alpha-synuclein 90 ? uM '[U-13C; U-15N]' 1 'sodium phosphate' 20 ? mM . 1 'sodium azide' 0.02 ? '% v/v' . 1 D2O 10 ? '% v/v' 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 281 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 7.4 _pdbx_nmr_exptl_sample_conditions.ionic_strength 20 _pdbx_nmr_exptl_sample_conditions.details '90 uM 13C-15N alpha-synuclein in 20 mM sodium phosphate buffer, 0.02% sodium azide, pH 7.4, 10% D2O' _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label condition_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '2D 1H-13C HSQC' 2 isotropic # _pdbx_nmr_refine.entry_id 34AF _pdbx_nmr_refine.method 'molecular dynamics' _pdbx_nmr_refine.details Amber _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 refinement Amber 20 'Case, Darden, Cheatham III, Simmerling, Wang, Duke, Luo, ... and Kollman' 2 'structure calculation' CYANA 3.98.15 'Guntert, Mumenthaler and Wuthrich' 3 'chemical shift assignment' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' 4 'peak picking' Poky ? 'Manthey, Tonelli, Clos II, Rahimi, Markley and Lee' 5 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 6 processing TopSpin ? 'Bruker Biospin' 7 collection TopSpin ? 'Bruker Biospin' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A VAL 26 ? A VAL 26 2 1 Y 1 A ALA 27 ? A ALA 27 3 1 Y 1 A GLU 28 ? A GLU 28 4 1 Y 1 A ALA 29 ? A ALA 29 5 1 Y 1 A ALA 30 ? A ALA 30 6 1 Y 1 A GLY 31 ? A GLY 31 7 1 Y 1 A LYS 32 ? A LYS 32 8 1 Y 1 A THR 33 ? A THR 33 9 1 Y 1 A LYS 34 ? A LYS 34 10 1 Y 1 A GLU 35 ? A GLU 35 11 1 Y 1 A GLY 36 ? A GLY 36 12 1 Y 1 A VAL 37 ? A VAL 37 13 1 Y 1 A LEU 38 ? A LEU 38 14 1 Y 1 A TYR 39 ? A TYR 39 15 1 Y 1 A VAL 40 ? A VAL 40 16 1 Y 1 A GLY 41 ? A GLY 41 17 1 Y 1 A SER 42 ? A SER 42 18 1 Y 1 A LYS 43 ? A LYS 43 19 1 Y 1 A THR 44 ? A THR 44 20 1 Y 1 A LYS 45 ? A LYS 45 21 1 Y 1 A GLU 46 ? A GLU 46 22 1 Y 1 A GLY 47 ? A GLY 47 23 1 Y 1 A VAL 48 ? A VAL 48 24 1 Y 1 A VAL 49 ? A VAL 49 25 1 Y 1 A HIS 50 ? A HIS 50 26 1 Y 1 A GLY 51 ? A GLY 51 27 1 Y 1 A VAL 52 ? A VAL 52 28 1 Y 1 A ALA 53 ? A ALA 53 29 1 Y 1 A THR 54 ? A THR 54 30 1 Y 1 A VAL 55 ? A VAL 55 31 1 Y 1 A ALA 56 ? A ALA 56 32 1 Y 1 A GLU 57 ? A GLU 57 33 1 Y 1 A LYS 58 ? A LYS 58 34 1 Y 1 A THR 59 ? A THR 59 35 1 Y 1 A LYS 60 ? A LYS 60 36 1 Y 1 A GLU 61 ? A GLU 61 37 1 Y 1 A GLN 62 ? A GLN 62 38 1 Y 1 A VAL 63 ? A VAL 63 39 1 Y 1 A THR 64 ? A THR 64 40 1 Y 1 A ASN 65 ? A ASN 65 41 1 Y 1 A VAL 66 ? A VAL 66 42 1 Y 1 A GLY 67 ? A GLY 67 43 1 Y 1 A GLY 68 ? A GLY 68 44 1 Y 1 A ALA 69 ? A ALA 69 45 1 Y 1 A VAL 70 ? A VAL 70 46 1 Y 1 A VAL 71 ? A VAL 71 47 1 Y 1 A THR 72 ? A THR 72 48 1 Y 1 A GLY 73 ? A GLY 73 49 1 Y 1 A VAL 74 ? A VAL 74 50 1 Y 1 A THR 75 ? A THR 75 51 1 Y 1 A ALA 76 ? A ALA 76 52 1 Y 1 A VAL 77 ? A VAL 77 53 1 Y 1 A ALA 78 ? A ALA 78 54 1 Y 1 A GLN 79 ? A GLN 79 55 1 Y 1 A LYS 80 ? A LYS 80 56 1 Y 1 A THR 81 ? A THR 81 57 1 Y 1 A VAL 82 ? A VAL 82 58 1 Y 1 A GLU 83 ? A GLU 83 59 1 Y 1 A GLY 84 ? A GLY 84 60 1 Y 1 A ALA 85 ? A ALA 85 61 1 Y 1 A GLY 86 ? A GLY 86 62 1 Y 1 A SER 87 ? A SER 87 63 1 Y 1 A ILE 88 ? A ILE 88 64 1 Y 1 A ALA 89 ? A ALA 89 65 1 Y 1 A ALA 90 ? A ALA 90 66 1 Y 1 A ALA 91 ? A ALA 91 67 1 Y 1 A THR 92 ? A THR 92 68 1 Y 1 A GLY 93 ? A GLY 93 69 1 Y 1 A PHE 94 ? A PHE 94 70 1 Y 1 A VAL 95 ? A VAL 95 71 1 Y 1 A LYS 96 ? A LYS 96 72 1 Y 1 A LYS 97 ? A LYS 97 73 1 Y 1 A ASP 98 ? A ASP 98 74 1 Y 1 A GLN 99 ? A GLN 99 75 1 Y 1 A LEU 100 ? A LEU 100 76 1 Y 1 A GLY 101 ? A GLY 101 77 1 Y 1 A LYS 102 ? A LYS 102 78 1 Y 1 A ASN 103 ? A ASN 103 79 1 Y 1 A GLU 104 ? A GLU 104 80 1 Y 1 A GLU 105 ? A GLU 105 81 1 Y 1 A GLY 106 ? A GLY 106 82 1 Y 1 A ALA 107 ? A ALA 107 83 1 Y 1 A PRO 108 ? A PRO 108 84 1 Y 1 A GLN 109 ? A GLN 109 85 1 Y 1 A GLU 110 ? A GLU 110 86 1 Y 1 A GLY 111 ? A GLY 111 87 1 Y 1 A ILE 112 ? A ILE 112 88 1 Y 1 A LEU 113 ? A LEU 113 89 1 Y 1 A GLU 114 ? A GLU 114 90 1 Y 1 A ASP 115 ? A ASP 115 91 1 Y 1 A MET 116 ? A MET 116 92 1 Y 1 A PRO 117 ? A PRO 117 93 1 Y 1 A VAL 118 ? A VAL 118 94 1 Y 1 A ASP 119 ? A ASP 119 95 1 Y 1 A PRO 120 ? A PRO 120 96 1 Y 1 A ASP 121 ? A ASP 121 97 1 Y 1 A ASN 122 ? A ASN 122 98 1 Y 1 A GLU 123 ? A GLU 123 99 1 Y 1 A ALA 124 ? A ALA 124 100 1 Y 1 A TYR 125 ? A TYR 125 101 1 Y 1 A GLU 126 ? A GLU 126 102 1 Y 1 A MET 127 ? A MET 127 103 1 Y 1 A PRO 128 ? A PRO 128 104 1 Y 1 A SER 129 ? A SER 129 105 1 Y 1 A GLU 130 ? A GLU 130 106 1 Y 1 A GLU 131 ? A GLU 131 107 1 Y 1 A GLY 132 ? A GLY 132 108 1 Y 1 A TYR 133 ? A TYR 133 109 1 Y 1 A GLN 134 ? A GLN 134 110 1 Y 1 A ASP 135 ? A ASP 135 111 1 Y 1 A TYR 136 ? A TYR 136 112 1 Y 1 A GLU 137 ? A GLU 137 113 1 Y 1 A PRO 138 ? A PRO 138 114 1 Y 1 A GLU 139 ? A GLU 139 115 1 Y 1 A ALA 140 ? A ALA 140 116 2 Y 1 A VAL 26 ? A VAL 26 117 2 Y 1 A ALA 27 ? A ALA 27 118 2 Y 1 A GLU 28 ? A GLU 28 119 2 Y 1 A ALA 29 ? A ALA 29 120 2 Y 1 A ALA 30 ? A ALA 30 121 2 Y 1 A GLY 31 ? A GLY 31 122 2 Y 1 A LYS 32 ? A LYS 32 123 2 Y 1 A THR 33 ? A THR 33 124 2 Y 1 A LYS 34 ? A LYS 34 125 2 Y 1 A GLU 35 ? A GLU 35 126 2 Y 1 A GLY 36 ? A GLY 36 127 2 Y 1 A VAL 37 ? A VAL 37 128 2 Y 1 A LEU 38 ? A LEU 38 129 2 Y 1 A TYR 39 ? A TYR 39 130 2 Y 1 A VAL 40 ? A VAL 40 131 2 Y 1 A GLY 41 ? A GLY 41 132 2 Y 1 A SER 42 ? A SER 42 133 2 Y 1 A LYS 43 ? A LYS 43 134 2 Y 1 A THR 44 ? A THR 44 135 2 Y 1 A LYS 45 ? A LYS 45 136 2 Y 1 A GLU 46 ? A GLU 46 137 2 Y 1 A GLY 47 ? A GLY 47 138 2 Y 1 A VAL 48 ? A VAL 48 139 2 Y 1 A VAL 49 ? A VAL 49 140 2 Y 1 A HIS 50 ? A HIS 50 141 2 Y 1 A GLY 51 ? A GLY 51 142 2 Y 1 A VAL 52 ? A VAL 52 143 2 Y 1 A ALA 53 ? A ALA 53 144 2 Y 1 A THR 54 ? A THR 54 145 2 Y 1 A VAL 55 ? A VAL 55 146 2 Y 1 A ALA 56 ? A ALA 56 147 2 Y 1 A GLU 57 ? A GLU 57 148 2 Y 1 A LYS 58 ? A LYS 58 149 2 Y 1 A THR 59 ? A THR 59 150 2 Y 1 A LYS 60 ? A LYS 60 151 2 Y 1 A GLU 61 ? A GLU 61 152 2 Y 1 A GLN 62 ? A GLN 62 153 2 Y 1 A VAL 63 ? A VAL 63 154 2 Y 1 A THR 64 ? A THR 64 155 2 Y 1 A ASN 65 ? A ASN 65 156 2 Y 1 A VAL 66 ? A VAL 66 157 2 Y 1 A GLY 67 ? A GLY 67 158 2 Y 1 A GLY 68 ? A GLY 68 159 2 Y 1 A ALA 69 ? A ALA 69 160 2 Y 1 A VAL 70 ? A VAL 70 161 2 Y 1 A VAL 71 ? A VAL 71 162 2 Y 1 A THR 72 ? A THR 72 163 2 Y 1 A GLY 73 ? A GLY 73 164 2 Y 1 A VAL 74 ? A VAL 74 165 2 Y 1 A THR 75 ? A THR 75 166 2 Y 1 A ALA 76 ? A ALA 76 167 2 Y 1 A VAL 77 ? A VAL 77 168 2 Y 1 A ALA 78 ? A ALA 78 169 2 Y 1 A GLN 79 ? A GLN 79 170 2 Y 1 A LYS 80 ? A LYS 80 171 2 Y 1 A THR 81 ? A THR 81 172 2 Y 1 A VAL 82 ? A VAL 82 173 2 Y 1 A GLU 83 ? A GLU 83 174 2 Y 1 A GLY 84 ? A GLY 84 175 2 Y 1 A ALA 85 ? A ALA 85 176 2 Y 1 A GLY 86 ? A GLY 86 177 2 Y 1 A SER 87 ? A SER 87 178 2 Y 1 A ILE 88 ? A ILE 88 179 2 Y 1 A ALA 89 ? A ALA 89 180 2 Y 1 A ALA 90 ? A ALA 90 181 2 Y 1 A ALA 91 ? A ALA 91 182 2 Y 1 A THR 92 ? A THR 92 183 2 Y 1 A GLY 93 ? A GLY 93 184 2 Y 1 A PHE 94 ? A PHE 94 185 2 Y 1 A VAL 95 ? A VAL 95 186 2 Y 1 A LYS 96 ? A LYS 96 187 2 Y 1 A LYS 97 ? A LYS 97 188 2 Y 1 A ASP 98 ? A ASP 98 189 2 Y 1 A GLN 99 ? A GLN 99 190 2 Y 1 A LEU 100 ? A LEU 100 191 2 Y 1 A GLY 101 ? A GLY 101 192 2 Y 1 A LYS 102 ? A LYS 102 193 2 Y 1 A ASN 103 ? A ASN 103 194 2 Y 1 A GLU 104 ? A GLU 104 195 2 Y 1 A GLU 105 ? A GLU 105 196 2 Y 1 A GLY 106 ? A GLY 106 197 2 Y 1 A ALA 107 ? A ALA 107 198 2 Y 1 A PRO 108 ? A PRO 108 199 2 Y 1 A GLN 109 ? A GLN 109 200 2 Y 1 A GLU 110 ? A GLU 110 201 2 Y 1 A GLY 111 ? A GLY 111 202 2 Y 1 A ILE 112 ? A ILE 112 203 2 Y 1 A LEU 113 ? A LEU 113 204 2 Y 1 A GLU 114 ? A GLU 114 205 2 Y 1 A ASP 115 ? A ASP 115 206 2 Y 1 A MET 116 ? A MET 116 207 2 Y 1 A PRO 117 ? A PRO 117 208 2 Y 1 A VAL 118 ? A VAL 118 209 2 Y 1 A ASP 119 ? A ASP 119 210 2 Y 1 A PRO 120 ? A PRO 120 211 2 Y 1 A ASP 121 ? A ASP 121 212 2 Y 1 A ASN 122 ? A ASN 122 213 2 Y 1 A GLU 123 ? A GLU 123 214 2 Y 1 A ALA 124 ? A ALA 124 215 2 Y 1 A TYR 125 ? A TYR 125 216 2 Y 1 A GLU 126 ? A GLU 126 217 2 Y 1 A MET 127 ? A MET 127 218 2 Y 1 A PRO 128 ? A PRO 128 219 2 Y 1 A SER 129 ? A SER 129 220 2 Y 1 A GLU 130 ? A GLU 130 221 2 Y 1 A GLU 131 ? A GLU 131 222 2 Y 1 A GLY 132 ? A GLY 132 223 2 Y 1 A TYR 133 ? A TYR 133 224 2 Y 1 A GLN 134 ? A GLN 134 225 2 Y 1 A ASP 135 ? A ASP 135 226 2 Y 1 A TYR 136 ? A TYR 136 227 2 Y 1 A GLU 137 ? A GLU 137 228 2 Y 1 A PRO 138 ? A PRO 138 229 2 Y 1 A GLU 139 ? A GLU 139 230 2 Y 1 A ALA 140 ? A ALA 140 231 3 Y 1 A VAL 26 ? A VAL 26 232 3 Y 1 A ALA 27 ? A ALA 27 233 3 Y 1 A GLU 28 ? A GLU 28 234 3 Y 1 A ALA 29 ? A ALA 29 235 3 Y 1 A ALA 30 ? A ALA 30 236 3 Y 1 A GLY 31 ? A GLY 31 237 3 Y 1 A LYS 32 ? A LYS 32 238 3 Y 1 A THR 33 ? A THR 33 239 3 Y 1 A LYS 34 ? A LYS 34 240 3 Y 1 A GLU 35 ? A GLU 35 241 3 Y 1 A GLY 36 ? A GLY 36 242 3 Y 1 A VAL 37 ? A VAL 37 243 3 Y 1 A LEU 38 ? A LEU 38 244 3 Y 1 A TYR 39 ? A TYR 39 245 3 Y 1 A VAL 40 ? A VAL 40 246 3 Y 1 A GLY 41 ? A GLY 41 247 3 Y 1 A SER 42 ? A SER 42 248 3 Y 1 A LYS 43 ? A LYS 43 249 3 Y 1 A THR 44 ? A THR 44 250 3 Y 1 A LYS 45 ? A LYS 45 251 3 Y 1 A GLU 46 ? A GLU 46 252 3 Y 1 A GLY 47 ? A GLY 47 253 3 Y 1 A VAL 48 ? A VAL 48 254 3 Y 1 A VAL 49 ? A VAL 49 255 3 Y 1 A HIS 50 ? A HIS 50 256 3 Y 1 A GLY 51 ? A GLY 51 257 3 Y 1 A VAL 52 ? A VAL 52 258 3 Y 1 A ALA 53 ? A ALA 53 259 3 Y 1 A THR 54 ? A THR 54 260 3 Y 1 A VAL 55 ? A VAL 55 261 3 Y 1 A ALA 56 ? A ALA 56 262 3 Y 1 A GLU 57 ? A GLU 57 263 3 Y 1 A LYS 58 ? A LYS 58 264 3 Y 1 A THR 59 ? A THR 59 265 3 Y 1 A LYS 60 ? A LYS 60 266 3 Y 1 A GLU 61 ? A GLU 61 267 3 Y 1 A GLN 62 ? A GLN 62 268 3 Y 1 A VAL 63 ? A VAL 63 269 3 Y 1 A THR 64 ? A THR 64 270 3 Y 1 A ASN 65 ? A ASN 65 271 3 Y 1 A VAL 66 ? A VAL 66 272 3 Y 1 A GLY 67 ? A GLY 67 273 3 Y 1 A GLY 68 ? A GLY 68 274 3 Y 1 A ALA 69 ? A ALA 69 275 3 Y 1 A VAL 70 ? A VAL 70 276 3 Y 1 A VAL 71 ? A VAL 71 277 3 Y 1 A THR 72 ? A THR 72 278 3 Y 1 A GLY 73 ? A GLY 73 279 3 Y 1 A VAL 74 ? A VAL 74 280 3 Y 1 A THR 75 ? A THR 75 281 3 Y 1 A ALA 76 ? A ALA 76 282 3 Y 1 A VAL 77 ? A VAL 77 283 3 Y 1 A ALA 78 ? A ALA 78 284 3 Y 1 A GLN 79 ? A GLN 79 285 3 Y 1 A LYS 80 ? A LYS 80 286 3 Y 1 A THR 81 ? A THR 81 287 3 Y 1 A VAL 82 ? A VAL 82 288 3 Y 1 A GLU 83 ? A GLU 83 289 3 Y 1 A GLY 84 ? A GLY 84 290 3 Y 1 A ALA 85 ? A ALA 85 291 3 Y 1 A GLY 86 ? A GLY 86 292 3 Y 1 A SER 87 ? A SER 87 293 3 Y 1 A ILE 88 ? A ILE 88 294 3 Y 1 A ALA 89 ? A ALA 89 295 3 Y 1 A ALA 90 ? A ALA 90 296 3 Y 1 A ALA 91 ? A ALA 91 297 3 Y 1 A THR 92 ? A THR 92 298 3 Y 1 A GLY 93 ? A GLY 93 299 3 Y 1 A PHE 94 ? A PHE 94 300 3 Y 1 A VAL 95 ? A VAL 95 301 3 Y 1 A LYS 96 ? A LYS 96 302 3 Y 1 A LYS 97 ? A LYS 97 303 3 Y 1 A ASP 98 ? A ASP 98 304 3 Y 1 A GLN 99 ? A GLN 99 305 3 Y 1 A LEU 100 ? A LEU 100 306 3 Y 1 A GLY 101 ? A GLY 101 307 3 Y 1 A LYS 102 ? A LYS 102 308 3 Y 1 A ASN 103 ? A ASN 103 309 3 Y 1 A GLU 104 ? A GLU 104 310 3 Y 1 A GLU 105 ? A GLU 105 311 3 Y 1 A GLY 106 ? A GLY 106 312 3 Y 1 A ALA 107 ? A ALA 107 313 3 Y 1 A PRO 108 ? A PRO 108 314 3 Y 1 A GLN 109 ? A GLN 109 315 3 Y 1 A GLU 110 ? A GLU 110 316 3 Y 1 A GLY 111 ? A GLY 111 317 3 Y 1 A ILE 112 ? A ILE 112 318 3 Y 1 A LEU 113 ? A LEU 113 319 3 Y 1 A GLU 114 ? A GLU 114 320 3 Y 1 A ASP 115 ? A ASP 115 321 3 Y 1 A MET 116 ? A MET 116 322 3 Y 1 A PRO 117 ? A PRO 117 323 3 Y 1 A VAL 118 ? A VAL 118 324 3 Y 1 A ASP 119 ? A ASP 119 325 3 Y 1 A PRO 120 ? A PRO 120 326 3 Y 1 A ASP 121 ? A ASP 121 327 3 Y 1 A ASN 122 ? A ASN 122 328 3 Y 1 A GLU 123 ? A GLU 123 329 3 Y 1 A ALA 124 ? A ALA 124 330 3 Y 1 A TYR 125 ? A TYR 125 331 3 Y 1 A GLU 126 ? A GLU 126 332 3 Y 1 A MET 127 ? A MET 127 333 3 Y 1 A PRO 128 ? A PRO 128 334 3 Y 1 A SER 129 ? A SER 129 335 3 Y 1 A GLU 130 ? A GLU 130 336 3 Y 1 A GLU 131 ? A GLU 131 337 3 Y 1 A GLY 132 ? A GLY 132 338 3 Y 1 A TYR 133 ? A TYR 133 339 3 Y 1 A GLN 134 ? A GLN 134 340 3 Y 1 A ASP 135 ? A ASP 135 341 3 Y 1 A TYR 136 ? A TYR 136 342 3 Y 1 A GLU 137 ? A GLU 137 343 3 Y 1 A PRO 138 ? A PRO 138 344 3 Y 1 A GLU 139 ? A GLU 139 345 3 Y 1 A ALA 140 ? A ALA 140 346 4 Y 1 A VAL 26 ? A VAL 26 347 4 Y 1 A ALA 27 ? A ALA 27 348 4 Y 1 A GLU 28 ? A GLU 28 349 4 Y 1 A ALA 29 ? A ALA 29 350 4 Y 1 A ALA 30 ? A ALA 30 351 4 Y 1 A GLY 31 ? A GLY 31 352 4 Y 1 A LYS 32 ? A LYS 32 353 4 Y 1 A THR 33 ? A THR 33 354 4 Y 1 A LYS 34 ? A LYS 34 355 4 Y 1 A GLU 35 ? A GLU 35 356 4 Y 1 A GLY 36 ? A GLY 36 357 4 Y 1 A VAL 37 ? A VAL 37 358 4 Y 1 A LEU 38 ? A LEU 38 359 4 Y 1 A TYR 39 ? A TYR 39 360 4 Y 1 A VAL 40 ? A VAL 40 361 4 Y 1 A GLY 41 ? A GLY 41 362 4 Y 1 A SER 42 ? A SER 42 363 4 Y 1 A LYS 43 ? A LYS 43 364 4 Y 1 A THR 44 ? A THR 44 365 4 Y 1 A LYS 45 ? A LYS 45 366 4 Y 1 A GLU 46 ? A GLU 46 367 4 Y 1 A GLY 47 ? A GLY 47 368 4 Y 1 A VAL 48 ? A VAL 48 369 4 Y 1 A VAL 49 ? A VAL 49 370 4 Y 1 A HIS 50 ? A HIS 50 371 4 Y 1 A GLY 51 ? A GLY 51 372 4 Y 1 A VAL 52 ? A VAL 52 373 4 Y 1 A ALA 53 ? A ALA 53 374 4 Y 1 A THR 54 ? A THR 54 375 4 Y 1 A VAL 55 ? A VAL 55 376 4 Y 1 A ALA 56 ? A ALA 56 377 4 Y 1 A GLU 57 ? A GLU 57 378 4 Y 1 A LYS 58 ? A LYS 58 379 4 Y 1 A THR 59 ? A THR 59 380 4 Y 1 A LYS 60 ? A LYS 60 381 4 Y 1 A GLU 61 ? A GLU 61 382 4 Y 1 A GLN 62 ? A GLN 62 383 4 Y 1 A VAL 63 ? A VAL 63 384 4 Y 1 A THR 64 ? A THR 64 385 4 Y 1 A ASN 65 ? A ASN 65 386 4 Y 1 A VAL 66 ? A VAL 66 387 4 Y 1 A GLY 67 ? A GLY 67 388 4 Y 1 A GLY 68 ? A GLY 68 389 4 Y 1 A ALA 69 ? A ALA 69 390 4 Y 1 A VAL 70 ? A VAL 70 391 4 Y 1 A VAL 71 ? A VAL 71 392 4 Y 1 A THR 72 ? A THR 72 393 4 Y 1 A GLY 73 ? A GLY 73 394 4 Y 1 A VAL 74 ? A VAL 74 395 4 Y 1 A THR 75 ? A THR 75 396 4 Y 1 A ALA 76 ? A ALA 76 397 4 Y 1 A VAL 77 ? A VAL 77 398 4 Y 1 A ALA 78 ? A ALA 78 399 4 Y 1 A GLN 79 ? A GLN 79 400 4 Y 1 A LYS 80 ? A LYS 80 401 4 Y 1 A THR 81 ? A THR 81 402 4 Y 1 A VAL 82 ? A VAL 82 403 4 Y 1 A GLU 83 ? A GLU 83 404 4 Y 1 A GLY 84 ? A GLY 84 405 4 Y 1 A ALA 85 ? A ALA 85 406 4 Y 1 A GLY 86 ? A GLY 86 407 4 Y 1 A SER 87 ? A SER 87 408 4 Y 1 A ILE 88 ? A ILE 88 409 4 Y 1 A ALA 89 ? A ALA 89 410 4 Y 1 A ALA 90 ? A ALA 90 411 4 Y 1 A ALA 91 ? A ALA 91 412 4 Y 1 A THR 92 ? A THR 92 413 4 Y 1 A GLY 93 ? A GLY 93 414 4 Y 1 A PHE 94 ? A PHE 94 415 4 Y 1 A VAL 95 ? A VAL 95 416 4 Y 1 A LYS 96 ? A LYS 96 417 4 Y 1 A LYS 97 ? A LYS 97 418 4 Y 1 A ASP 98 ? A ASP 98 419 4 Y 1 A GLN 99 ? A GLN 99 420 4 Y 1 A LEU 100 ? A LEU 100 421 4 Y 1 A GLY 101 ? A GLY 101 422 4 Y 1 A LYS 102 ? A LYS 102 423 4 Y 1 A ASN 103 ? A ASN 103 424 4 Y 1 A GLU 104 ? A GLU 104 425 4 Y 1 A GLU 105 ? A GLU 105 426 4 Y 1 A GLY 106 ? A GLY 106 427 4 Y 1 A ALA 107 ? A ALA 107 428 4 Y 1 A PRO 108 ? A PRO 108 429 4 Y 1 A GLN 109 ? A GLN 109 430 4 Y 1 A GLU 110 ? A GLU 110 431 4 Y 1 A GLY 111 ? A GLY 111 432 4 Y 1 A ILE 112 ? A ILE 112 433 4 Y 1 A LEU 113 ? A LEU 113 434 4 Y 1 A GLU 114 ? A GLU 114 435 4 Y 1 A ASP 115 ? A ASP 115 436 4 Y 1 A MET 116 ? A MET 116 437 4 Y 1 A PRO 117 ? A PRO 117 438 4 Y 1 A VAL 118 ? A VAL 118 439 4 Y 1 A ASP 119 ? A ASP 119 440 4 Y 1 A PRO 120 ? A PRO 120 441 4 Y 1 A ASP 121 ? A ASP 121 442 4 Y 1 A ASN 122 ? A ASN 122 443 4 Y 1 A GLU 123 ? A GLU 123 444 4 Y 1 A ALA 124 ? A ALA 124 445 4 Y 1 A TYR 125 ? A TYR 125 446 4 Y 1 A GLU 126 ? A GLU 126 447 4 Y 1 A MET 127 ? A MET 127 448 4 Y 1 A PRO 128 ? A PRO 128 449 4 Y 1 A SER 129 ? A SER 129 450 4 Y 1 A GLU 130 ? A GLU 130 451 4 Y 1 A GLU 131 ? A GLU 131 452 4 Y 1 A GLY 132 ? A GLY 132 453 4 Y 1 A TYR 133 ? A TYR 133 454 4 Y 1 A GLN 134 ? A GLN 134 455 4 Y 1 A ASP 135 ? A ASP 135 456 4 Y 1 A TYR 136 ? A TYR 136 457 4 Y 1 A GLU 137 ? A GLU 137 458 4 Y 1 A PRO 138 ? A PRO 138 459 4 Y 1 A GLU 139 ? A GLU 139 460 4 Y 1 A ALA 140 ? A ALA 140 461 5 Y 1 A VAL 26 ? A VAL 26 462 5 Y 1 A ALA 27 ? A ALA 27 463 5 Y 1 A GLU 28 ? A GLU 28 464 5 Y 1 A ALA 29 ? A ALA 29 465 5 Y 1 A ALA 30 ? A ALA 30 466 5 Y 1 A GLY 31 ? A GLY 31 467 5 Y 1 A LYS 32 ? A LYS 32 468 5 Y 1 A THR 33 ? A THR 33 469 5 Y 1 A LYS 34 ? A LYS 34 470 5 Y 1 A GLU 35 ? A GLU 35 471 5 Y 1 A GLY 36 ? A GLY 36 472 5 Y 1 A VAL 37 ? A VAL 37 473 5 Y 1 A LEU 38 ? A LEU 38 474 5 Y 1 A TYR 39 ? A TYR 39 475 5 Y 1 A VAL 40 ? A VAL 40 476 5 Y 1 A GLY 41 ? A GLY 41 477 5 Y 1 A SER 42 ? A SER 42 478 5 Y 1 A LYS 43 ? A LYS 43 479 5 Y 1 A THR 44 ? A THR 44 480 5 Y 1 A LYS 45 ? A LYS 45 481 5 Y 1 A GLU 46 ? A GLU 46 482 5 Y 1 A GLY 47 ? A GLY 47 483 5 Y 1 A VAL 48 ? A VAL 48 484 5 Y 1 A VAL 49 ? A VAL 49 485 5 Y 1 A HIS 50 ? A HIS 50 486 5 Y 1 A GLY 51 ? A GLY 51 487 5 Y 1 A VAL 52 ? A VAL 52 488 5 Y 1 A ALA 53 ? A ALA 53 489 5 Y 1 A THR 54 ? A THR 54 490 5 Y 1 A VAL 55 ? A VAL 55 491 5 Y 1 A ALA 56 ? A ALA 56 492 5 Y 1 A GLU 57 ? A GLU 57 493 5 Y 1 A LYS 58 ? A LYS 58 494 5 Y 1 A THR 59 ? A THR 59 495 5 Y 1 A LYS 60 ? A LYS 60 496 5 Y 1 A GLU 61 ? A GLU 61 497 5 Y 1 A GLN 62 ? A GLN 62 498 5 Y 1 A VAL 63 ? A VAL 63 499 5 Y 1 A THR 64 ? A THR 64 500 5 Y 1 A ASN 65 ? A ASN 65 501 5 Y 1 A VAL 66 ? A VAL 66 502 5 Y 1 A GLY 67 ? A GLY 67 503 5 Y 1 A GLY 68 ? A GLY 68 504 5 Y 1 A ALA 69 ? A ALA 69 505 5 Y 1 A VAL 70 ? A VAL 70 506 5 Y 1 A VAL 71 ? A VAL 71 507 5 Y 1 A THR 72 ? A THR 72 508 5 Y 1 A GLY 73 ? A GLY 73 509 5 Y 1 A VAL 74 ? A VAL 74 510 5 Y 1 A THR 75 ? A THR 75 511 5 Y 1 A ALA 76 ? A ALA 76 512 5 Y 1 A VAL 77 ? A VAL 77 513 5 Y 1 A ALA 78 ? A ALA 78 514 5 Y 1 A GLN 79 ? A GLN 79 515 5 Y 1 A LYS 80 ? A LYS 80 516 5 Y 1 A THR 81 ? A THR 81 517 5 Y 1 A VAL 82 ? A VAL 82 518 5 Y 1 A GLU 83 ? A GLU 83 519 5 Y 1 A GLY 84 ? A GLY 84 520 5 Y 1 A ALA 85 ? A ALA 85 521 5 Y 1 A GLY 86 ? A GLY 86 522 5 Y 1 A SER 87 ? A SER 87 523 5 Y 1 A ILE 88 ? A ILE 88 524 5 Y 1 A ALA 89 ? A ALA 89 525 5 Y 1 A ALA 90 ? A ALA 90 526 5 Y 1 A ALA 91 ? A ALA 91 527 5 Y 1 A THR 92 ? A THR 92 528 5 Y 1 A GLY 93 ? A GLY 93 529 5 Y 1 A PHE 94 ? A PHE 94 530 5 Y 1 A VAL 95 ? A VAL 95 531 5 Y 1 A LYS 96 ? A LYS 96 532 5 Y 1 A LYS 97 ? A LYS 97 533 5 Y 1 A ASP 98 ? A ASP 98 534 5 Y 1 A GLN 99 ? A GLN 99 535 5 Y 1 A LEU 100 ? A LEU 100 536 5 Y 1 A GLY 101 ? A GLY 101 537 5 Y 1 A LYS 102 ? A LYS 102 538 5 Y 1 A ASN 103 ? A ASN 103 539 5 Y 1 A GLU 104 ? A GLU 104 540 5 Y 1 A GLU 105 ? A GLU 105 541 5 Y 1 A GLY 106 ? A GLY 106 542 5 Y 1 A ALA 107 ? A ALA 107 543 5 Y 1 A PRO 108 ? A PRO 108 544 5 Y 1 A GLN 109 ? A GLN 109 545 5 Y 1 A GLU 110 ? A GLU 110 546 5 Y 1 A GLY 111 ? A GLY 111 547 5 Y 1 A ILE 112 ? A ILE 112 548 5 Y 1 A LEU 113 ? A LEU 113 549 5 Y 1 A GLU 114 ? A GLU 114 550 5 Y 1 A ASP 115 ? A ASP 115 551 5 Y 1 A MET 116 ? A MET 116 552 5 Y 1 A PRO 117 ? A PRO 117 553 5 Y 1 A VAL 118 ? A VAL 118 554 5 Y 1 A ASP 119 ? A ASP 119 555 5 Y 1 A PRO 120 ? A PRO 120 556 5 Y 1 A ASP 121 ? A ASP 121 557 5 Y 1 A ASN 122 ? A ASN 122 558 5 Y 1 A GLU 123 ? A GLU 123 559 5 Y 1 A ALA 124 ? A ALA 124 560 5 Y 1 A TYR 125 ? A TYR 125 561 5 Y 1 A GLU 126 ? A GLU 126 562 5 Y 1 A MET 127 ? A MET 127 563 5 Y 1 A PRO 128 ? A PRO 128 564 5 Y 1 A SER 129 ? A SER 129 565 5 Y 1 A GLU 130 ? A GLU 130 566 5 Y 1 A GLU 131 ? A GLU 131 567 5 Y 1 A GLY 132 ? A GLY 132 568 5 Y 1 A TYR 133 ? A TYR 133 569 5 Y 1 A GLN 134 ? A GLN 134 570 5 Y 1 A ASP 135 ? A ASP 135 571 5 Y 1 A TYR 136 ? A TYR 136 572 5 Y 1 A GLU 137 ? A GLU 137 573 5 Y 1 A PRO 138 ? A PRO 138 574 5 Y 1 A GLU 139 ? A GLU 139 575 5 Y 1 A ALA 140 ? A ALA 140 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ASN N N N N 14 ASN CA C N S 15 ASN C C N N 16 ASN O O N N 17 ASN CB C N N 18 ASN CG C N N 19 ASN OD1 O N N 20 ASN ND2 N N N 21 ASN OXT O N N 22 ASN H H N N 23 ASN H2 H N N 24 ASN HA H N N 25 ASN HB2 H N N 26 ASN HB3 H N N 27 ASN HD21 H N N 28 ASN HD22 H N N 29 ASN HXT H N N 30 ASP N N N N 31 ASP CA C N S 32 ASP C C N N 33 ASP O O N N 34 ASP CB C N N 35 ASP CG C N N 36 ASP OD1 O N N 37 ASP OD2 O N N 38 ASP OXT O N N 39 ASP H H N N 40 ASP H2 H N N 41 ASP HA H N N 42 ASP HB2 H N N 43 ASP HB3 H N N 44 ASP HD2 H N N 45 ASP HXT H N N 46 CU CU CU N N 47 GLN N N N N 48 GLN CA C N S 49 GLN C C N N 50 GLN O O N N 51 GLN CB C N N 52 GLN CG C N N 53 GLN CD C N N 54 GLN OE1 O N N 55 GLN NE2 N N N 56 GLN OXT O N N 57 GLN H H N N 58 GLN H2 H N N 59 GLN HA H N N 60 GLN HB2 H N N 61 GLN HB3 H N N 62 GLN HG2 H N N 63 GLN HG3 H N N 64 GLN HE21 H N N 65 GLN HE22 H N N 66 GLN HXT H N N 67 GLU N N N N 68 GLU CA C N S 69 GLU C C N N 70 GLU O O N N 71 GLU CB C N N 72 GLU CG C N N 73 GLU CD C N N 74 GLU OE1 O N N 75 GLU OE2 O N N 76 GLU OXT O N N 77 GLU H H N N 78 GLU H2 H N N 79 GLU HA H N N 80 GLU HB2 H N N 81 GLU HB3 H N N 82 GLU HG2 H N N 83 GLU HG3 H N N 84 GLU HE2 H N N 85 GLU HXT H N N 86 GLY N N N N 87 GLY CA C N N 88 GLY C C N N 89 GLY O O N N 90 GLY OXT O N N 91 GLY H H N N 92 GLY H2 H N N 93 GLY HA2 H N N 94 GLY HA3 H N N 95 GLY HXT H N N 96 HIS N N N N 97 HIS CA C N S 98 HIS C C N N 99 HIS O O N N 100 HIS CB C N N 101 HIS CG C Y N 102 HIS ND1 N Y N 103 HIS CD2 C Y N 104 HIS CE1 C Y N 105 HIS NE2 N Y N 106 HIS OXT O N N 107 HIS H H N N 108 HIS H2 H N N 109 HIS HA H N N 110 HIS HB2 H N N 111 HIS HB3 H N N 112 HIS HD1 H N N 113 HIS HD2 H N N 114 HIS HE1 H N N 115 HIS HE2 H N N 116 HIS HXT H N N 117 HOH O O N N 118 HOH H1 H N N 119 HOH H2 H N N 120 ILE N N N N 121 ILE CA C N S 122 ILE C C N N 123 ILE O O N N 124 ILE CB C N S 125 ILE CG1 C N N 126 ILE CG2 C N N 127 ILE CD1 C N N 128 ILE OXT O N N 129 ILE H H N N 130 ILE H2 H N N 131 ILE HA H N N 132 ILE HB H N N 133 ILE HG12 H N N 134 ILE HG13 H N N 135 ILE HG21 H N N 136 ILE HG22 H N N 137 ILE HG23 H N N 138 ILE HD11 H N N 139 ILE HD12 H N N 140 ILE HD13 H N N 141 ILE HXT H N N 142 LEU N N N N 143 LEU CA C N S 144 LEU C C N N 145 LEU O O N N 146 LEU CB C N N 147 LEU CG C N N 148 LEU CD1 C N N 149 LEU CD2 C N N 150 LEU OXT O N N 151 LEU H H N N 152 LEU H2 H N N 153 LEU HA H N N 154 LEU HB2 H N N 155 LEU HB3 H N N 156 LEU HG H N N 157 LEU HD11 H N N 158 LEU HD12 H N N 159 LEU HD13 H N N 160 LEU HD21 H N N 161 LEU HD22 H N N 162 LEU HD23 H N N 163 LEU HXT H N N 164 LYS N N N N 165 LYS CA C N S 166 LYS C C N N 167 LYS O O N N 168 LYS CB C N N 169 LYS CG C N N 170 LYS CD C N N 171 LYS CE C N N 172 LYS NZ N N N 173 LYS OXT O N N 174 LYS H H N N 175 LYS H2 H N N 176 LYS HA H N N 177 LYS HB2 H N N 178 LYS HB3 H N N 179 LYS HG2 H N N 180 LYS HG3 H N N 181 LYS HD2 H N N 182 LYS HD3 H N N 183 LYS HE2 H N N 184 LYS HE3 H N N 185 LYS HZ1 H N N 186 LYS HZ2 H N N 187 LYS HZ3 H N N 188 LYS HXT H N N 189 MET N N N N 190 MET CA C N S 191 MET C C N N 192 MET O O N N 193 MET CB C N N 194 MET CG C N N 195 MET SD S N N 196 MET CE C N N 197 MET OXT O N N 198 MET H H N N 199 MET H2 H N N 200 MET HA H N N 201 MET HB2 H N N 202 MET HB3 H N N 203 MET HG2 H N N 204 MET HG3 H N N 205 MET HE1 H N N 206 MET HE2 H N N 207 MET HE3 H N N 208 MET HXT H N N 209 PHE N N N N 210 PHE CA C N S 211 PHE C C N N 212 PHE O O N N 213 PHE CB C N N 214 PHE CG C Y N 215 PHE CD1 C Y N 216 PHE CD2 C Y N 217 PHE CE1 C Y N 218 PHE CE2 C Y N 219 PHE CZ C Y N 220 PHE OXT O N N 221 PHE H H N N 222 PHE H2 H N N 223 PHE HA H N N 224 PHE HB2 H N N 225 PHE HB3 H N N 226 PHE HD1 H N N 227 PHE HD2 H N N 228 PHE HE1 H N N 229 PHE HE2 H N N 230 PHE HZ H N N 231 PHE HXT H N N 232 PRO N N N N 233 PRO CA C N S 234 PRO C C N N 235 PRO O O N N 236 PRO CB C N N 237 PRO CG C N N 238 PRO CD C N N 239 PRO OXT O N N 240 PRO H H N N 241 PRO HA H N N 242 PRO HB2 H N N 243 PRO HB3 H N N 244 PRO HG2 H N N 245 PRO HG3 H N N 246 PRO HD2 H N N 247 PRO HD3 H N N 248 PRO HXT H N N 249 SER N N N N 250 SER CA C N S 251 SER C C N N 252 SER O O N N 253 SER CB C N N 254 SER OG O N N 255 SER OXT O N N 256 SER H H N N 257 SER H2 H N N 258 SER HA H N N 259 SER HB2 H N N 260 SER HB3 H N N 261 SER HG H N N 262 SER HXT H N N 263 THR N N N N 264 THR CA C N S 265 THR C C N N 266 THR O O N N 267 THR CB C N R 268 THR OG1 O N N 269 THR CG2 C N N 270 THR OXT O N N 271 THR H H N N 272 THR H2 H N N 273 THR HA H N N 274 THR HB H N N 275 THR HG1 H N N 276 THR HG21 H N N 277 THR HG22 H N N 278 THR HG23 H N N 279 THR HXT H N N 280 TYR N N N N 281 TYR CA C N S 282 TYR C C N N 283 TYR O O N N 284 TYR CB C N N 285 TYR CG C Y N 286 TYR CD1 C Y N 287 TYR CD2 C Y N 288 TYR CE1 C Y N 289 TYR CE2 C Y N 290 TYR CZ C Y N 291 TYR OH O N N 292 TYR OXT O N N 293 TYR H H N N 294 TYR H2 H N N 295 TYR HA H N N 296 TYR HB2 H N N 297 TYR HB3 H N N 298 TYR HD1 H N N 299 TYR HD2 H N N 300 TYR HE1 H N N 301 TYR HE2 H N N 302 TYR HH H N N 303 TYR HXT H N N 304 VAL N N N N 305 VAL CA C N S 306 VAL C C N N 307 VAL O O N N 308 VAL CB C N N 309 VAL CG1 C N N 310 VAL CG2 C N N 311 VAL OXT O N N 312 VAL H H N N 313 VAL H2 H N N 314 VAL HA H N N 315 VAL HB H N N 316 VAL HG11 H N N 317 VAL HG12 H N N 318 VAL HG13 H N N 319 VAL HG21 H N N 320 VAL HG22 H N N 321 VAL HG23 H N N 322 VAL HXT H N N 323 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ASN N CA sing N N 13 ASN N H sing N N 14 ASN N H2 sing N N 15 ASN CA C sing N N 16 ASN CA CB sing N N 17 ASN CA HA sing N N 18 ASN C O doub N N 19 ASN C OXT sing N N 20 ASN CB CG sing N N 21 ASN CB HB2 sing N N 22 ASN CB HB3 sing N N 23 ASN CG OD1 doub N N 24 ASN CG ND2 sing N N 25 ASN ND2 HD21 sing N N 26 ASN ND2 HD22 sing N N 27 ASN OXT HXT sing N N 28 ASP N CA sing N N 29 ASP N H sing N N 30 ASP N H2 sing N N 31 ASP CA C sing N N 32 ASP CA CB sing N N 33 ASP CA HA sing N N 34 ASP C O doub N N 35 ASP C OXT sing N N 36 ASP CB CG sing N N 37 ASP CB HB2 sing N N 38 ASP CB HB3 sing N N 39 ASP CG OD1 doub N N 40 ASP CG OD2 sing N N 41 ASP OD2 HD2 sing N N 42 ASP OXT HXT sing N N 43 GLN N CA sing N N 44 GLN N H sing N N 45 GLN N H2 sing N N 46 GLN CA C sing N N 47 GLN CA CB sing N N 48 GLN CA HA sing N N 49 GLN C O doub N N 50 GLN C OXT sing N N 51 GLN CB CG sing N N 52 GLN CB HB2 sing N N 53 GLN CB HB3 sing N N 54 GLN CG CD sing N N 55 GLN CG HG2 sing N N 56 GLN CG HG3 sing N N 57 GLN CD OE1 doub N N 58 GLN CD NE2 sing N N 59 GLN NE2 HE21 sing N N 60 GLN NE2 HE22 sing N N 61 GLN OXT HXT sing N N 62 GLU N CA sing N N 63 GLU N H sing N N 64 GLU N H2 sing N N 65 GLU CA C sing N N 66 GLU CA CB sing N N 67 GLU CA HA sing N N 68 GLU C O doub N N 69 GLU C OXT sing N N 70 GLU CB CG sing N N 71 GLU CB HB2 sing N N 72 GLU CB HB3 sing N N 73 GLU CG CD sing N N 74 GLU CG HG2 sing N N 75 GLU CG HG3 sing N N 76 GLU CD OE1 doub N N 77 GLU CD OE2 sing N N 78 GLU OE2 HE2 sing N N 79 GLU OXT HXT sing N N 80 GLY N CA sing N N 81 GLY N H sing N N 82 GLY N H2 sing N N 83 GLY CA C sing N N 84 GLY CA HA2 sing N N 85 GLY CA HA3 sing N N 86 GLY C O doub N N 87 GLY C OXT sing N N 88 GLY OXT HXT sing N N 89 HIS N CA sing N N 90 HIS N H sing N N 91 HIS N H2 sing N N 92 HIS CA C sing N N 93 HIS CA CB sing N N 94 HIS CA HA sing N N 95 HIS C O doub N N 96 HIS C OXT sing N N 97 HIS CB CG sing N N 98 HIS CB HB2 sing N N 99 HIS CB HB3 sing N N 100 HIS CG ND1 sing Y N 101 HIS CG CD2 doub Y N 102 HIS ND1 CE1 doub Y N 103 HIS ND1 HD1 sing N N 104 HIS CD2 NE2 sing Y N 105 HIS CD2 HD2 sing N N 106 HIS CE1 NE2 sing Y N 107 HIS CE1 HE1 sing N N 108 HIS NE2 HE2 sing N N 109 HIS OXT HXT sing N N 110 HOH O H1 sing N N 111 HOH O H2 sing N N 112 ILE N CA sing N N 113 ILE N H sing N N 114 ILE N H2 sing N N 115 ILE CA C sing N N 116 ILE CA CB sing N N 117 ILE CA HA sing N N 118 ILE C O doub N N 119 ILE C OXT sing N N 120 ILE CB CG1 sing N N 121 ILE CB CG2 sing N N 122 ILE CB HB sing N N 123 ILE CG1 CD1 sing N N 124 ILE CG1 HG12 sing N N 125 ILE CG1 HG13 sing N N 126 ILE CG2 HG21 sing N N 127 ILE CG2 HG22 sing N N 128 ILE CG2 HG23 sing N N 129 ILE CD1 HD11 sing N N 130 ILE CD1 HD12 sing N N 131 ILE CD1 HD13 sing N N 132 ILE OXT HXT sing N N 133 LEU N CA sing N N 134 LEU N H sing N N 135 LEU N H2 sing N N 136 LEU CA C sing N N 137 LEU CA CB sing N N 138 LEU CA HA sing N N 139 LEU C O doub N N 140 LEU C OXT sing N N 141 LEU CB CG sing N N 142 LEU CB HB2 sing N N 143 LEU CB HB3 sing N N 144 LEU CG CD1 sing N N 145 LEU CG CD2 sing N N 146 LEU CG HG sing N N 147 LEU CD1 HD11 sing N N 148 LEU CD1 HD12 sing N N 149 LEU CD1 HD13 sing N N 150 LEU CD2 HD21 sing N N 151 LEU CD2 HD22 sing N N 152 LEU CD2 HD23 sing N N 153 LEU OXT HXT sing N N 154 LYS N CA sing N N 155 LYS N H sing N N 156 LYS N H2 sing N N 157 LYS CA C sing N N 158 LYS CA CB sing N N 159 LYS CA HA sing N N 160 LYS C O doub N N 161 LYS C OXT sing N N 162 LYS CB CG sing N N 163 LYS CB HB2 sing N N 164 LYS CB HB3 sing N N 165 LYS CG CD sing N N 166 LYS CG HG2 sing N N 167 LYS CG HG3 sing N N 168 LYS CD CE sing N N 169 LYS CD HD2 sing N N 170 LYS CD HD3 sing N N 171 LYS CE NZ sing N N 172 LYS CE HE2 sing N N 173 LYS CE HE3 sing N N 174 LYS NZ HZ1 sing N N 175 LYS NZ HZ2 sing N N 176 LYS NZ HZ3 sing N N 177 LYS OXT HXT sing N N 178 MET N CA sing N N 179 MET N H sing N N 180 MET N H2 sing N N 181 MET CA C sing N N 182 MET CA CB sing N N 183 MET CA HA sing N N 184 MET C O doub N N 185 MET C OXT sing N N 186 MET CB CG sing N N 187 MET CB HB2 sing N N 188 MET CB HB3 sing N N 189 MET CG SD sing N N 190 MET CG HG2 sing N N 191 MET CG HG3 sing N N 192 MET SD CE sing N N 193 MET CE HE1 sing N N 194 MET CE HE2 sing N N 195 MET CE HE3 sing N N 196 MET OXT HXT sing N N 197 PHE N CA sing N N 198 PHE N H sing N N 199 PHE N H2 sing N N 200 PHE CA C sing N N 201 PHE CA CB sing N N 202 PHE CA HA sing N N 203 PHE C O doub N N 204 PHE C OXT sing N N 205 PHE CB CG sing N N 206 PHE CB HB2 sing N N 207 PHE CB HB3 sing N N 208 PHE CG CD1 doub Y N 209 PHE CG CD2 sing Y N 210 PHE CD1 CE1 sing Y N 211 PHE CD1 HD1 sing N N 212 PHE CD2 CE2 doub Y N 213 PHE CD2 HD2 sing N N 214 PHE CE1 CZ doub Y N 215 PHE CE1 HE1 sing N N 216 PHE CE2 CZ sing Y N 217 PHE CE2 HE2 sing N N 218 PHE CZ HZ sing N N 219 PHE OXT HXT sing N N 220 PRO N CA sing N N 221 PRO N CD sing N N 222 PRO N H sing N N 223 PRO CA C sing N N 224 PRO CA CB sing N N 225 PRO CA HA sing N N 226 PRO C O doub N N 227 PRO C OXT sing N N 228 PRO CB CG sing N N 229 PRO CB HB2 sing N N 230 PRO CB HB3 sing N N 231 PRO CG CD sing N N 232 PRO CG HG2 sing N N 233 PRO CG HG3 sing N N 234 PRO CD HD2 sing N N 235 PRO CD HD3 sing N N 236 PRO OXT HXT sing N N 237 SER N CA sing N N 238 SER N H sing N N 239 SER N H2 sing N N 240 SER CA C sing N N 241 SER CA CB sing N N 242 SER CA HA sing N N 243 SER C O doub N N 244 SER C OXT sing N N 245 SER CB OG sing N N 246 SER CB HB2 sing N N 247 SER CB HB3 sing N N 248 SER OG HG sing N N 249 SER OXT HXT sing N N 250 THR N CA sing N N 251 THR N H sing N N 252 THR N H2 sing N N 253 THR CA C sing N N 254 THR CA CB sing N N 255 THR CA HA sing N N 256 THR C O doub N N 257 THR C OXT sing N N 258 THR CB OG1 sing N N 259 THR CB CG2 sing N N 260 THR CB HB sing N N 261 THR OG1 HG1 sing N N 262 THR CG2 HG21 sing N N 263 THR CG2 HG22 sing N N 264 THR CG2 HG23 sing N N 265 THR OXT HXT sing N N 266 TYR N CA sing N N 267 TYR N H sing N N 268 TYR N H2 sing N N 269 TYR CA C sing N N 270 TYR CA CB sing N N 271 TYR CA HA sing N N 272 TYR C O doub N N 273 TYR C OXT sing N N 274 TYR CB CG sing N N 275 TYR CB HB2 sing N N 276 TYR CB HB3 sing N N 277 TYR CG CD1 doub Y N 278 TYR CG CD2 sing Y N 279 TYR CD1 CE1 sing Y N 280 TYR CD1 HD1 sing N N 281 TYR CD2 CE2 doub Y N 282 TYR CD2 HD2 sing N N 283 TYR CE1 CZ doub Y N 284 TYR CE1 HE1 sing N N 285 TYR CE2 CZ sing Y N 286 TYR CE2 HE2 sing N N 287 TYR CZ OH sing N N 288 TYR OH HH sing N N 289 TYR OXT HXT sing N N 290 VAL N CA sing N N 291 VAL N H sing N N 292 VAL N H2 sing N N 293 VAL CA C sing N N 294 VAL CA CB sing N N 295 VAL CA HA sing N N 296 VAL C O doub N N 297 VAL C OXT sing N N 298 VAL CB CG1 sing N N 299 VAL CB CG2 sing N N 300 VAL CB HB sing N N 301 VAL CG1 HG11 sing N N 302 VAL CG1 HG12 sing N N 303 VAL CG1 HG13 sing N N 304 VAL CG2 HG21 sing N N 305 VAL CG2 HG22 sing N N 306 VAL CG2 HG23 sing N N 307 VAL OXT HXT sing N N 308 # _pdbx_audit_support.funding_organization 'Swedish Research Council' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 AVANCE ? Bruker 950 'TCI cryogenic probe' 2 AVANCE ? Bruker 700 'TXO cryogenic probe' # _atom_sites.entry_id 34AF _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.016984 _atom_sites.fract_transf_matrix[1][2] 0.006004 _atom_sites.fract_transf_matrix[1][3] 0.010399 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018014 _atom_sites.fract_transf_matrix[2][3] 0.010399 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.020801 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C CU H N O S # loop_ #