data_35UC # _entry.id 35UC # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 35UC pdb_000035uc 10.2210/pdb35uc/pdb WWPDB D_1000306355 ? ? # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-09-16 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 35UC _pdbx_database_status.recvd_initial_deposition_date 2026-05-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible N # _pdbx_contact_author.id 2 _pdbx_contact_author.email nwalker@arcusbio.com _pdbx_contact_author.name_first Nigel _pdbx_contact_author.name_last Walker _pdbx_contact_author.name_mi P _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0009-0002-5838-8311 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Walker, N.P.' 1 0009-0002-5838-8311 'Jeffrey, J.L.' 2 0000-0001-9249-5984 'Blaesse, M.' 3 0000-0002-3315-7763 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Med.Chem. _citation.journal_id_ASTM JMCMAR _citation.journal_id_CSD 0151 _citation.journal_id_ISSN 0022-2623 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Leveraging Structure-Based Design to Overcome Class III RTK Off-Target Activity in the Development of Selective Wild-Type KIT Inhibitors ; _citation.year 2026 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.jmedchem.6c01334 _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Moon, H.' 1 ? primary 'Yan, X.' 2 ? primary 'Zhu, J.' 3 ? primary 'Mata, G.' 4 ? primary 'Wang, Z.' 5 ? primary 'Haelsig, K.T.' 6 ? primary 'Schweickert, P.G.' 7 ? primary 'Sivick, K.E.' 8 ? primary 'Huang, H.T.' 9 ? primary 'Van Abbema, A.M.' 10 ? primary 'Chen, S.' 11 ? primary 'Zhao, X.' 12 ? primary 'Green, D.W.' 13 ? primary 'Jin, L.' 14 ? primary 'Young, S.W.' 15 ? primary 'Walters, M.J.' 16 ? primary 'Walker, N.P.' 17 ? primary 'Leleti, M.R.' 18 ? primary 'Powers, J.P.' 19 ? primary 'Jeffrey, J.L.' 20 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mast/stem cell growth factor receptor Kit' 38560.582 1 2.7.10.1 'residues 694-752 deleted, and serine inserted between residues 753 and 754' 'residues 544-935 with residues 694-752 deleted, and serine inserted between residues 753 and 754' ? 2 non-polymer syn '2-[4-(2-azanyl-[1,2,4]triazolo[1,5-a]pyridin-7-yl)pyrazol-1-yl]-~{N}-(2-fluoranyl-4-methyl-phenyl)ethanamide' 365.364 1 ? ? ? ? 3 water nat water 18.015 65 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;SCFR,Piebald trait protein,PBT,Proto-oncogene c-Kit,Tyrosine-protein kinase Kit,p145 c-kit,v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GPMDPTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAM TVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKTSPAI MEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWM APESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPT FKQIVQLIEKQISESTNHI ; _entity_poly.pdbx_seq_one_letter_code_can ;GPMDPTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAM TVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKTSPAI MEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWM APESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPLKRPT FKQIVQLIEKQISESTNHI ; _entity_poly.pdbx_strand_id AAA _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '2-[4-(2-azanyl-[1,2,4]triazolo[1,5-a]pyridin-7-yl)pyrazol-1-yl]-~{N}-(2-fluoranyl-4-methyl-phenyl)ethanamide' A1DMF 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 MET n 1 4 ASP n 1 5 PRO n 1 6 THR n 1 7 TYR n 1 8 LYS n 1 9 TYR n 1 10 LEU n 1 11 GLN n 1 12 LYS n 1 13 PRO n 1 14 MET n 1 15 TYR n 1 16 GLU n 1 17 VAL n 1 18 GLN n 1 19 TRP n 1 20 LYS n 1 21 VAL n 1 22 VAL n 1 23 GLU n 1 24 GLU n 1 25 ILE n 1 26 ASN n 1 27 GLY n 1 28 ASN n 1 29 ASN n 1 30 TYR n 1 31 VAL n 1 32 TYR n 1 33 ILE n 1 34 ASP n 1 35 PRO n 1 36 THR n 1 37 GLN n 1 38 LEU n 1 39 PRO n 1 40 TYR n 1 41 ASP n 1 42 HIS n 1 43 LYS n 1 44 TRP n 1 45 GLU n 1 46 PHE n 1 47 PRO n 1 48 ARG n 1 49 ASN n 1 50 ARG n 1 51 LEU n 1 52 SER n 1 53 PHE n 1 54 GLY n 1 55 LYS n 1 56 THR n 1 57 LEU n 1 58 GLY n 1 59 ALA n 1 60 GLY n 1 61 ALA n 1 62 PHE n 1 63 GLY n 1 64 LYS n 1 65 VAL n 1 66 VAL n 1 67 GLU n 1 68 ALA n 1 69 THR n 1 70 ALA n 1 71 TYR n 1 72 GLY n 1 73 LEU n 1 74 ILE n 1 75 LYS n 1 76 SER n 1 77 ASP n 1 78 ALA n 1 79 ALA n 1 80 MET n 1 81 THR n 1 82 VAL n 1 83 ALA n 1 84 VAL n 1 85 LYS n 1 86 MET n 1 87 LEU n 1 88 LYS n 1 89 PRO n 1 90 SER n 1 91 ALA n 1 92 HIS n 1 93 LEU n 1 94 THR n 1 95 GLU n 1 96 ARG n 1 97 GLU n 1 98 ALA n 1 99 LEU n 1 100 MET n 1 101 SER n 1 102 GLU n 1 103 LEU n 1 104 LYS n 1 105 VAL n 1 106 LEU n 1 107 SER n 1 108 TYR n 1 109 LEU n 1 110 GLY n 1 111 ASN n 1 112 HIS n 1 113 MET n 1 114 ASN n 1 115 ILE n 1 116 VAL n 1 117 ASN n 1 118 LEU n 1 119 LEU n 1 120 GLY n 1 121 ALA n 1 122 CYS n 1 123 THR n 1 124 ILE n 1 125 GLY n 1 126 GLY n 1 127 PRO n 1 128 THR n 1 129 LEU n 1 130 VAL n 1 131 ILE n 1 132 THR n 1 133 GLU n 1 134 TYR n 1 135 CYS n 1 136 CYS n 1 137 TYR n 1 138 GLY n 1 139 ASP n 1 140 LEU n 1 141 LEU n 1 142 ASN n 1 143 PHE n 1 144 LEU n 1 145 ARG n 1 146 ARG n 1 147 LYS n 1 148 ARG n 1 149 ASP n 1 150 SER n 1 151 PHE n 1 152 ILE n 1 153 CYS n 1 154 SER n 1 155 LYS n 1 156 THR n 1 157 SER n 1 158 PRO n 1 159 ALA n 1 160 ILE n 1 161 MET n 1 162 GLU n 1 163 ASP n 1 164 ASP n 1 165 GLU n 1 166 LEU n 1 167 ALA n 1 168 LEU n 1 169 ASP n 1 170 LEU n 1 171 GLU n 1 172 ASP n 1 173 LEU n 1 174 LEU n 1 175 SER n 1 176 PHE n 1 177 SER n 1 178 TYR n 1 179 GLN n 1 180 VAL n 1 181 ALA n 1 182 LYS n 1 183 GLY n 1 184 MET n 1 185 ALA n 1 186 PHE n 1 187 LEU n 1 188 ALA n 1 189 SER n 1 190 LYS n 1 191 ASN n 1 192 CYS n 1 193 ILE n 1 194 HIS n 1 195 ARG n 1 196 ASP n 1 197 LEU n 1 198 ALA n 1 199 ALA n 1 200 ARG n 1 201 ASN n 1 202 ILE n 1 203 LEU n 1 204 LEU n 1 205 THR n 1 206 HIS n 1 207 GLY n 1 208 ARG n 1 209 ILE n 1 210 THR n 1 211 LYS n 1 212 ILE n 1 213 CYS n 1 214 ASP n 1 215 PHE n 1 216 GLY n 1 217 LEU n 1 218 ALA n 1 219 ARG n 1 220 ASP n 1 221 ILE n 1 222 LYS n 1 223 ASN n 1 224 ASP n 1 225 SER n 1 226 ASN n 1 227 TYR n 1 228 VAL n 1 229 VAL n 1 230 LYS n 1 231 GLY n 1 232 ASN n 1 233 ALA n 1 234 ARG n 1 235 LEU n 1 236 PRO n 1 237 VAL n 1 238 LYS n 1 239 TRP n 1 240 MET n 1 241 ALA n 1 242 PRO n 1 243 GLU n 1 244 SER n 1 245 ILE n 1 246 PHE n 1 247 ASN n 1 248 CYS n 1 249 VAL n 1 250 TYR n 1 251 THR n 1 252 PHE n 1 253 GLU n 1 254 SER n 1 255 ASP n 1 256 VAL n 1 257 TRP n 1 258 SER n 1 259 TYR n 1 260 GLY n 1 261 ILE n 1 262 PHE n 1 263 LEU n 1 264 TRP n 1 265 GLU n 1 266 LEU n 1 267 PHE n 1 268 SER n 1 269 LEU n 1 270 GLY n 1 271 SER n 1 272 SER n 1 273 PRO n 1 274 TYR n 1 275 PRO n 1 276 GLY n 1 277 MET n 1 278 PRO n 1 279 VAL n 1 280 ASP n 1 281 SER n 1 282 LYS n 1 283 PHE n 1 284 TYR n 1 285 LYS n 1 286 MET n 1 287 ILE n 1 288 LYS n 1 289 GLU n 1 290 GLY n 1 291 PHE n 1 292 ARG n 1 293 MET n 1 294 LEU n 1 295 SER n 1 296 PRO n 1 297 GLU n 1 298 HIS n 1 299 ALA n 1 300 PRO n 1 301 ALA n 1 302 GLU n 1 303 MET n 1 304 TYR n 1 305 ASP n 1 306 ILE n 1 307 MET n 1 308 LYS n 1 309 THR n 1 310 CYS n 1 311 TRP n 1 312 ASP n 1 313 ALA n 1 314 ASP n 1 315 PRO n 1 316 LEU n 1 317 LYS n 1 318 ARG n 1 319 PRO n 1 320 THR n 1 321 PHE n 1 322 LYS n 1 323 GLN n 1 324 ILE n 1 325 VAL n 1 326 GLN n 1 327 LEU n 1 328 ILE n 1 329 GLU n 1 330 LYS n 1 331 GLN n 1 332 ILE n 1 333 SER n 1 334 GLU n 1 335 SER n 1 336 THR n 1 337 ASN n 1 338 HIS n 1 339 ILE n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 155 human ? 'KIT, SCFR' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 156 339 human ? 'KIT, SCFR' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight A1DMF non-polymer . '2-[4-(2-azanyl-[1,2,4]triazolo[1,5-a]pyridin-7-yl)pyrazol-1-yl]-~{N}-(2-fluoranyl-4-methyl-phenyl)ethanamide' ? 'C18 H16 F N7 O' 365.364 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 539 ? ? ? AAA . n A 1 2 PRO 2 540 ? ? ? AAA . n A 1 3 MET 3 541 ? ? ? AAA . n A 1 4 ASP 4 542 ? ? ? AAA . n A 1 5 PRO 5 543 ? ? ? AAA . n A 1 6 THR 6 544 ? ? ? AAA . n A 1 7 TYR 7 545 545 TYR TYR AAA . n A 1 8 LYS 8 546 546 LYS LYS AAA . n A 1 9 TYR 9 547 547 TYR TYR AAA . n A 1 10 LEU 10 548 548 LEU LEU AAA . n A 1 11 GLN 11 549 549 GLN GLN AAA . n A 1 12 LYS 12 550 550 LYS LYS AAA . n A 1 13 PRO 13 551 551 PRO PRO AAA . n A 1 14 MET 14 552 552 MET MET AAA . n A 1 15 TYR 15 553 553 TYR TYR AAA . n A 1 16 GLU 16 554 554 GLU GLU AAA . n A 1 17 VAL 17 555 555 VAL VAL AAA . n A 1 18 GLN 18 556 556 GLN GLN AAA . n A 1 19 TRP 19 557 557 TRP TRP AAA . n A 1 20 LYS 20 558 558 LYS LYS AAA . n A 1 21 VAL 21 559 559 VAL VAL AAA . n A 1 22 VAL 22 560 560 VAL VAL AAA . n A 1 23 GLU 23 561 561 GLU GLU AAA . n A 1 24 GLU 24 562 562 GLU GLU AAA . n A 1 25 ILE 25 563 563 ILE ILE AAA . n A 1 26 ASN 26 564 ? ? ? AAA . n A 1 27 GLY 27 565 ? ? ? AAA . n A 1 28 ASN 28 566 ? ? ? AAA . n A 1 29 ASN 29 567 567 ASN ASN AAA . n A 1 30 TYR 30 568 568 TYR TYR AAA . n A 1 31 VAL 31 569 569 VAL VAL AAA . n A 1 32 TYR 32 570 570 TYR TYR AAA . n A 1 33 ILE 33 571 571 ILE ILE AAA . n A 1 34 ASP 34 572 572 ASP ASP AAA . n A 1 35 PRO 35 573 573 PRO PRO AAA . n A 1 36 THR 36 574 574 THR THR AAA . n A 1 37 GLN 37 575 575 GLN GLN AAA . n A 1 38 LEU 38 576 576 LEU LEU AAA . n A 1 39 PRO 39 577 577 PRO PRO AAA . n A 1 40 TYR 40 578 578 TYR TYR AAA . n A 1 41 ASP 41 579 579 ASP ASP AAA . n A 1 42 HIS 42 580 580 HIS HIS AAA . n A 1 43 LYS 43 581 581 LYS LYS AAA . n A 1 44 TRP 44 582 582 TRP TRP AAA . n A 1 45 GLU 45 583 583 GLU GLU AAA . n A 1 46 PHE 46 584 584 PHE PHE AAA . n A 1 47 PRO 47 585 585 PRO PRO AAA . n A 1 48 ARG 48 586 586 ARG ARG AAA . n A 1 49 ASN 49 587 587 ASN ASN AAA . n A 1 50 ARG 50 588 588 ARG ARG AAA . n A 1 51 LEU 51 589 589 LEU LEU AAA . n A 1 52 SER 52 590 590 SER SER AAA . n A 1 53 PHE 53 591 591 PHE PHE AAA . n A 1 54 GLY 54 592 592 GLY GLY AAA . n A 1 55 LYS 55 593 593 LYS LYS AAA . n A 1 56 THR 56 594 594 THR THR AAA . n A 1 57 LEU 57 595 595 LEU LEU AAA . n A 1 58 GLY 58 596 596 GLY GLY AAA . n A 1 59 ALA 59 597 597 ALA ALA AAA . n A 1 60 GLY 60 598 598 GLY GLY AAA . n A 1 61 ALA 61 599 599 ALA ALA AAA . n A 1 62 PHE 62 600 600 PHE PHE AAA . n A 1 63 GLY 63 601 601 GLY GLY AAA . n A 1 64 LYS 64 602 602 LYS LYS AAA . n A 1 65 VAL 65 603 603 VAL VAL AAA . n A 1 66 VAL 66 604 604 VAL VAL AAA . n A 1 67 GLU 67 605 605 GLU GLU AAA . n A 1 68 ALA 68 606 606 ALA ALA AAA . n A 1 69 THR 69 607 607 THR THR AAA . n A 1 70 ALA 70 608 608 ALA ALA AAA . n A 1 71 TYR 71 609 609 TYR TYR AAA . n A 1 72 GLY 72 610 610 GLY GLY AAA . n A 1 73 LEU 73 611 611 LEU LEU AAA . n A 1 74 ILE 74 612 612 ILE ILE AAA . n A 1 75 LYS 75 613 613 LYS LYS AAA . n A 1 76 SER 76 614 614 SER SER AAA . n A 1 77 ASP 77 615 615 ASP ASP AAA . n A 1 78 ALA 78 616 616 ALA ALA AAA . n A 1 79 ALA 79 617 617 ALA ALA AAA . n A 1 80 MET 80 618 618 MET MET AAA . n A 1 81 THR 81 619 619 THR THR AAA . n A 1 82 VAL 82 620 620 VAL VAL AAA . n A 1 83 ALA 83 621 621 ALA ALA AAA . n A 1 84 VAL 84 622 622 VAL VAL AAA . n A 1 85 LYS 85 623 623 LYS LYS AAA . n A 1 86 MET 86 624 624 MET MET AAA . n A 1 87 LEU 87 625 625 LEU LEU AAA . n A 1 88 LYS 88 626 626 LYS LYS AAA . n A 1 89 PRO 89 627 627 PRO PRO AAA . n A 1 90 SER 90 628 628 SER SER AAA . n A 1 91 ALA 91 629 629 ALA ALA AAA . n A 1 92 HIS 92 630 630 HIS HIS AAA . n A 1 93 LEU 93 631 631 LEU LEU AAA . n A 1 94 THR 94 632 632 THR THR AAA . n A 1 95 GLU 95 633 633 GLU GLU AAA . n A 1 96 ARG 96 634 634 ARG ARG AAA . n A 1 97 GLU 97 635 635 GLU GLU AAA . n A 1 98 ALA 98 636 636 ALA ALA AAA . n A 1 99 LEU 99 637 637 LEU LEU AAA . n A 1 100 MET 100 638 638 MET MET AAA . n A 1 101 SER 101 639 639 SER SER AAA . n A 1 102 GLU 102 640 640 GLU GLU AAA . n A 1 103 LEU 103 641 641 LEU LEU AAA . n A 1 104 LYS 104 642 642 LYS LYS AAA . n A 1 105 VAL 105 643 643 VAL VAL AAA . n A 1 106 LEU 106 644 644 LEU LEU AAA . n A 1 107 SER 107 645 645 SER SER AAA . n A 1 108 TYR 108 646 646 TYR TYR AAA . n A 1 109 LEU 109 647 647 LEU LEU AAA . n A 1 110 GLY 110 648 648 GLY GLY AAA . n A 1 111 ASN 111 649 649 ASN ASN AAA . n A 1 112 HIS 112 650 650 HIS HIS AAA . n A 1 113 MET 113 651 651 MET MET AAA . n A 1 114 ASN 114 652 652 ASN ASN AAA . n A 1 115 ILE 115 653 653 ILE ILE AAA . n A 1 116 VAL 116 654 654 VAL VAL AAA . n A 1 117 ASN 117 655 655 ASN ASN AAA . n A 1 118 LEU 118 656 656 LEU LEU AAA . n A 1 119 LEU 119 657 657 LEU LEU AAA . n A 1 120 GLY 120 658 658 GLY GLY AAA . n A 1 121 ALA 121 659 659 ALA ALA AAA . n A 1 122 CYS 122 660 660 CYS CYS AAA . n A 1 123 THR 123 661 661 THR THR AAA . n A 1 124 ILE 124 662 662 ILE ILE AAA . n A 1 125 GLY 125 663 663 GLY GLY AAA . n A 1 126 GLY 126 664 664 GLY GLY AAA . n A 1 127 PRO 127 665 665 PRO PRO AAA . n A 1 128 THR 128 666 666 THR THR AAA . n A 1 129 LEU 129 667 667 LEU LEU AAA . n A 1 130 VAL 130 668 668 VAL VAL AAA . n A 1 131 ILE 131 669 669 ILE ILE AAA . n A 1 132 THR 132 670 670 THR THR AAA . n A 1 133 GLU 133 671 671 GLU GLU AAA . n A 1 134 TYR 134 672 672 TYR TYR AAA . n A 1 135 CYS 135 673 673 CYS CYS AAA . n A 1 136 CYS 136 674 674 CYS CYS AAA . n A 1 137 TYR 137 675 675 TYR TYR AAA . n A 1 138 GLY 138 676 676 GLY GLY AAA . n A 1 139 ASP 139 677 677 ASP ASP AAA . n A 1 140 LEU 140 678 678 LEU LEU AAA . n A 1 141 LEU 141 679 679 LEU LEU AAA . n A 1 142 ASN 142 680 680 ASN ASN AAA . n A 1 143 PHE 143 681 681 PHE PHE AAA . n A 1 144 LEU 144 682 682 LEU LEU AAA . n A 1 145 ARG 145 683 683 ARG ARG AAA . n A 1 146 ARG 146 684 684 ARG ARG AAA . n A 1 147 LYS 147 685 685 LYS LYS AAA . n A 1 148 ARG 148 686 686 ARG ARG AAA . n A 1 149 ASP 149 687 687 ASP ASP AAA . n A 1 150 SER 150 746 ? ? ? AAA . n A 1 151 PHE 151 747 ? ? ? AAA . n A 1 152 ILE 152 748 ? ? ? AAA . n A 1 153 CYS 153 749 ? ? ? AAA . n A 1 154 SER 154 750 ? ? ? AAA . n A 1 155 LYS 155 751 ? ? ? AAA . n A 1 156 THR 156 752 ? ? ? AAA . n A 1 157 SER 157 753 ? ? ? AAA . n A 1 158 PRO 158 754 ? ? ? AAA . n A 1 159 ALA 159 755 ? ? ? AAA . n A 1 160 ILE 160 756 ? ? ? AAA . n A 1 161 MET 161 757 ? ? ? AAA . n A 1 162 GLU 162 758 ? ? ? AAA . n A 1 163 ASP 163 759 ? ? ? AAA . n A 1 164 ASP 164 760 760 ASP ASP AAA . n A 1 165 GLU 165 761 761 GLU GLU AAA . n A 1 166 LEU 166 762 762 LEU LEU AAA . n A 1 167 ALA 167 763 763 ALA ALA AAA . n A 1 168 LEU 168 764 764 LEU LEU AAA . n A 1 169 ASP 169 765 765 ASP ASP AAA . n A 1 170 LEU 170 766 766 LEU LEU AAA . n A 1 171 GLU 171 767 767 GLU GLU AAA . n A 1 172 ASP 172 768 768 ASP ASP AAA . n A 1 173 LEU 173 769 769 LEU LEU AAA . n A 1 174 LEU 174 770 770 LEU LEU AAA . n A 1 175 SER 175 771 771 SER SER AAA . n A 1 176 PHE 176 772 772 PHE PHE AAA . n A 1 177 SER 177 773 773 SER SER AAA . n A 1 178 TYR 178 774 774 TYR TYR AAA . n A 1 179 GLN 179 775 775 GLN GLN AAA . n A 1 180 VAL 180 776 776 VAL VAL AAA . n A 1 181 ALA 181 777 777 ALA ALA AAA . n A 1 182 LYS 182 778 778 LYS LYS AAA . n A 1 183 GLY 183 779 779 GLY GLY AAA . n A 1 184 MET 184 780 780 MET MET AAA . n A 1 185 ALA 185 781 781 ALA ALA AAA . n A 1 186 PHE 186 782 782 PHE PHE AAA . n A 1 187 LEU 187 783 783 LEU LEU AAA . n A 1 188 ALA 188 784 784 ALA ALA AAA . n A 1 189 SER 189 785 785 SER SER AAA . n A 1 190 LYS 190 786 786 LYS LYS AAA . n A 1 191 ASN 191 787 787 ASN ASN AAA . n A 1 192 CYS 192 788 788 CYS CYS AAA . n A 1 193 ILE 193 789 789 ILE ILE AAA . n A 1 194 HIS 194 790 790 HIS HIS AAA . n A 1 195 ARG 195 791 791 ARG ARG AAA . n A 1 196 ASP 196 792 792 ASP ASP AAA . n A 1 197 LEU 197 793 793 LEU LEU AAA . n A 1 198 ALA 198 794 794 ALA ALA AAA . n A 1 199 ALA 199 795 795 ALA ALA AAA . n A 1 200 ARG 200 796 796 ARG ARG AAA . n A 1 201 ASN 201 797 797 ASN ASN AAA . n A 1 202 ILE 202 798 798 ILE ILE AAA . n A 1 203 LEU 203 799 799 LEU LEU AAA . n A 1 204 LEU 204 800 800 LEU LEU AAA . n A 1 205 THR 205 801 801 THR THR AAA . n A 1 206 HIS 206 802 802 HIS HIS AAA . n A 1 207 GLY 207 803 803 GLY GLY AAA . n A 1 208 ARG 208 804 804 ARG ARG AAA . n A 1 209 ILE 209 805 805 ILE ILE AAA . n A 1 210 THR 210 806 806 THR THR AAA . n A 1 211 LYS 211 807 807 LYS LYS AAA . n A 1 212 ILE 212 808 808 ILE ILE AAA . n A 1 213 CYS 213 809 809 CYS CYS AAA . n A 1 214 ASP 214 810 810 ASP ASP AAA . n A 1 215 PHE 215 811 811 PHE PHE AAA . n A 1 216 GLY 216 812 812 GLY GLY AAA . n A 1 217 LEU 217 813 813 LEU LEU AAA . n A 1 218 ALA 218 814 814 ALA ALA AAA . n A 1 219 ARG 219 815 815 ARG ARG AAA . n A 1 220 ASP 220 816 816 ASP ASP AAA . n A 1 221 ILE 221 817 817 ILE ILE AAA . n A 1 222 LYS 222 818 818 LYS LYS AAA . n A 1 223 ASN 223 819 819 ASN ASN AAA . n A 1 224 ASP 224 820 820 ASP ASP AAA . n A 1 225 SER 225 821 821 SER SER AAA . n A 1 226 ASN 226 822 822 ASN ASN AAA . n A 1 227 TYR 227 823 823 TYR TYR AAA . n A 1 228 VAL 228 824 824 VAL VAL AAA . n A 1 229 VAL 229 825 825 VAL VAL AAA . n A 1 230 LYS 230 826 826 LYS LYS AAA . n A 1 231 GLY 231 827 827 GLY GLY AAA . n A 1 232 ASN 232 828 828 ASN ASN AAA . n A 1 233 ALA 233 829 829 ALA ALA AAA . n A 1 234 ARG 234 830 830 ARG ARG AAA . n A 1 235 LEU 235 831 831 LEU LEU AAA . n A 1 236 PRO 236 832 832 PRO PRO AAA . n A 1 237 VAL 237 833 833 VAL VAL AAA . n A 1 238 LYS 238 834 834 LYS LYS AAA . n A 1 239 TRP 239 835 835 TRP TRP AAA . n A 1 240 MET 240 836 836 MET MET AAA . n A 1 241 ALA 241 837 837 ALA ALA AAA . n A 1 242 PRO 242 838 838 PRO PRO AAA . n A 1 243 GLU 243 839 839 GLU GLU AAA . n A 1 244 SER 244 840 840 SER SER AAA . n A 1 245 ILE 245 841 841 ILE ILE AAA . n A 1 246 PHE 246 842 842 PHE PHE AAA . n A 1 247 ASN 247 843 843 ASN ASN AAA . n A 1 248 CYS 248 844 844 CYS CYS AAA . n A 1 249 VAL 249 845 845 VAL VAL AAA . n A 1 250 TYR 250 846 846 TYR TYR AAA . n A 1 251 THR 251 847 847 THR THR AAA . n A 1 252 PHE 252 848 848 PHE PHE AAA . n A 1 253 GLU 253 849 849 GLU GLU AAA . n A 1 254 SER 254 850 850 SER SER AAA . n A 1 255 ASP 255 851 851 ASP ASP AAA . n A 1 256 VAL 256 852 852 VAL VAL AAA . n A 1 257 TRP 257 853 853 TRP TRP AAA . n A 1 258 SER 258 854 854 SER SER AAA . n A 1 259 TYR 259 855 855 TYR TYR AAA . n A 1 260 GLY 260 856 856 GLY GLY AAA . n A 1 261 ILE 261 857 857 ILE ILE AAA . n A 1 262 PHE 262 858 858 PHE PHE AAA . n A 1 263 LEU 263 859 859 LEU LEU AAA . n A 1 264 TRP 264 860 860 TRP TRP AAA . n A 1 265 GLU 265 861 861 GLU GLU AAA . n A 1 266 LEU 266 862 862 LEU LEU AAA . n A 1 267 PHE 267 863 863 PHE PHE AAA . n A 1 268 SER 268 864 864 SER SER AAA . n A 1 269 LEU 269 865 865 LEU LEU AAA . n A 1 270 GLY 270 866 866 GLY GLY AAA . n A 1 271 SER 271 867 867 SER SER AAA . n A 1 272 SER 272 868 868 SER SER AAA . n A 1 273 PRO 273 869 869 PRO PRO AAA . n A 1 274 TYR 274 870 870 TYR TYR AAA . n A 1 275 PRO 275 871 871 PRO PRO AAA . n A 1 276 GLY 276 872 872 GLY GLY AAA . n A 1 277 MET 277 873 873 MET MET AAA . n A 1 278 PRO 278 874 874 PRO PRO AAA . n A 1 279 VAL 279 875 875 VAL VAL AAA . n A 1 280 ASP 280 876 876 ASP ASP AAA . n A 1 281 SER 281 877 877 SER SER AAA . n A 1 282 LYS 282 878 878 LYS LYS AAA . n A 1 283 PHE 283 879 879 PHE PHE AAA . n A 1 284 TYR 284 880 880 TYR TYR AAA . n A 1 285 LYS 285 881 881 LYS LYS AAA . n A 1 286 MET 286 882 882 MET MET AAA . n A 1 287 ILE 287 883 883 ILE ILE AAA . n A 1 288 LYS 288 884 884 LYS LYS AAA . n A 1 289 GLU 289 885 885 GLU GLU AAA . n A 1 290 GLY 290 886 886 GLY GLY AAA . n A 1 291 PHE 291 887 887 PHE PHE AAA . n A 1 292 ARG 292 888 888 ARG ARG AAA . n A 1 293 MET 293 889 889 MET MET AAA . n A 1 294 LEU 294 890 890 LEU LEU AAA . n A 1 295 SER 295 891 891 SER SER AAA . n A 1 296 PRO 296 892 892 PRO PRO AAA . n A 1 297 GLU 297 893 893 GLU GLU AAA . n A 1 298 HIS 298 894 894 HIS HIS AAA . n A 1 299 ALA 299 895 895 ALA ALA AAA . n A 1 300 PRO 300 896 896 PRO PRO AAA . n A 1 301 ALA 301 897 897 ALA ALA AAA . n A 1 302 GLU 302 898 898 GLU GLU AAA . n A 1 303 MET 303 899 899 MET MET AAA . n A 1 304 TYR 304 900 900 TYR TYR AAA . n A 1 305 ASP 305 901 901 ASP ASP AAA . n A 1 306 ILE 306 902 902 ILE ILE AAA . n A 1 307 MET 307 903 903 MET MET AAA . n A 1 308 LYS 308 904 904 LYS LYS AAA . n A 1 309 THR 309 905 905 THR THR AAA . n A 1 310 CYS 310 906 906 CYS CYS AAA . n A 1 311 TRP 311 907 907 TRP TRP AAA . n A 1 312 ASP 312 908 908 ASP ASP AAA . n A 1 313 ALA 313 909 909 ALA ALA AAA . n A 1 314 ASP 314 910 910 ASP ASP AAA . n A 1 315 PRO 315 911 911 PRO PRO AAA . n A 1 316 LEU 316 912 912 LEU LEU AAA . n A 1 317 LYS 317 913 913 LYS LYS AAA . n A 1 318 ARG 318 914 914 ARG ARG AAA . n A 1 319 PRO 319 915 915 PRO PRO AAA . n A 1 320 THR 320 916 916 THR THR AAA . n A 1 321 PHE 321 917 917 PHE PHE AAA . n A 1 322 LYS 322 918 918 LYS LYS AAA . n A 1 323 GLN 323 919 919 GLN GLN AAA . n A 1 324 ILE 324 920 920 ILE ILE AAA . n A 1 325 VAL 325 921 921 VAL VAL AAA . n A 1 326 GLN 326 922 922 GLN GLN AAA . n A 1 327 LEU 327 923 923 LEU LEU AAA . n A 1 328 ILE 328 924 924 ILE ILE AAA . n A 1 329 GLU 329 925 925 GLU GLU AAA . n A 1 330 LYS 330 926 926 LYS LYS AAA . n A 1 331 GLN 331 927 927 GLN GLN AAA . n A 1 332 ILE 332 928 928 ILE ILE AAA . n A 1 333 SER 333 929 929 SER SER AAA . n A 1 334 GLU 334 930 930 GLU GLU AAA . n A 1 335 SER 335 931 931 SER SER AAA . n A 1 336 THR 336 932 932 THR THR AAA . n A 1 337 ASN 337 933 933 ASN ASN AAA . n A 1 338 HIS 338 934 ? ? ? AAA . n A 1 339 ILE 339 935 ? ? ? AAA . n # _pdbx_entity_instance_feature.ordinal 1 _pdbx_entity_instance_feature.comp_id A1DMF _pdbx_entity_instance_feature.asym_id ? _pdbx_entity_instance_feature.seq_num ? _pdbx_entity_instance_feature.auth_comp_id A1DMF _pdbx_entity_instance_feature.auth_asym_id ? _pdbx_entity_instance_feature.auth_seq_num ? _pdbx_entity_instance_feature.feature_type 'SUBJECT OF INVESTIGATION' _pdbx_entity_instance_feature.details ? # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 A1DMF 1 1001 1 A1DMF INX AAA . C 3 HOH 1 1101 6 HOH HOH AAA . C 3 HOH 2 1102 31 HOH HOH AAA . C 3 HOH 3 1103 33 HOH HOH AAA . C 3 HOH 4 1104 48 HOH HOH AAA . C 3 HOH 5 1105 57 HOH HOH AAA . C 3 HOH 6 1106 64 HOH HOH AAA . C 3 HOH 7 1107 40 HOH HOH AAA . C 3 HOH 8 1108 1 HOH HOH AAA . C 3 HOH 9 1109 50 HOH HOH AAA . C 3 HOH 10 1110 2 HOH HOH AAA . C 3 HOH 11 1111 4 HOH HOH AAA . C 3 HOH 12 1112 41 HOH HOH AAA . C 3 HOH 13 1113 5 HOH HOH AAA . C 3 HOH 14 1114 12 HOH HOH AAA . C 3 HOH 15 1115 9 HOH HOH AAA . C 3 HOH 16 1116 36 HOH HOH AAA . C 3 HOH 17 1117 55 HOH HOH AAA . C 3 HOH 18 1118 25 HOH HOH AAA . C 3 HOH 19 1119 68 HOH HOH AAA . C 3 HOH 20 1120 13 HOH HOH AAA . C 3 HOH 21 1121 29 HOH HOH AAA . C 3 HOH 22 1122 26 HOH HOH AAA . C 3 HOH 23 1123 14 HOH HOH AAA . C 3 HOH 24 1124 32 HOH HOH AAA . C 3 HOH 25 1125 16 HOH HOH AAA . C 3 HOH 26 1126 21 HOH HOH AAA . C 3 HOH 27 1127 66 HOH HOH AAA . C 3 HOH 28 1128 7 HOH HOH AAA . C 3 HOH 29 1129 49 HOH HOH AAA . C 3 HOH 30 1130 53 HOH HOH AAA . C 3 HOH 31 1131 23 HOH HOH AAA . C 3 HOH 32 1132 20 HOH HOH AAA . C 3 HOH 33 1133 10 HOH HOH AAA . C 3 HOH 34 1134 52 HOH HOH AAA . C 3 HOH 35 1135 8 HOH HOH AAA . C 3 HOH 36 1136 38 HOH HOH AAA . C 3 HOH 37 1137 3 HOH HOH AAA . C 3 HOH 38 1138 24 HOH HOH AAA . C 3 HOH 39 1139 42 HOH HOH AAA . C 3 HOH 40 1140 28 HOH HOH AAA . C 3 HOH 41 1141 30 HOH HOH AAA . C 3 HOH 42 1142 54 HOH HOH AAA . C 3 HOH 43 1143 19 HOH HOH AAA . C 3 HOH 44 1144 51 HOH HOH AAA . C 3 HOH 45 1145 18 HOH HOH AAA . C 3 HOH 46 1146 34 HOH HOH AAA . C 3 HOH 47 1147 11 HOH HOH AAA . C 3 HOH 48 1148 46 HOH HOH AAA . C 3 HOH 49 1149 56 HOH HOH AAA . C 3 HOH 50 1150 45 HOH HOH AAA . C 3 HOH 51 1151 44 HOH HOH AAA . C 3 HOH 52 1152 58 HOH HOH AAA . C 3 HOH 53 1153 22 HOH HOH AAA . C 3 HOH 54 1154 15 HOH HOH AAA . C 3 HOH 55 1155 67 HOH HOH AAA . C 3 HOH 56 1156 37 HOH HOH AAA . C 3 HOH 57 1157 17 HOH HOH AAA . C 3 HOH 58 1158 59 HOH HOH AAA . C 3 HOH 59 1159 47 HOH HOH AAA . C 3 HOH 60 1160 65 HOH HOH AAA . C 3 HOH 61 1161 27 HOH HOH AAA . C 3 HOH 62 1162 61 HOH HOH AAA . C 3 HOH 63 1163 60 HOH HOH AAA . C 3 HOH 64 1164 63 HOH HOH AAA . C 3 HOH 65 1165 62 HOH HOH AAA . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 0 AAA TYR 545 ? CG ? A TYR 7 CG 2 1 Y 0 AAA TYR 545 ? CD1 ? A TYR 7 CD1 3 1 Y 0 AAA TYR 545 ? CD2 ? A TYR 7 CD2 4 1 Y 0 AAA TYR 545 ? CE1 ? A TYR 7 CE1 5 1 Y 0 AAA TYR 545 ? CE2 ? A TYR 7 CE2 6 1 Y 0 AAA TYR 545 ? CZ ? A TYR 7 CZ 7 1 Y 0 AAA TYR 545 ? OH ? A TYR 7 OH 8 1 Y 0 AAA LYS 550 ? CD ? A LYS 12 CD 9 1 Y 0 AAA LYS 550 ? CE ? A LYS 12 CE 10 1 Y 0 AAA LYS 550 ? NZ ? A LYS 12 NZ 11 1 Y 0 AAA MET 552 ? CE ? A MET 14 CE 12 1 Y 0 AAA ILE 563 ? CG1 ? A ILE 25 CG1 13 1 Y 0 AAA ILE 563 ? CG2 ? A ILE 25 CG2 14 1 Y 0 AAA ILE 563 ? CD1 ? A ILE 25 CD1 15 1 Y 0 AAA ASN 567 ? CG ? A ASN 29 CG 16 1 Y 0 AAA ASN 567 ? OD1 ? A ASN 29 OD1 17 1 Y 0 AAA ASN 567 ? ND2 ? A ASN 29 ND2 18 1 Y 0 AAA HIS 580 ? CG ? A HIS 42 CG 19 1 Y 0 AAA HIS 580 ? ND1 ? A HIS 42 ND1 20 1 Y 0 AAA HIS 580 ? CD2 ? A HIS 42 CD2 21 1 Y 0 AAA HIS 580 ? CE1 ? A HIS 42 CE1 22 1 Y 0 AAA HIS 580 ? NE2 ? A HIS 42 NE2 23 1 Y 0 AAA ARG 588 ? NE ? A ARG 50 NE 24 1 Y 0 AAA ARG 588 ? CZ ? A ARG 50 CZ 25 1 Y 0 AAA ARG 588 ? NH1 ? A ARG 50 NH1 26 1 Y 0 AAA ARG 588 ? NH2 ? A ARG 50 NH2 27 1 Y 0 AAA LYS 593 ? NZ ? A LYS 55 NZ 28 1 Y 0 AAA ILE 612 ? CG1 ? A ILE 74 CG1 29 1 Y 0 AAA ILE 612 ? CG2 ? A ILE 74 CG2 30 1 Y 0 AAA ILE 612 ? CD1 ? A ILE 74 CD1 31 1 Y 0 AAA LYS 613 ? CG ? A LYS 75 CG 32 1 Y 0 AAA LYS 613 ? CD ? A LYS 75 CD 33 1 Y 0 AAA LYS 613 ? CE ? A LYS 75 CE 34 1 Y 0 AAA LYS 613 ? NZ ? A LYS 75 NZ 35 1 Y 0 AAA SER 614 ? OG ? A SER 76 OG 36 1 Y 0 AAA ASP 615 ? CG ? A ASP 77 CG 37 1 Y 0 AAA ASP 615 ? OD1 ? A ASP 77 OD1 38 1 Y 0 AAA ASP 615 ? OD2 ? A ASP 77 OD2 39 1 Y 0 AAA ARG 634 ? NE ? A ARG 96 NE 40 1 Y 0 AAA ARG 634 ? CZ ? A ARG 96 CZ 41 1 Y 0 AAA ARG 634 ? NH1 ? A ARG 96 NH1 42 1 Y 0 AAA ARG 634 ? NH2 ? A ARG 96 NH2 43 1 Y 0 AAA ILE 662 ? CD1 ? A ILE 124 CD1 44 1 Y 0 AAA ASP 687 ? CG ? A ASP 149 CG 45 1 Y 0 AAA ASP 687 ? OD1 ? A ASP 149 OD1 46 1 Y 0 AAA ASP 687 ? OD2 ? A ASP 149 OD2 47 1 Y 0 AAA ASP 760 ? CG ? A ASP 164 CG 48 1 Y 0 AAA ASP 760 ? OD1 ? A ASP 164 OD1 49 1 Y 0 AAA ASP 760 ? OD2 ? A ASP 164 OD2 50 1 Y 0 AAA GLU 761 ? CG ? A GLU 165 CG 51 1 Y 0 AAA GLU 761 ? CD ? A GLU 165 CD 52 1 Y 0 AAA GLU 761 ? OE1 ? A GLU 165 OE1 53 1 Y 0 AAA GLU 761 ? OE2 ? A GLU 165 OE2 54 1 Y 0 AAA LEU 762 ? CD1 ? A LEU 166 CD1 55 1 Y 0 AAA LEU 762 ? CD2 ? A LEU 166 CD2 56 1 Y 0 AAA HIS 802 ? CG ? A HIS 206 CG 57 1 Y 0 AAA HIS 802 ? ND1 ? A HIS 206 ND1 58 1 Y 0 AAA HIS 802 ? CD2 ? A HIS 206 CD2 59 1 Y 0 AAA HIS 802 ? CE1 ? A HIS 206 CE1 60 1 Y 0 AAA HIS 802 ? NE2 ? A HIS 206 NE2 61 1 Y 0 AAA LYS 818 ? CG ? A LYS 222 CG 62 1 Y 0 AAA LYS 818 ? CD ? A LYS 222 CD 63 1 Y 0 AAA LYS 818 ? CE ? A LYS 222 CE 64 1 Y 0 AAA LYS 818 ? NZ ? A LYS 222 NZ 65 1 Y 0 AAA LYS 826 ? CD ? A LYS 230 CD 66 1 Y 0 AAA LYS 826 ? CE ? A LYS 230 CE 67 1 Y 0 AAA LYS 826 ? NZ ? A LYS 230 NZ 68 1 Y 0 AAA ASN 828 ? CG ? A ASN 232 CG 69 1 Y 0 AAA ASN 828 ? OD1 ? A ASN 232 OD1 70 1 Y 0 AAA ASN 828 ? ND2 ? A ASN 232 ND2 71 1 Y 0 AAA LYS 878 ? CG ? A LYS 282 CG 72 1 Y 0 AAA LYS 878 ? CD ? A LYS 282 CD 73 1 Y 0 AAA LYS 878 ? CE ? A LYS 282 CE 74 1 Y 0 AAA LYS 878 ? NZ ? A LYS 282 NZ 75 1 Y 0 AAA MET 882 ? CG ? A MET 286 CG 76 1 Y 0 AAA MET 882 ? SD ? A MET 286 SD 77 1 Y 0 AAA MET 882 ? CE ? A MET 286 CE 78 1 Y 0 AAA LYS 884 ? CE ? A LYS 288 CE 79 1 Y 0 AAA LYS 884 ? NZ ? A LYS 288 NZ 80 1 Y 0 AAA GLU 885 ? CD ? A GLU 289 CD 81 1 Y 0 AAA GLU 885 ? OE1 ? A GLU 289 OE1 82 1 Y 0 AAA GLU 885 ? OE2 ? A GLU 289 OE2 83 1 Y 0 AAA LYS 904 ? CE ? A LYS 308 CE 84 1 Y 0 AAA LYS 904 ? NZ ? A LYS 308 NZ 85 1 Y 0 AAA LYS 913 ? CD ? A LYS 317 CD 86 1 Y 0 AAA LYS 913 ? CE ? A LYS 317 CE 87 1 Y 0 AAA LYS 913 ? NZ ? A LYS 317 NZ 88 1 Y 0 AAA GLN 922 ? CD ? A GLN 326 CD 89 1 Y 0 AAA GLN 922 ? OE1 ? A GLN 326 OE1 90 1 Y 0 AAA GLN 922 ? NE2 ? A GLN 326 NE2 91 1 Y 0 AAA LYS 926 ? CE ? A LYS 330 CE 92 1 Y 0 AAA LYS 926 ? NZ ? A LYS 330 NZ 93 1 Y 0 AAA ASN 933 ? CG ? A ASN 337 CG 94 1 Y 0 AAA ASN 933 ? OD1 ? A ASN 337 OD1 95 1 Y 0 AAA ASN 933 ? ND2 ? A ASN 337 ND2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_reference_DOI _software.pdbx_ordinal ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? autoPROC ? ? ? '1.1.7 20211020' ? 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.7.7 ? 2 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? TRUNCATE ? ? ? 7.1.015 ? 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0267 ? 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? 'Jan 31, 2020' ? 5 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? 11.7.03 ? 6 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 35UC _cell.details ? _cell.formula_units_Z ? _cell.length_a 44.934 _cell.length_a_esd ? _cell.length_b 81.168 _cell.length_b_esd ? _cell.length_c 99.767 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? _cell.pdbx_esd_method ? # _symmetry.entry_id 35UC _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 35UC _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.36 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? _exptl_crystal.pdbx_mosaic_method ? _exptl_crystal.pdbx_mosaic_block_size ? _exptl_crystal.pdbx_mosaic_block_size_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.50 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'HEPES; PEG8000' _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.temp 293 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? _diffrn.pdbx_serial_crystal_experiment N # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS EIGER X 16M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2022-04-06 _diffrn_detector.pdbx_frequency ? _diffrn_detector.id ? _diffrn_detector.number_of_axes ? # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SLS BEAMLINE X10SA' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X10SA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 35UC _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.328 _reflns.d_resolution_low 62.962 _reflns.details ;Some remarks regarding the mmCIF items written, the PDB Exchange Dictionary (PDBx/mmCIF) Version 5.0 supporting the data files in the current PDB archive (dictionary version 5.325, last updated 2020-04-13: http://mmcif.wwpdb.org/dictionaries/mmcif_pdbx_v50.dic/Index/) and the actual quantities provided by MRFANA (https://github.com/githubgphl/MRFANA) from the autoPROC package (https://www.globalphasing.com/autoproc/). In general, the mmCIF categories here should provide items that are currently used in the PDB archive. If there are alternatives, the one recommended by the PDB developers has been selected. The distinction between *_all and *_obs quantities is not always clear: often only one version is actively used within the PDB archive (or is the one recommended by PDB developers). The intention of distinguishing between classes of reflections before and after some kind of observation criterion was applied, can in principle be useful - but such criteria change in various ways throughout the data processing steps (rejection of overloaded or too partial reflections, outlier/misfit rejections during scaling etc) and there is no retrospect computation of data scaling/merging statistics for the reflections used in the final refinement (where another observation criterion might have been applied). Typical data processing will usually only provide one version of statistics at various stages and these are given in the recommended item here, irrespective of the "_all" and "_obs" connotation, see e.g. the use of _reflns.pdbx_Rmerge_I_obs, _reflns.pdbx_Rrim_I_all and _reflns.pdbx_Rpim_I_all. Please note that all statistics related to "merged intensities" (or "merging") are based on inverse-variance weighting of the individual measurements making up a symmetry-unique reflection. This is standard for several decades now, even if some of the dictionary definitions seem to suggest that a simple "mean" or "average" intensity is being used instead. R-values are always given for all symmetry-equivalent reflections following Friedel's law, i.e. Bijvoet pairs are not treated separately (since we want to describe the overall mean intensity and not the mean I(+) and I(-) here). The Rrim metric is identical to the Rmeas R-value and only differs in name. _reflns.pdbx_number_measured_all is the number of measured intensities just before the final merging step (at which point no additional rejection takes place). _reflns.number_obs is the number of symmetry-unique observations, i.e. the result of merging those measurements via inverse-variance weighting. _reflns.pdbx_netI_over_sigmaI is based on the merged intensities (_reflns.number_obs) as expected. _reflns.pdbx_redundancy is synonymous with "multiplicity". The per-shell item _reflns_shell.number_measured_all corresponds to the overall value _reflns.pdbx_number_measured_all. The per-shell item _reflns_shell.number_unique_all corresponds to the overall value _reflns.number_obs. The per-shell item _reflns_shell.percent_possible_all corresponds to the overall value _reflns.percent_possible_obs. The per-shell item _reflns_shell.meanI_over_sigI_obs corresponds to the overall value given as _reflns.pdbx_netI_over_sigmaI. But be aware of the incorrect definition of the former in the current dictionary! ; _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 15538 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7.42 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.28 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.1413 _reflns.pdbx_Rpim_I_all 0.0516 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 115282 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.993 _reflns.pdbx_CC_star ? _reflns.pdbx_R_split ? _reflns.pdbx_Rmerge_I_obs 0.1311 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_CC_split_method ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_1_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_2_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[1] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[2] ? _reflns.pdbx_aniso_diffraction_limit_axis_3_ortho[3] ? _reflns.pdbx_aniso_diffraction_limit_1 ? _reflns.pdbx_aniso_diffraction_limit_2 ? _reflns.pdbx_aniso_diffraction_limit_3 ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_1_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_2_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[1] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[2] ? _reflns.pdbx_aniso_B_tensor_eigenvector_3_ortho[3] ? _reflns.pdbx_aniso_B_tensor_eigenvalue_1 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_2 ? _reflns.pdbx_aniso_B_tensor_eigenvalue_3 ? _reflns.pdbx_orthogonalization_convention ? _reflns.pdbx_percent_possible_ellipsoidal ? _reflns.pdbx_percent_possible_spherical ? _reflns.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns.pdbx_percent_possible_spherical_anomalous ? _reflns.pdbx_redundancy_anomalous 3.98 _reflns.pdbx_CC_half_anomalous -0.158 _reflns.pdbx_absDiff_over_sigma_anomalous 0.703 _reflns.pdbx_percent_possible_anomalous 95.4 _reflns.pdbx_observed_signal_threshold ? _reflns.pdbx_signal_type ? _reflns.pdbx_signal_details ? _reflns.pdbx_signal_software_id ? # _reflns_shell.d_res_high 2.328 _reflns_shell.d_res_low 2.368 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.37 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs 794 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.57 _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all 1.6193 _reflns_shell.pdbx_Rpim_I_all 0.5796 _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half 0.635 _reflns_shell.pdbx_CC_star ? _reflns_shell.pdbx_R_split ? _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.5088 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_percent_possible_ellipsoidal ? _reflns_shell.pdbx_percent_possible_spherical ? _reflns_shell.pdbx_percent_possible_ellipsoidal_anomalous ? _reflns_shell.pdbx_percent_possible_spherical_anomalous ? _reflns_shell.pdbx_redundancy_anomalous ? _reflns_shell.pdbx_CC_half_anomalous ? _reflns_shell.pdbx_absDiff_over_sigma_anomalous ? _reflns_shell.pdbx_percent_possible_anomalous ? # _refine.aniso_B[1][1] 3.327 _refine.aniso_B[1][2] 0.000 _refine.aniso_B[1][3] -0.000 _refine.aniso_B[2][2] -2.941 _refine.aniso_B[2][3] 0.000 _refine.aniso_B[3][3] -0.386 _refine.B_iso_max ? _refine.B_iso_mean 49.918 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.938 _refine.correlation_coeff_Fo_to_Fc_free 0.891 _refine.details 'Hydrogens have been added in their riding positions' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 35UC _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.328 _refine.ls_d_res_low 62.962 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15431 _refine.ls_number_reflns_R_free 1140 _refine.ls_number_reflns_R_work 14291 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.925 _refine.ls_percent_reflns_R_free 7.388 _refine.ls_R_factor_all 0.231 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_free 0.2953 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2264 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'MASK BULK SOLVENT' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.correlation_coeff_I_to_Fcsqd_work ? _refine.correlation_coeff_I_to_Fcsqd_free ? _refine.pdbx_R_complete ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.425 _refine.pdbx_overall_ESU_R_Free 0.301 _refine.pdbx_solvent_vdw_probe_radii 1.200 _refine.pdbx_solvent_ion_probe_radii 0.800 _refine.pdbx_solvent_shrinkage_radii 0.800 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 10.540 _refine.overall_SU_ML 0.244 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2521 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 27 _refine_hist.number_atoms_solvent 65 _refine_hist.number_atoms_total 2613 _refine_hist.d_res_high 2.328 _refine_hist.d_res_low 62.962 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_Zscore _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 0.013 2514 ? r_bond_refined_d ? ? ? 'X-RAY DIFFRACTION' ? 0.002 0.017 2358 ? r_bond_other_d ? ? ? 'X-RAY DIFFRACTION' ? 1.346 1.640 3415 ? r_angle_refined_deg ? ? ? 'X-RAY DIFFRACTION' ? 1.094 1.572 5402 ? r_angle_other_deg ? ? ? 'X-RAY DIFFRACTION' ? 6.739 5.000 311 ? r_dihedral_angle_1_deg ? ? ? 'X-RAY DIFFRACTION' ? 31.174 22.294 109 ? r_dihedral_angle_2_deg ? ? ? 'X-RAY DIFFRACTION' ? 13.922 15.000 401 ? r_dihedral_angle_3_deg ? ? ? 'X-RAY DIFFRACTION' ? 11.470 15.000 11 ? r_dihedral_angle_4_deg ? ? ? 'X-RAY DIFFRACTION' ? 0.050 0.200 326 ? r_chiral_restr ? ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 2813 ? r_gen_planes_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 572 ? r_gen_planes_other ? ? ? 'X-RAY DIFFRACTION' ? 0.157 0.200 406 ? r_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.145 0.200 2009 ? r_symmetry_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.153 0.200 1180 ? r_nbtor_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.073 0.200 1021 ? r_symmetry_nbtor_other ? ? ? 'X-RAY DIFFRACTION' ? 0.135 0.200 70 ? r_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.088 0.200 9 ? r_symmetry_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 0.128 0.200 36 ? r_nbd_other ? ? ? 'X-RAY DIFFRACTION' ? 0.180 0.200 6 ? r_symmetry_xyhbond_nbd_refined ? ? ? 'X-RAY DIFFRACTION' ? 2.370 5.577 1253 ? r_mcbond_it ? ? ? 'X-RAY DIFFRACTION' ? 2.371 5.574 1252 ? r_mcbond_other ? ? ? 'X-RAY DIFFRACTION' ? 4.011 8.346 1561 ? r_mcangle_it ? ? ? 'X-RAY DIFFRACTION' ? 4.010 8.350 1562 ? r_mcangle_other ? ? ? 'X-RAY DIFFRACTION' ? 1.997 5.571 1261 ? r_scbond_it ? ? ? 'X-RAY DIFFRACTION' ? 1.996 5.570 1262 ? r_scbond_other ? ? ? 'X-RAY DIFFRACTION' ? 3.446 8.301 1854 ? r_scangle_it ? ? ? 'X-RAY DIFFRACTION' ? 3.445 8.300 1855 ? r_scangle_other ? ? ? 'X-RAY DIFFRACTION' ? 5.681 60.485 2688 ? r_lrange_it ? ? ? 'X-RAY DIFFRACTION' ? 5.667 60.455 2684 ? r_lrange_other ? ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_R_complete _refine_ls_shell.correlation_coeff_Fo_to_Fc _refine_ls_shell.correlation_coeff_Fo_to_Fc_free _refine_ls_shell.correlation_coeff_I_to_Fcsqd_work _refine_ls_shell.correlation_coeff_I_to_Fcsqd_free _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free _refine_ls_shell.R_factor_R_free 'X-RAY DIFFRACTION' 2.328 2.388 1186 . 84 1096 99.4941 . 0.326 . . 0.323 . . . . . 0.312 . . . . . 20 . 0.700 0.672 0.379 'X-RAY DIFFRACTION' 2.388 2.454 1120 . 90 1030 100.0000 . 0.299 . . 0.295 . . . . . 0.284 . . . . . 20 . 0.752 0.741 0.350 'X-RAY DIFFRACTION' 2.454 2.525 1136 . 89 1047 100.0000 . 0.279 . . 0.274 . . . . . 0.256 . . . . . 20 . 0.816 0.796 0.338 'X-RAY DIFFRACTION' 2.525 2.602 1066 . 101 964 99.9062 . 0.265 . . 0.261 . . . . . 0.241 . . . . . 20 . 0.863 0.845 0.311 'X-RAY DIFFRACTION' 2.602 2.687 1061 . 62 731 74.7408 . 0.310 . . 0.306 . . . . . 0.280 . . . . . 20 . 0.850 0.853 0.360 'X-RAY DIFFRACTION' 2.687 2.782 1026 . 60 811 84.8928 . 0.298 . . 0.291 . . . . . 0.250 . . . . . 20 . 0.853 0.825 0.403 'X-RAY DIFFRACTION' 2.782 2.886 986 . 75 911 100.0000 . 0.250 . . 0.242 . . . . . 0.220 . . . . . 20 . 0.872 0.839 0.344 'X-RAY DIFFRACTION' 2.886 3.004 962 . 55 907 100.0000 . 0.220 . . 0.218 . . . . . 0.193 . . . . . 20 . 0.905 0.891 0.255 'X-RAY DIFFRACTION' 3.004 3.137 907 . 65 842 100.0000 . 0.217 . . 0.214 . . . . . 0.195 . . . . . 20 . 0.920 0.895 0.258 'X-RAY DIFFRACTION' 3.137 3.290 881 . 63 818 100.0000 . 0.220 . . 0.216 . . . . . 0.196 . . . . . 20 . 0.917 0.900 0.270 'X-RAY DIFFRACTION' 3.290 3.467 840 . 63 630 82.5000 . 0.230 . . 0.227 . . . . . 0.202 . . . . . 20 . 0.920 0.923 0.249 'X-RAY DIFFRACTION' 3.467 3.677 790 . 49 653 88.8608 . 0.246 . . 0.239 . . . . . 0.222 . . . . . 20 . 0.896 0.799 0.333 'X-RAY DIFFRACTION' 3.677 3.930 752 . 44 584 83.5106 . 0.295 . . 0.295 . . . . . 0.267 . . . . . 20 . 0.812 0.870 0.293 'X-RAY DIFFRACTION' 3.930 4.243 708 . 43 637 96.0452 . 0.173 . . 0.168 . . . . . 0.165 . . . . . 20 . 0.951 0.893 0.256 'X-RAY DIFFRACTION' 4.243 4.646 644 . 42 601 99.8447 . 0.176 . . 0.171 . . . . . 0.181 . . . . . 20 . 0.958 0.933 0.242 'X-RAY DIFFRACTION' 4.646 5.191 598 . 43 555 100.0000 . 0.175 . . 0.169 . . . . . 0.184 . . . . . 20 . 0.955 0.932 0.266 'X-RAY DIFFRACTION' 5.191 5.988 528 . 42 486 100.0000 . 0.230 . . 0.225 . . . . . 0.235 . . . . . 20 . 0.943 0.924 0.286 'X-RAY DIFFRACTION' 5.988 7.317 466 . 36 430 100.0000 . 0.232 . . 0.228 . . . . . 0.237 . . . . . 20 . 0.939 0.915 0.271 'X-RAY DIFFRACTION' 7.317 10.278 363 . 17 345 99.7245 . 0.182 . . 0.178 . . . . . 0.214 . . . . . 20 . 0.960 0.925 0.294 'X-RAY DIFFRACTION' 10.278 62.962 231 . 17 213 99.5671 . 0.299 . . 0.292 . . . . . 0.333 . . . . . 20 . 0.917 0.884 0.392 # _struct.entry_id 35UC _struct.title 'Crystal structure of 2-amino-[1,2,4]triazolo[1,5-a]pyridine derivative bound to KIT' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 35UC _struct_keywords.text 'KIT inhibitor, tyrosine kinase inhibitor, gatekeeper, juxtamembrane, inflammation, allergy, chronic urticaria, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP KIT_HUMAN P10721 ? 1 ;TYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAFGKVVEATAYGLIKSDAAMTVAVK MLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGACTIGGPTLVITEYCCYGDLLNFLRRKRDSFICSK ; 544 2 UNP KIT_HUMAN P10721 ? 1 ;TPAIMEDDELALDLEDLLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLP VKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMYDIMKTCWDADPL KRPTFKQIVQLIEKQISESTNHI ; 753 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 35UC AAA 6 ? 155 ? P10721 544 ? 693 ? 544 751 2 2 35UC AAA 156 ? 339 ? P10721 753 ? 935 ? 752 935 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 35UC GLY AAA 1 ? UNP P10721 ? ? 'expression tag' 539 1 1 35UC PRO AAA 2 ? UNP P10721 ? ? 'expression tag' 540 2 1 35UC MET AAA 3 ? UNP P10721 ? ? 'expression tag' 541 3 1 35UC ASP AAA 4 ? UNP P10721 ? ? 'expression tag' 542 4 1 35UC PRO AAA 5 ? UNP P10721 ? ? 'expression tag' 543 5 2 35UC SER AAA 157 ? UNP P10721 ? ? insertion 753 6 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support none _pdbx_struct_assembly_auth_evidence.details ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 34 ? LEU A 38 ? ASP AAA 572 LEU AAA 576 5 ? 5 HELX_P HELX_P2 AA2 ASP A 41 ? GLU A 45 ? ASP AAA 579 GLU AAA 583 5 ? 5 HELX_P HELX_P3 AA3 PRO A 47 ? ASN A 49 ? PRO AAA 585 ASN AAA 587 5 ? 3 HELX_P HELX_P4 AA4 ALA A 91 ? GLY A 110 ? ALA AAA 629 GLY AAA 648 1 ? 20 HELX_P HELX_P5 AA5 ASP A 139 ? LYS A 147 ? ASP AAA 677 LYS AAA 685 1 ? 9 HELX_P HELX_P6 AA6 ASP A 169 ? LYS A 190 ? ASP AAA 765 LYS AAA 786 1 ? 22 HELX_P HELX_P7 AA7 ALA A 198 ? ARG A 200 ? ALA AAA 794 ARG AAA 796 5 ? 3 HELX_P HELX_P8 AA8 PHE A 215 ? ARG A 219 ? PHE AAA 811 ARG AAA 815 5 ? 5 HELX_P HELX_P9 AA9 ASP A 220 ? ASP A 224 ? ASP AAA 816 ASP AAA 820 5 ? 5 HELX_P HELX_P10 AB1 PRO A 236 ? MET A 240 ? PRO AAA 832 MET AAA 836 5 ? 5 HELX_P HELX_P11 AB2 ALA A 241 ? ASN A 247 ? ALA AAA 837 ASN AAA 843 1 ? 7 HELX_P HELX_P12 AB3 THR A 251 ? SER A 268 ? THR AAA 847 SER AAA 864 1 ? 18 HELX_P HELX_P13 AB4 ASP A 280 ? GLY A 290 ? ASP AAA 876 GLY AAA 886 1 ? 11 HELX_P HELX_P14 AB5 PRO A 300 ? TRP A 311 ? PRO AAA 896 TRP AAA 907 1 ? 12 HELX_P HELX_P15 AB6 ASP A 314 ? ARG A 318 ? ASP AAA 910 ARG AAA 914 5 ? 5 HELX_P HELX_P16 AB7 THR A 320 ? GLU A 334 ? THR AAA 916 GLU AAA 930 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 5 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 31 ? TYR A 32 ? VAL AAA 569 TYR AAA 570 AA1 2 LYS A 20 ? GLU A 23 ? LYS AAA 558 GLU AAA 561 AA1 3 CYS A 192 ? ILE A 193 ? CYS AAA 788 ILE AAA 789 AA2 1 LEU A 51 ? ALA A 59 ? LEU AAA 589 ALA AAA 597 AA2 2 GLY A 63 ? ALA A 70 ? GLY AAA 601 ALA AAA 608 AA2 3 THR A 81 ? LEU A 87 ? THR AAA 619 LEU AAA 625 AA2 4 LEU A 129 ? THR A 132 ? LEU AAA 667 THR AAA 670 AA2 5 LEU A 118 ? CYS A 122 ? LEU AAA 656 CYS AAA 660 AA3 1 ILE A 202 ? THR A 205 ? ILE AAA 798 THR AAA 801 AA3 2 ILE A 209 ? ILE A 212 ? ILE AAA 805 ILE AAA 808 AA4 1 VAL A 228 ? LYS A 230 ? VAL AAA 824 LYS AAA 826 AA4 2 ALA A 233 ? LEU A 235 ? ALA AAA 829 LEU AAA 831 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O VAL A 31 ? O VAL AAA 569 N GLU A 23 ? N GLU AAA 561 AA1 2 3 N LYS A 20 ? N LYS AAA 558 O ILE A 193 ? O ILE AAA 789 AA2 1 2 N GLY A 54 ? N GLY AAA 592 O GLU A 67 ? O GLU AAA 605 AA2 2 3 N ALA A 68 ? N ALA AAA 606 O VAL A 82 ? O VAL AAA 620 AA2 3 4 N LYS A 85 ? N LYS AAA 623 O VAL A 130 ? O VAL AAA 668 AA2 4 5 O ILE A 131 ? O ILE AAA 669 N LEU A 119 ? N LEU AAA 657 AA3 1 2 N LEU A 203 ? N LEU AAA 799 O LYS A 211 ? O LYS AAA 807 AA4 1 2 N VAL A 228 ? N VAL AAA 824 O LEU A 235 ? O LEU AAA 831 # _pdbx_entry_details.entry_id 35UC _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest Y _pdbx_entry_details.has_protein_modification N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER AAA 590 ? ? -164.69 118.25 2 1 ASP AAA 792 ? ? -153.47 43.80 3 1 LYS AAA 826 ? ? -163.47 98.34 # _pdbx_distant_solvent_atoms.id 1 _pdbx_distant_solvent_atoms.PDB_model_num 1 _pdbx_distant_solvent_atoms.auth_atom_id O _pdbx_distant_solvent_atoms.label_alt_id ? _pdbx_distant_solvent_atoms.auth_asym_id AAA _pdbx_distant_solvent_atoms.auth_comp_id HOH _pdbx_distant_solvent_atoms.auth_seq_id 1165 _pdbx_distant_solvent_atoms.PDB_ins_code ? _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 6.80 _pdbx_distant_solvent_atoms.neighbor_ligand_distance . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 AAA GLY 539 ? A GLY 1 2 1 Y 1 AAA PRO 540 ? A PRO 2 3 1 Y 1 AAA MET 541 ? A MET 3 4 1 Y 1 AAA ASP 542 ? A ASP 4 5 1 Y 1 AAA PRO 543 ? A PRO 5 6 1 Y 1 AAA THR 544 ? A THR 6 7 1 Y 1 AAA ASN 564 ? A ASN 26 8 1 Y 1 AAA GLY 565 ? A GLY 27 9 1 Y 1 AAA ASN 566 ? A ASN 28 10 1 Y 1 AAA SER 746 ? A SER 150 11 1 Y 1 AAA PHE 747 ? A PHE 151 12 1 Y 1 AAA ILE 748 ? A ILE 152 13 1 Y 1 AAA CYS 749 ? A CYS 153 14 1 Y 1 AAA SER 750 ? A SER 154 15 1 Y 1 AAA LYS 751 ? A LYS 155 16 1 Y 1 AAA THR 752 ? A THR 156 17 1 Y 1 AAA SER 753 ? A SER 157 18 1 Y 1 AAA PRO 754 ? A PRO 158 19 1 Y 1 AAA ALA 755 ? A ALA 159 20 1 Y 1 AAA ILE 756 ? A ILE 160 21 1 Y 1 AAA MET 757 ? A MET 161 22 1 Y 1 AAA GLU 758 ? A GLU 162 23 1 Y 1 AAA ASP 759 ? A ASP 163 24 1 Y 1 AAA HIS 934 ? A HIS 338 25 1 Y 1 AAA ILE 935 ? A ILE 339 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal A1DMF C1 C N N 1 A1DMF C2 C Y N 2 A1DMF C3 C Y N 3 A1DMF C4 C Y N 4 A1DMF C5 C Y N 5 A1DMF C6 C N N 6 A1DMF C7 C Y N 7 A1DMF C8 C Y N 8 A1DMF C11 C Y N 9 A1DMF C12 C Y N 10 A1DMF C15 C Y N 11 A1DMF C16 C Y N 12 A1DMF C17 C Y N 13 A1DMF C18 C Y N 14 A1DMF O1 O N N 15 A1DMF N1 N N N 16 A1DMF F1 F N N 17 A1DMF C9 C N N 18 A1DMF N2 N Y N 19 A1DMF N3 N Y N 20 A1DMF C10 C Y N 21 A1DMF C13 C Y N 22 A1DMF C14 C Y N 23 A1DMF N4 N Y N 24 A1DMF N5 N N N 25 A1DMF N6 N Y N 26 A1DMF N7 N Y N 27 A1DMF H2 H N N 28 A1DMF H3 H N N 29 A1DMF H4 H N N 30 A1DMF H5 H N N 31 A1DMF H6 H N N 32 A1DMF H7 H N N 33 A1DMF H14 H N N 34 A1DMF H15 H N N 35 A1DMF H16 H N N 36 A1DMF H1 H N N 37 A1DMF H8 H N N 38 A1DMF H9 H N N 39 A1DMF H10 H N N 40 A1DMF H11 H N N 41 A1DMF H12 H N N 42 A1DMF H13 H N N 43 ALA N N N N 44 ALA CA C N S 45 ALA C C N N 46 ALA O O N N 47 ALA CB C N N 48 ALA OXT O N N 49 ALA H H N N 50 ALA H2 H N N 51 ALA HA H N N 52 ALA HB1 H N N 53 ALA HB2 H N N 54 ALA HB3 H N N 55 ALA HXT H N N 56 ARG N N N N 57 ARG CA C N S 58 ARG C C N N 59 ARG O O N N 60 ARG CB C N N 61 ARG CG C N N 62 ARG CD C N N 63 ARG NE N N N 64 ARG CZ C N N 65 ARG NH1 N N N 66 ARG NH2 N N N 67 ARG OXT O N N 68 ARG H H N N 69 ARG H2 H N N 70 ARG HA H N N 71 ARG HB2 H N N 72 ARG HB3 H N N 73 ARG HG2 H N N 74 ARG HG3 H N N 75 ARG HD2 H N N 76 ARG HD3 H N N 77 ARG HE H N N 78 ARG HH11 H N N 79 ARG HH12 H N N 80 ARG HH21 H N N 81 ARG HH22 H N N 82 ARG HXT H N N 83 ASN N N N N 84 ASN CA C N S 85 ASN C C N N 86 ASN O O N N 87 ASN CB C N N 88 ASN CG C N N 89 ASN OD1 O N N 90 ASN ND2 N N N 91 ASN OXT O N N 92 ASN H H N N 93 ASN H2 H N N 94 ASN HA H N N 95 ASN HB2 H N N 96 ASN HB3 H N N 97 ASN HD21 H N N 98 ASN HD22 H N N 99 ASN HXT H N N 100 ASP N N N N 101 ASP CA C N S 102 ASP C C N N 103 ASP O O N N 104 ASP CB C N N 105 ASP CG C N N 106 ASP OD1 O N N 107 ASP OD2 O N N 108 ASP OXT O N N 109 ASP H H N N 110 ASP H2 H N N 111 ASP HA H N N 112 ASP HB2 H N N 113 ASP HB3 H N N 114 ASP HD2 H N N 115 ASP HXT H N N 116 CYS N N N N 117 CYS CA C N R 118 CYS C C N N 119 CYS O O N N 120 CYS CB C N N 121 CYS SG S N N 122 CYS OXT O N N 123 CYS H H N N 124 CYS H2 H N N 125 CYS HA H N N 126 CYS HB2 H N N 127 CYS HB3 H N N 128 CYS HG H N N 129 CYS HXT H N N 130 GLN N N N N 131 GLN CA C N S 132 GLN C C N N 133 GLN O O N N 134 GLN CB C N N 135 GLN CG C N N 136 GLN CD C N N 137 GLN OE1 O N N 138 GLN NE2 N N N 139 GLN OXT O N N 140 GLN H H N N 141 GLN H2 H N N 142 GLN HA H N N 143 GLN HB2 H N N 144 GLN HB3 H N N 145 GLN HG2 H N N 146 GLN HG3 H N N 147 GLN HE21 H N N 148 GLN HE22 H N N 149 GLN HXT H N N 150 GLU N N N N 151 GLU CA C N S 152 GLU C C N N 153 GLU O O N N 154 GLU CB C N N 155 GLU CG C N N 156 GLU CD C N N 157 GLU OE1 O N N 158 GLU OE2 O N N 159 GLU OXT O N N 160 GLU H H N N 161 GLU H2 H N N 162 GLU HA H N N 163 GLU HB2 H N N 164 GLU HB3 H N N 165 GLU HG2 H N N 166 GLU HG3 H N N 167 GLU HE2 H N N 168 GLU HXT H N N 169 GLY N N N N 170 GLY CA C N N 171 GLY C C N N 172 GLY O O N N 173 GLY OXT O N N 174 GLY H H N N 175 GLY H2 H N N 176 GLY HA2 H N N 177 GLY HA3 H N N 178 GLY HXT H N N 179 HIS N N N N 180 HIS CA C N S 181 HIS C C N N 182 HIS O O N N 183 HIS CB C N N 184 HIS CG C Y N 185 HIS ND1 N Y N 186 HIS CD2 C Y N 187 HIS CE1 C Y N 188 HIS NE2 N Y N 189 HIS OXT O N N 190 HIS H H N N 191 HIS H2 H N N 192 HIS HA H N N 193 HIS HB2 H N N 194 HIS HB3 H N N 195 HIS HD1 H N N 196 HIS HD2 H N N 197 HIS HE1 H N N 198 HIS HE2 H N N 199 HIS HXT H N N 200 HOH O O N N 201 HOH H1 H N N 202 HOH H2 H N N 203 ILE N N N N 204 ILE CA C N S 205 ILE C C N N 206 ILE O O N N 207 ILE CB C N S 208 ILE CG1 C N N 209 ILE CG2 C N N 210 ILE CD1 C N N 211 ILE OXT O N N 212 ILE H H N N 213 ILE H2 H N N 214 ILE HA H N N 215 ILE HB H N N 216 ILE HG12 H N N 217 ILE HG13 H N N 218 ILE HG21 H N N 219 ILE HG22 H N N 220 ILE HG23 H N N 221 ILE HD11 H N N 222 ILE HD12 H N N 223 ILE HD13 H N N 224 ILE HXT H N N 225 LEU N N N N 226 LEU CA C N S 227 LEU C C N N 228 LEU O O N N 229 LEU CB C N N 230 LEU CG C N N 231 LEU CD1 C N N 232 LEU CD2 C N N 233 LEU OXT O N N 234 LEU H H N N 235 LEU H2 H N N 236 LEU HA H N N 237 LEU HB2 H N N 238 LEU HB3 H N N 239 LEU HG H N N 240 LEU HD11 H N N 241 LEU HD12 H N N 242 LEU HD13 H N N 243 LEU HD21 H N N 244 LEU HD22 H N N 245 LEU HD23 H N N 246 LEU HXT H N N 247 LYS N N N N 248 LYS CA C N S 249 LYS C C N N 250 LYS O O N N 251 LYS CB C N N 252 LYS CG C N N 253 LYS CD C N N 254 LYS CE C N N 255 LYS NZ N N N 256 LYS OXT O N N 257 LYS H H N N 258 LYS H2 H N N 259 LYS HA H N N 260 LYS HB2 H N N 261 LYS HB3 H N N 262 LYS HG2 H N N 263 LYS HG3 H N N 264 LYS HD2 H N N 265 LYS HD3 H N N 266 LYS HE2 H N N 267 LYS HE3 H N N 268 LYS HZ1 H N N 269 LYS HZ2 H N N 270 LYS HZ3 H N N 271 LYS HXT H N N 272 MET N N N N 273 MET CA C N S 274 MET C C N N 275 MET O O N N 276 MET CB C N N 277 MET CG C N N 278 MET SD S N N 279 MET CE C N N 280 MET OXT O N N 281 MET H H N N 282 MET H2 H N N 283 MET HA H N N 284 MET HB2 H N N 285 MET HB3 H N N 286 MET HG2 H N N 287 MET HG3 H N N 288 MET HE1 H N N 289 MET HE2 H N N 290 MET HE3 H N N 291 MET HXT H N N 292 PHE N N N N 293 PHE CA C N S 294 PHE C C N N 295 PHE O O N N 296 PHE CB C N N 297 PHE CG C Y N 298 PHE CD1 C Y N 299 PHE CD2 C Y N 300 PHE CE1 C Y N 301 PHE CE2 C Y N 302 PHE CZ C Y N 303 PHE OXT O N N 304 PHE H H N N 305 PHE H2 H N N 306 PHE HA H N N 307 PHE HB2 H N N 308 PHE HB3 H N N 309 PHE HD1 H N N 310 PHE HD2 H N N 311 PHE HE1 H N N 312 PHE HE2 H N N 313 PHE HZ H N N 314 PHE HXT H N N 315 PRO N N N N 316 PRO CA C N S 317 PRO C C N N 318 PRO O O N N 319 PRO CB C N N 320 PRO CG C N N 321 PRO CD C N N 322 PRO OXT O N N 323 PRO H H N N 324 PRO HA H N N 325 PRO HB2 H N N 326 PRO HB3 H N N 327 PRO HG2 H N N 328 PRO HG3 H N N 329 PRO HD2 H N N 330 PRO HD3 H N N 331 PRO HXT H N N 332 SER N N N N 333 SER CA C N S 334 SER C C N N 335 SER O O N N 336 SER CB C N N 337 SER OG O N N 338 SER OXT O N N 339 SER H H N N 340 SER H2 H N N 341 SER HA H N N 342 SER HB2 H N N 343 SER HB3 H N N 344 SER HG H N N 345 SER HXT H N N 346 THR N N N N 347 THR CA C N S 348 THR C C N N 349 THR O O N N 350 THR CB C N R 351 THR OG1 O N N 352 THR CG2 C N N 353 THR OXT O N N 354 THR H H N N 355 THR H2 H N N 356 THR HA H N N 357 THR HB H N N 358 THR HG1 H N N 359 THR HG21 H N N 360 THR HG22 H N N 361 THR HG23 H N N 362 THR HXT H N N 363 TRP N N N N 364 TRP CA C N S 365 TRP C C N N 366 TRP O O N N 367 TRP CB C N N 368 TRP CG C Y N 369 TRP CD1 C Y N 370 TRP CD2 C Y N 371 TRP NE1 N Y N 372 TRP CE2 C Y N 373 TRP CE3 C Y N 374 TRP CZ2 C Y N 375 TRP CZ3 C Y N 376 TRP CH2 C Y N 377 TRP OXT O N N 378 TRP H H N N 379 TRP H2 H N N 380 TRP HA H N N 381 TRP HB2 H N N 382 TRP HB3 H N N 383 TRP HD1 H N N 384 TRP HE1 H N N 385 TRP HE3 H N N 386 TRP HZ2 H N N 387 TRP HZ3 H N N 388 TRP HH2 H N N 389 TRP HXT H N N 390 TYR N N N N 391 TYR CA C N S 392 TYR C C N N 393 TYR O O N N 394 TYR CB C N N 395 TYR CG C Y N 396 TYR CD1 C Y N 397 TYR CD2 C Y N 398 TYR CE1 C Y N 399 TYR CE2 C Y N 400 TYR CZ C Y N 401 TYR OH O N N 402 TYR OXT O N N 403 TYR H H N N 404 TYR H2 H N N 405 TYR HA H N N 406 TYR HB2 H N N 407 TYR HB3 H N N 408 TYR HD1 H N N 409 TYR HD2 H N N 410 TYR HE1 H N N 411 TYR HE2 H N N 412 TYR HH H N N 413 TYR HXT H N N 414 VAL N N N N 415 VAL CA C N S 416 VAL C C N N 417 VAL O O N N 418 VAL CB C N N 419 VAL CG1 C N N 420 VAL CG2 C N N 421 VAL OXT O N N 422 VAL H H N N 423 VAL H2 H N N 424 VAL HA H N N 425 VAL HB H N N 426 VAL HG11 H N N 427 VAL HG12 H N N 428 VAL HG13 H N N 429 VAL HG21 H N N 430 VAL HG22 H N N 431 VAL HG23 H N N 432 VAL HXT H N N 433 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal A1DMF O1 C1 doub N N 1 A1DMF C1 N1 sing N N 2 A1DMF N1 C2 sing N N 3 A1DMF C2 C3 doub Y N 4 A1DMF C3 F1 sing N N 5 A1DMF C3 C4 sing Y N 6 A1DMF C4 C5 doub Y N 7 A1DMF C5 C6 sing N N 8 A1DMF C5 C7 sing Y N 9 A1DMF C7 C8 doub Y N 10 A1DMF C1 C9 sing N N 11 A1DMF C9 N2 sing N N 12 A1DMF N2 N3 sing Y N 13 A1DMF N3 C10 doub Y N 14 A1DMF C10 C11 sing Y N 15 A1DMF C11 C12 sing N N 16 A1DMF C12 C13 doub Y N 17 A1DMF C13 C14 sing Y N 18 A1DMF C14 N4 doub Y N 19 A1DMF N4 C15 sing Y N 20 A1DMF C15 N5 sing N N 21 A1DMF C15 N6 doub Y N 22 A1DMF N6 N7 sing Y N 23 A1DMF N7 C16 sing Y N 24 A1DMF C16 C17 doub Y N 25 A1DMF C11 C18 doub Y N 26 A1DMF C2 C8 sing Y N 27 A1DMF N2 C18 sing Y N 28 A1DMF C12 C17 sing Y N 29 A1DMF C14 N7 sing Y N 30 A1DMF C4 H2 sing N N 31 A1DMF C6 H3 sing N N 32 A1DMF C6 H4 sing N N 33 A1DMF C6 H5 sing N N 34 A1DMF C7 H6 sing N N 35 A1DMF C8 H7 sing N N 36 A1DMF C16 H14 sing N N 37 A1DMF C17 H15 sing N N 38 A1DMF C18 H16 sing N N 39 A1DMF N1 H1 sing N N 40 A1DMF C9 H8 sing N N 41 A1DMF C9 H9 sing N N 42 A1DMF C10 H10 sing N N 43 A1DMF C13 H11 sing N N 44 A1DMF N5 H12 sing N N 45 A1DMF N5 H13 sing N N 46 ALA N CA sing N N 47 ALA N H sing N N 48 ALA N H2 sing N N 49 ALA CA C sing N N 50 ALA CA CB sing N N 51 ALA CA HA sing N N 52 ALA C O doub N N 53 ALA C OXT sing N N 54 ALA CB HB1 sing N N 55 ALA CB HB2 sing N N 56 ALA CB HB3 sing N N 57 ALA OXT HXT sing N N 58 ARG N CA sing N N 59 ARG N H sing N N 60 ARG N H2 sing N N 61 ARG CA C sing N N 62 ARG CA CB sing N N 63 ARG CA HA sing N N 64 ARG C O doub N N 65 ARG C OXT sing N N 66 ARG CB CG sing N N 67 ARG CB HB2 sing N N 68 ARG CB HB3 sing N N 69 ARG CG CD sing N N 70 ARG CG HG2 sing N N 71 ARG CG HG3 sing N N 72 ARG CD NE sing N N 73 ARG CD HD2 sing N N 74 ARG CD HD3 sing N N 75 ARG NE CZ sing N N 76 ARG NE HE sing N N 77 ARG CZ NH1 sing N N 78 ARG CZ NH2 doub N N 79 ARG NH1 HH11 sing N N 80 ARG NH1 HH12 sing N N 81 ARG NH2 HH21 sing N N 82 ARG NH2 HH22 sing N N 83 ARG OXT HXT sing N N 84 ASN N CA sing N N 85 ASN N H sing N N 86 ASN N H2 sing N N 87 ASN CA C sing N N 88 ASN CA CB sing N N 89 ASN CA HA sing N N 90 ASN C O doub N N 91 ASN C OXT sing N N 92 ASN CB CG sing N N 93 ASN CB HB2 sing N N 94 ASN CB HB3 sing N N 95 ASN CG OD1 doub N N 96 ASN CG ND2 sing N N 97 ASN ND2 HD21 sing N N 98 ASN ND2 HD22 sing N N 99 ASN OXT HXT sing N N 100 ASP N CA sing N N 101 ASP N H sing N N 102 ASP N H2 sing N N 103 ASP CA C sing N N 104 ASP CA CB sing N N 105 ASP CA HA sing N N 106 ASP C O doub N N 107 ASP C OXT sing N N 108 ASP CB CG sing N N 109 ASP CB HB2 sing N N 110 ASP CB HB3 sing N N 111 ASP CG OD1 doub N N 112 ASP CG OD2 sing N N 113 ASP OD2 HD2 sing N N 114 ASP OXT HXT sing N N 115 CYS N CA sing N N 116 CYS N H sing N N 117 CYS N H2 sing N N 118 CYS CA C sing N N 119 CYS CA CB sing N N 120 CYS CA HA sing N N 121 CYS C O doub N N 122 CYS C OXT sing N N 123 CYS CB SG sing N N 124 CYS CB HB2 sing N N 125 CYS CB HB3 sing N N 126 CYS SG HG sing N N 127 CYS OXT HXT sing N N 128 GLN N CA sing N N 129 GLN N H sing N N 130 GLN N H2 sing N N 131 GLN CA C sing N N 132 GLN CA CB sing N N 133 GLN CA HA sing N N 134 GLN C O doub N N 135 GLN C OXT sing N N 136 GLN CB CG sing N N 137 GLN CB HB2 sing N N 138 GLN CB HB3 sing N N 139 GLN CG CD sing N N 140 GLN CG HG2 sing N N 141 GLN CG HG3 sing N N 142 GLN CD OE1 doub N N 143 GLN CD NE2 sing N N 144 GLN NE2 HE21 sing N N 145 GLN NE2 HE22 sing N N 146 GLN OXT HXT sing N N 147 GLU N CA sing N N 148 GLU N H sing N N 149 GLU N H2 sing N N 150 GLU CA C sing N N 151 GLU CA CB sing N N 152 GLU CA HA sing N N 153 GLU C O doub N N 154 GLU C OXT sing N N 155 GLU CB CG sing N N 156 GLU CB HB2 sing N N 157 GLU CB HB3 sing N N 158 GLU CG CD sing N N 159 GLU CG HG2 sing N N 160 GLU CG HG3 sing N N 161 GLU CD OE1 doub N N 162 GLU CD OE2 sing N N 163 GLU OE2 HE2 sing N N 164 GLU OXT HXT sing N N 165 GLY N CA sing N N 166 GLY N H sing N N 167 GLY N H2 sing N N 168 GLY CA C sing N N 169 GLY CA HA2 sing N N 170 GLY CA HA3 sing N N 171 GLY C O doub N N 172 GLY C OXT sing N N 173 GLY OXT HXT sing N N 174 HIS N CA sing N N 175 HIS N H sing N N 176 HIS N H2 sing N N 177 HIS CA C sing N N 178 HIS CA CB sing N N 179 HIS CA HA sing N N 180 HIS C O doub N N 181 HIS C OXT sing N N 182 HIS CB CG sing N N 183 HIS CB HB2 sing N N 184 HIS CB HB3 sing N N 185 HIS CG ND1 sing Y N 186 HIS CG CD2 doub Y N 187 HIS ND1 CE1 doub Y N 188 HIS ND1 HD1 sing N N 189 HIS CD2 NE2 sing Y N 190 HIS CD2 HD2 sing N N 191 HIS CE1 NE2 sing Y N 192 HIS CE1 HE1 sing N N 193 HIS NE2 HE2 sing N N 194 HIS OXT HXT sing N N 195 HOH O H1 sing N N 196 HOH O H2 sing N N 197 ILE N CA sing N N 198 ILE N H sing N N 199 ILE N H2 sing N N 200 ILE CA C sing N N 201 ILE CA CB sing N N 202 ILE CA HA sing N N 203 ILE C O doub N N 204 ILE C OXT sing N N 205 ILE CB CG1 sing N N 206 ILE CB CG2 sing N N 207 ILE CB HB sing N N 208 ILE CG1 CD1 sing N N 209 ILE CG1 HG12 sing N N 210 ILE CG1 HG13 sing N N 211 ILE CG2 HG21 sing N N 212 ILE CG2 HG22 sing N N 213 ILE CG2 HG23 sing N N 214 ILE CD1 HD11 sing N N 215 ILE CD1 HD12 sing N N 216 ILE CD1 HD13 sing N N 217 ILE OXT HXT sing N N 218 LEU N CA sing N N 219 LEU N H sing N N 220 LEU N H2 sing N N 221 LEU CA C sing N N 222 LEU CA CB sing N N 223 LEU CA HA sing N N 224 LEU C O doub N N 225 LEU C OXT sing N N 226 LEU CB CG sing N N 227 LEU CB HB2 sing N N 228 LEU CB HB3 sing N N 229 LEU CG CD1 sing N N 230 LEU CG CD2 sing N N 231 LEU CG HG sing N N 232 LEU CD1 HD11 sing N N 233 LEU CD1 HD12 sing N N 234 LEU CD1 HD13 sing N N 235 LEU CD2 HD21 sing N N 236 LEU CD2 HD22 sing N N 237 LEU CD2 HD23 sing N N 238 LEU OXT HXT sing N N 239 LYS N CA sing N N 240 LYS N H sing N N 241 LYS N H2 sing N N 242 LYS CA C sing N N 243 LYS CA CB sing N N 244 LYS CA HA sing N N 245 LYS C O doub N N 246 LYS C OXT sing N N 247 LYS CB CG sing N N 248 LYS CB HB2 sing N N 249 LYS CB HB3 sing N N 250 LYS CG CD sing N N 251 LYS CG HG2 sing N N 252 LYS CG HG3 sing N N 253 LYS CD CE sing N N 254 LYS CD HD2 sing N N 255 LYS CD HD3 sing N N 256 LYS CE NZ sing N N 257 LYS CE HE2 sing N N 258 LYS CE HE3 sing N N 259 LYS NZ HZ1 sing N N 260 LYS NZ HZ2 sing N N 261 LYS NZ HZ3 sing N N 262 LYS OXT HXT sing N N 263 MET N CA sing N N 264 MET N H sing N N 265 MET N H2 sing N N 266 MET CA C sing N N 267 MET CA CB sing N N 268 MET CA HA sing N N 269 MET C O doub N N 270 MET C OXT sing N N 271 MET CB CG sing N N 272 MET CB HB2 sing N N 273 MET CB HB3 sing N N 274 MET CG SD sing N N 275 MET CG HG2 sing N N 276 MET CG HG3 sing N N 277 MET SD CE sing N N 278 MET CE HE1 sing N N 279 MET CE HE2 sing N N 280 MET CE HE3 sing N N 281 MET OXT HXT sing N N 282 PHE N CA sing N N 283 PHE N H sing N N 284 PHE N H2 sing N N 285 PHE CA C sing N N 286 PHE CA CB sing N N 287 PHE CA HA sing N N 288 PHE C O doub N N 289 PHE C OXT sing N N 290 PHE CB CG sing N N 291 PHE CB HB2 sing N N 292 PHE CB HB3 sing N N 293 PHE CG CD1 doub Y N 294 PHE CG CD2 sing Y N 295 PHE CD1 CE1 sing Y N 296 PHE CD1 HD1 sing N N 297 PHE CD2 CE2 doub Y N 298 PHE CD2 HD2 sing N N 299 PHE CE1 CZ doub Y N 300 PHE CE1 HE1 sing N N 301 PHE CE2 CZ sing Y N 302 PHE CE2 HE2 sing N N 303 PHE CZ HZ sing N N 304 PHE OXT HXT sing N N 305 PRO N CA sing N N 306 PRO N CD sing N N 307 PRO N H sing N N 308 PRO CA C sing N N 309 PRO CA CB sing N N 310 PRO CA HA sing N N 311 PRO C O doub N N 312 PRO C OXT sing N N 313 PRO CB CG sing N N 314 PRO CB HB2 sing N N 315 PRO CB HB3 sing N N 316 PRO CG CD sing N N 317 PRO CG HG2 sing N N 318 PRO CG HG3 sing N N 319 PRO CD HD2 sing N N 320 PRO CD HD3 sing N N 321 PRO OXT HXT sing N N 322 SER N CA sing N N 323 SER N H sing N N 324 SER N H2 sing N N 325 SER CA C sing N N 326 SER CA CB sing N N 327 SER CA HA sing N N 328 SER C O doub N N 329 SER C OXT sing N N 330 SER CB OG sing N N 331 SER CB HB2 sing N N 332 SER CB HB3 sing N N 333 SER OG HG sing N N 334 SER OXT HXT sing N N 335 THR N CA sing N N 336 THR N H sing N N 337 THR N H2 sing N N 338 THR CA C sing N N 339 THR CA CB sing N N 340 THR CA HA sing N N 341 THR C O doub N N 342 THR C OXT sing N N 343 THR CB OG1 sing N N 344 THR CB CG2 sing N N 345 THR CB HB sing N N 346 THR OG1 HG1 sing N N 347 THR CG2 HG21 sing N N 348 THR CG2 HG22 sing N N 349 THR CG2 HG23 sing N N 350 THR OXT HXT sing N N 351 TRP N CA sing N N 352 TRP N H sing N N 353 TRP N H2 sing N N 354 TRP CA C sing N N 355 TRP CA CB sing N N 356 TRP CA HA sing N N 357 TRP C O doub N N 358 TRP C OXT sing N N 359 TRP CB CG sing N N 360 TRP CB HB2 sing N N 361 TRP CB HB3 sing N N 362 TRP CG CD1 doub Y N 363 TRP CG CD2 sing Y N 364 TRP CD1 NE1 sing Y N 365 TRP CD1 HD1 sing N N 366 TRP CD2 CE2 doub Y N 367 TRP CD2 CE3 sing Y N 368 TRP NE1 CE2 sing Y N 369 TRP NE1 HE1 sing N N 370 TRP CE2 CZ2 sing Y N 371 TRP CE3 CZ3 doub Y N 372 TRP CE3 HE3 sing N N 373 TRP CZ2 CH2 doub Y N 374 TRP CZ2 HZ2 sing N N 375 TRP CZ3 CH2 sing Y N 376 TRP CZ3 HZ3 sing N N 377 TRP CH2 HH2 sing N N 378 TRP OXT HXT sing N N 379 TYR N CA sing N N 380 TYR N H sing N N 381 TYR N H2 sing N N 382 TYR CA C sing N N 383 TYR CA CB sing N N 384 TYR CA HA sing N N 385 TYR C O doub N N 386 TYR C OXT sing N N 387 TYR CB CG sing N N 388 TYR CB HB2 sing N N 389 TYR CB HB3 sing N N 390 TYR CG CD1 doub Y N 391 TYR CG CD2 sing Y N 392 TYR CD1 CE1 sing Y N 393 TYR CD1 HD1 sing N N 394 TYR CD2 CE2 doub Y N 395 TYR CD2 HD2 sing N N 396 TYR CE1 CZ doub Y N 397 TYR CE1 HE1 sing N N 398 TYR CE2 CZ sing Y N 399 TYR CE2 HE2 sing N N 400 TYR CZ OH sing N N 401 TYR OH HH sing N N 402 TYR OXT HXT sing N N 403 VAL N CA sing N N 404 VAL N H sing N N 405 VAL N H2 sing N N 406 VAL CA C sing N N 407 VAL CA CB sing N N 408 VAL CA HA sing N N 409 VAL C O doub N N 410 VAL C OXT sing N N 411 VAL CB CG1 sing N N 412 VAL CB CG2 sing N N 413 VAL CB HB sing N N 414 VAL CG1 HG11 sing N N 415 VAL CG1 HG12 sing N N 416 VAL CG1 HG13 sing N N 417 VAL CG2 HG21 sing N N 418 VAL CG2 HG22 sing N N 419 VAL CG2 HG23 sing N N 420 VAL OXT HXT sing N N 421 # _pdbx_audit_support.funding_organization 'Not funded' _pdbx_audit_support.country ? _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name Other _pdbx_initial_refinement_model.accession_code ? _pdbx_initial_refinement_model.details 'proprietary model' # _atom_sites.entry_id 35UC _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 0.022255 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012320 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010023 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol _atom_type.pdbx_scat_Z _atom_type.pdbx_N_electrons _atom_type.scat_Cromer_Mann_a1 _atom_type.scat_Cromer_Mann_b1 _atom_type.scat_Cromer_Mann_a2 _atom_type.scat_Cromer_Mann_b2 _atom_type.scat_Cromer_Mann_a3 _atom_type.scat_Cromer_Mann_b3 _atom_type.scat_Cromer_Mann_a4 _atom_type.scat_Cromer_Mann_b4 _atom_type.scat_Cromer_Mann_c C 6 6 2.310 20.844 1.020 10.208 1.589 0.569 0.865 51.651 0.216 F 9 9 3.539 10.282 2.641 4.294 1.517 0.262 1.024 26.148 0.306 H 1 1 0.493 10.511 0.323 26.126 0.140 3.142 0.041 57.800 0.003 N 7 7 12.222 0.006 3.135 9.893 2.014 28.997 1.167 0.583 -11.538 O 8 8 3.049 13.277 2.287 5.701 1.546 0.324 0.867 32.909 0.251 S 16 16 6.905 1.468 5.203 22.215 1.438 0.254 1.586 56.172 1.056 # loop_ #