data_38TI # _entry.id 38TI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.417 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 38TI pdb_000038ti 10.2210/pdb38ti/pdb WWPDB D_1000311735 ? ? BMRB 52977 ? 10.13018/BMR52977 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2026-10-14 _pdbx_audit_revision_history.part_number ? # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 38TI _pdbx_database_status.recvd_initial_deposition_date 2026-09-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.status_code_nmr_data REL _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # _pdbx_database_related.db_name BMRB _pdbx_database_related.details . _pdbx_database_related.db_id 52977 _pdbx_database_related.content_type unspecified # _pdbx_contact_author.id 5 _pdbx_contact_author.email sebastien.poget@csi.cuny.edu _pdbx_contact_author.name_first Sebastien _pdbx_contact_author.name_last Poget _pdbx_contact_author.name_mi F _pdbx_contact_author.role 'principal investigator/group leader' _pdbx_contact_author.identifier_ORCID 0000-0003-1724-3386 # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Adhikary, K.' 1 0000-0002-4721-6744 'Poget, S.F.' 2 0000-0003-1724-3386 'Zhuang, J.' 3 0000-0001-6229-9771 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'STRUCTURAL CHARACTERIZATION OF A TARANTULA TOXIN AND ITS INTERACTIONS WITH LIPID BILAYERS AND VOLTAGE-GATED SODIUM CHANNELS' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_patent ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Adhikary, K.' 1 0000-0002-4721-6744 primary 'Poget, S.F.' 2 0000-0003-1724-3386 primary 'Zhuang, J.' 3 0000-0001-6229-9771 # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description Kappa-theraphotoxin-Gr2c _entity.formula_weight 4049.851 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Kappa-TRTX-Gr2c,GTx2-1-1,GsAF II,GsAFII,GsAf2,Mechanotoxin-alpha' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GYCQKWMWTCDEERKCCEGLVCRLWCKKKIEW _entity_poly.pdbx_seq_one_letter_code_can GYCQKWMWTCDEERKCCEGLVCRLWCKKKIEW _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 TYR n 1 3 CYS n 1 4 GLN n 1 5 LYS n 1 6 TRP n 1 7 MET n 1 8 TRP n 1 9 THR n 1 10 CYS n 1 11 ASP n 1 12 GLU n 1 13 GLU n 1 14 ARG n 1 15 LYS n 1 16 CYS n 1 17 CYS n 1 18 GLU n 1 19 GLY n 1 20 LEU n 1 21 VAL n 1 22 CYS n 1 23 ARG n 1 24 LEU n 1 25 TRP n 1 26 CYS n 1 27 LYS n 1 28 LYS n 1 29 LYS n 1 30 ILE n 1 31 GLU n 1 32 TRP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 32 _entity_src_gen.gene_src_common_name 'Chilean rose tarantula' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Grammostola rosea' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 432528 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 0 GLY GLY A . n A 1 2 TYR 2 1 1 TYR TYR A . n A 1 3 CYS 3 2 2 CYS CYS A . n A 1 4 GLN 4 3 3 GLN GLN A . n A 1 5 LYS 5 4 4 LYS LYS A . n A 1 6 TRP 6 5 5 TRP TRP A . n A 1 7 MET 7 6 6 MET MET A . n A 1 8 TRP 8 7 7 TRP TRP A . n A 1 9 THR 9 8 8 THR THR A . n A 1 10 CYS 10 9 9 CYS CYS A . n A 1 11 ASP 11 10 10 ASP ASP A . n A 1 12 GLU 12 11 11 GLU GLU A . n A 1 13 GLU 13 12 12 GLU GLU A . n A 1 14 ARG 14 13 13 ARG ARG A . n A 1 15 LYS 15 14 14 LYS LYS A . n A 1 16 CYS 16 15 15 CYS CYS A . n A 1 17 CYS 17 16 16 CYS CYS A . n A 1 18 GLU 18 17 17 GLU GLU A . n A 1 19 GLY 19 18 18 GLY GLY A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 VAL 21 20 20 VAL VAL A . n A 1 22 CYS 22 21 21 CYS CYS A . n A 1 23 ARG 23 22 22 ARG ARG A . n A 1 24 LEU 24 23 23 LEU LEU A . n A 1 25 TRP 25 24 24 TRP TRP A . n A 1 26 CYS 26 25 25 CYS CYS A . n A 1 27 LYS 27 26 26 LYS LYS A . n A 1 28 LYS 28 27 27 LYS LYS A . n A 1 29 LYS 29 28 28 LYS LYS A . n A 1 30 ILE 30 29 29 ILE ILE A . n A 1 31 GLU 31 30 30 GLU GLU A . n A 1 32 TRP 32 31 31 TRP TRP A . n # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 38TI _exptl.crystals_number ? _exptl.details ? _exptl.method 'SOLUTION NMR' _exptl.method_details ? # _struct.entry_id 38TI _struct.title 'NMR solution structure of recombinant tarantula neurotoxin GsAF2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 38TI _struct_keywords.text ;GsAF2, GsAFII, GsAF-2, GsAF-II, tarantula toxin, spider toxin, neurotoxin, peptide neurotoxin, Nav inhibitor, Cav inhibitor, Kv inhibitor, SAC inhibitor, TOXIN ; _struct_keywords.pdbx_keywords TOXIN # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code AF2_GRARO _struct_ref.pdbx_db_accession P61409 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code YCQKWMWTCDEERKCCEGLVCRLWCKKKIEW _struct_ref.pdbx_align_begin 51 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 38TI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 32 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P61409 _struct_ref_seq.db_align_beg 51 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 81 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 31 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 38TI _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P61409 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # _pdbx_struct_assembly_auth_evidence.id 1 _pdbx_struct_assembly_auth_evidence.assembly_id 1 _pdbx_struct_assembly_auth_evidence.experimental_support 'NMR Distance Restraints' _pdbx_struct_assembly_auth_evidence.details ;The last run was run with unambiguous restraints. We used the restraints and peaks generated by Aria in the previous run for our final refinement. ; # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0 _pdbx_struct_oper_list.matrix[1][2] 0.0 _pdbx_struct_oper_list.matrix[1][3] 0.0 _pdbx_struct_oper_list.vector[1] 0.0 _pdbx_struct_oper_list.matrix[2][1] 0.0 _pdbx_struct_oper_list.matrix[2][2] 1.0 _pdbx_struct_oper_list.matrix[2][3] 0.0 _pdbx_struct_oper_list.vector[2] 0.0 _pdbx_struct_oper_list.matrix[3][1] 0.0 _pdbx_struct_oper_list.matrix[3][2] 0.0 _pdbx_struct_oper_list.matrix[3][3] 1.0 _pdbx_struct_oper_list.vector[3] 0.0 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 3 SG ? ? ? 1_555 A CYS 17 SG ? ? A CYS 2 A CYS 16 1_555 ? ? ? ? ? ? ? 2.028 ? ? disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 22 SG ? ? A CYS 9 A CYS 21 1_555 ? ? ? ? ? ? ? 2.021 ? ? disulf3 disulf ? ? A CYS 16 SG ? ? ? 1_555 A CYS 26 SG ? ? A CYS 15 A CYS 25 1_555 ? ? ? ? ? ? ? 2.032 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 3 ? CYS A 17 ? CYS A 2 ? 1_555 CYS A 16 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 10 ? CYS A 22 ? CYS A 9 ? 1_555 CYS A 21 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 16 ? CYS A 26 ? CYS A 15 ? 1_555 CYS A 25 ? 1_555 SG SG . . . None 'Disulfide bridge' # _pdbx_entry_details.entry_id 38TI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 4 OE1 A GLU 17 ? ? HZ3 A LYS 28 ? ? 1.59 2 11 HZ1 A LYS 4 ? ? OE1 A GLU 17 ? ? 1.59 3 20 OE1 A GLU 11 ? ? HZ1 A LYS 14 ? ? 1.57 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 17 ? ? 70.52 37.71 2 1 ARG A 22 ? ? -109.99 -156.50 3 1 LYS A 27 ? ? -68.62 -179.31 4 2 ARG A 22 ? ? -89.62 -155.66 5 3 GLU A 17 ? ? 66.07 64.77 6 3 ARG A 22 ? ? -83.35 -155.52 7 3 GLU A 30 ? ? -92.72 44.53 8 4 TYR A 1 ? ? 56.41 73.36 9 4 ARG A 22 ? ? -87.60 -153.88 10 5 THR A 8 ? ? -93.75 42.59 11 5 GLU A 11 ? ? -67.64 1.09 12 5 ARG A 22 ? ? -122.67 -154.70 13 5 ILE A 29 ? ? -138.51 -55.18 14 6 TYR A 1 ? ? -98.54 -61.43 15 6 CYS A 2 ? ? -176.45 149.74 16 6 THR A 8 ? ? -105.01 46.68 17 6 ARG A 22 ? ? -128.38 -153.17 18 7 TRP A 7 ? ? -69.99 -177.41 19 7 GLU A 17 ? ? 70.13 48.29 20 7 ARG A 22 ? ? -93.21 -154.19 21 7 ILE A 29 ? ? -113.05 -72.58 22 8 GLU A 17 ? ? 58.37 -163.62 23 8 ARG A 22 ? ? -109.82 -154.52 24 9 TYR A 1 ? ? 69.56 -65.36 25 9 ARG A 22 ? ? -118.51 -155.11 26 10 ARG A 22 ? ? -78.83 -157.20 27 10 ILE A 29 ? ? -141.58 14.49 28 11 ARG A 22 ? ? -108.21 -155.61 29 11 ILE A 29 ? ? -121.56 -53.89 30 11 GLU A 30 ? ? 64.24 65.91 31 12 GLU A 17 ? ? 60.98 -156.44 32 12 ARG A 22 ? ? -86.08 -153.57 33 13 ARG A 22 ? ? -110.82 -158.31 34 14 GLN A 3 ? ? -70.99 23.25 35 14 GLU A 17 ? ? 58.70 -154.86 36 14 ARG A 22 ? ? -104.74 -153.95 37 15 THR A 8 ? ? -108.35 46.01 38 15 ARG A 22 ? ? -133.62 -156.06 39 16 THR A 8 ? ? -106.35 43.44 40 16 ARG A 22 ? ? -123.60 -154.76 41 17 ARG A 22 ? ? -110.72 -158.00 42 17 GLU A 30 ? ? 54.00 18.17 43 18 GLU A 17 ? ? 66.08 -168.97 44 18 ARG A 22 ? ? -87.92 -156.75 45 18 GLU A 30 ? ? 54.13 -95.47 46 19 THR A 8 ? ? -102.41 45.27 47 19 GLU A 17 ? ? 62.56 -168.69 48 19 ARG A 22 ? ? -123.13 -153.99 49 19 ILE A 29 ? ? -154.91 -35.90 50 19 GLU A 30 ? ? 72.10 -79.74 51 20 CYS A 2 ? ? 73.67 151.47 52 20 GLU A 17 ? ? 62.32 -167.03 53 20 ARG A 22 ? ? -95.97 -154.48 # _pdbx_nmr_ensemble.entry_id 38TI _pdbx_nmr_ensemble.conformers_calculated_total_number 300 _pdbx_nmr_ensemble.conformers_submitted_total_number 20 _pdbx_nmr_ensemble.conformer_selection_criteria 'all calculated structures submitted' _pdbx_nmr_ensemble.representative_conformer ? _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_representative.entry_id 38TI _pdbx_nmr_representative.conformer_id 1 _pdbx_nmr_representative.selection_criteria 'target function' # loop_ _pdbx_nmr_sample_details.solution_id _pdbx_nmr_sample_details.contents _pdbx_nmr_sample_details.solvent_system _pdbx_nmr_sample_details.label _pdbx_nmr_sample_details.type _pdbx_nmr_sample_details.details 1 '200 uM [U-100% 15N] Kappa-theraphotoxin-Gr2c, 10 mM KH2PO4, 20 mM potassium chloride, 95% H2O/5% D2O' '95% H2O/5% D2O' 15N solution 'The sample was lyophilized and dissolved in 10 mM KH2PO4, 20 mM KCl, pH 6.95' 2 '60 uM [U-13C; U-15N] Kappa-theraphotoxin-Gr2c, 10 mM KH2PO4, 20 mM potassium chloride, 95% H2O/5% D2O' '95% H2O/5% D2O' 13C-15N solution 'The sample was lyophilized and dissolved in 10 mM KH2PO4, 20 mM KCl, pH 6.95' # loop_ _pdbx_nmr_exptl_sample.solution_id _pdbx_nmr_exptl_sample.component _pdbx_nmr_exptl_sample.concentration _pdbx_nmr_exptl_sample.concentration_range _pdbx_nmr_exptl_sample.concentration_units _pdbx_nmr_exptl_sample.isotopic_labeling 1 Kappa-theraphotoxin-Gr2c 200 ? uM '[U-100% 15N]' 1 KH2PO4 10 ? mM 'natural abundance' 1 'potassium chloride' 20 ? mM 'natural abundance' 2 Kappa-theraphotoxin-Gr2c 60 ? uM '[U-13C; U-15N]' 2 KH2PO4 10 ? mM 'natural abundance' 2 'potassium chloride' 20 ? mM 'natural abundance' # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 299 _pdbx_nmr_exptl_sample_conditions.pressure_units bar _pdbx_nmr_exptl_sample_conditions.pressure 1.01325 _pdbx_nmr_exptl_sample_conditions.pH 6.95 _pdbx_nmr_exptl_sample_conditions.ionic_strength 30 _pdbx_nmr_exptl_sample_conditions.details ;The same conditions were used for both samples. The only difference was the concentration and the labeling, as mentioned already in "Sample information". ; _pdbx_nmr_exptl_sample_conditions.ionic_strength_err ? _pdbx_nmr_exptl_sample_conditions.ionic_strength_units mM _pdbx_nmr_exptl_sample_conditions.label conditions_1 _pdbx_nmr_exptl_sample_conditions.pH_err ? _pdbx_nmr_exptl_sample_conditions.pH_units pH _pdbx_nmr_exptl_sample_conditions.pressure_err ? _pdbx_nmr_exptl_sample_conditions.temperature_err ? _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.solution_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.spectrometer_id _pdbx_nmr_exptl.sample_state 1 1 1 '2D 1H-15N HSQC' 1 isotropic 2 1 1 '3D 1H-15N TOCSY' 1 isotropic 3 1 1 '3D 1H-15N NOESY' 1 isotropic 4 1 2 '2D 1H-13C HSQC' 2 isotropic 5 1 2 '3D 1H-13C NOESY' 2 isotropic # _pdbx_nmr_details.entry_id 38TI _pdbx_nmr_details.text 'The authors state that the NMRBOX virtual machine was used only for the analysis and structure calculations.' # _pdbx_nmr_refine.entry_id 38TI _pdbx_nmr_refine.method 'simulated annealing' _pdbx_nmr_refine.details ? _pdbx_nmr_refine.software_ordinal 10 # loop_ _pdbx_nmr_software.ordinal _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors 1 collection VnmrJ ? Varian 2 collection TopSpin ? 'Bruker Biospin' 3 processing NMRPipe ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 4 'peak picking' 'CcpNmr Analysis' '2.4 and 2.5' CCPN 5 'data analysis' 'CcpNmr Analysis' '2.4 and 2.5' CCPN 6 'chemical shift assignment' 'CcpNmr Analysis' '2.4 and 2.5' CCPN 7 'chemical shift calculation' 'CcpNmr Analysis' '2.4 and 2.5' CCPN 8 'structure calculation' TALOS+ ? 'Shen, Y., Delaglio, F., Cornilescu, G. & Bax' 9 'structure calculation' ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 10 refinement ARIA 2.3 ;Linge, O'Donoghue and Nilges ; 11 'data analysis' PyMOL ? 'Schrodinger, LLC' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASP N N N N 28 ASP CA C N S 29 ASP C C N N 30 ASP O O N N 31 ASP CB C N N 32 ASP CG C N N 33 ASP OD1 O N N 34 ASP OD2 O N N 35 ASP OXT O N N 36 ASP H H N N 37 ASP H2 H N N 38 ASP HA H N N 39 ASP HB2 H N N 40 ASP HB3 H N N 41 ASP HD2 H N N 42 ASP HXT H N N 43 CYS N N N N 44 CYS CA C N R 45 CYS C C N N 46 CYS O O N N 47 CYS CB C N N 48 CYS SG S N N 49 CYS OXT O N N 50 CYS H H N N 51 CYS H2 H N N 52 CYS HA H N N 53 CYS HB2 H N N 54 CYS HB3 H N N 55 CYS HG H N N 56 CYS HXT H N N 57 GLN N N N N 58 GLN CA C N S 59 GLN C C N N 60 GLN O O N N 61 GLN CB C N N 62 GLN CG C N N 63 GLN CD C N N 64 GLN OE1 O N N 65 GLN NE2 N N N 66 GLN OXT O N N 67 GLN H H N N 68 GLN H2 H N N 69 GLN HA H N N 70 GLN HB2 H N N 71 GLN HB3 H N N 72 GLN HG2 H N N 73 GLN HG3 H N N 74 GLN HE21 H N N 75 GLN HE22 H N N 76 GLN HXT H N N 77 GLU N N N N 78 GLU CA C N S 79 GLU C C N N 80 GLU O O N N 81 GLU CB C N N 82 GLU CG C N N 83 GLU CD C N N 84 GLU OE1 O N N 85 GLU OE2 O N N 86 GLU OXT O N N 87 GLU H H N N 88 GLU H2 H N N 89 GLU HA H N N 90 GLU HB2 H N N 91 GLU HB3 H N N 92 GLU HG2 H N N 93 GLU HG3 H N N 94 GLU HE2 H N N 95 GLU HXT H N N 96 GLY N N N N 97 GLY CA C N N 98 GLY C C N N 99 GLY O O N N 100 GLY OXT O N N 101 GLY H H N N 102 GLY H2 H N N 103 GLY HA2 H N N 104 GLY HA3 H N N 105 GLY HXT H N N 106 ILE N N N N 107 ILE CA C N S 108 ILE C C N N 109 ILE O O N N 110 ILE CB C N S 111 ILE CG1 C N N 112 ILE CG2 C N N 113 ILE CD1 C N N 114 ILE OXT O N N 115 ILE H H N N 116 ILE H2 H N N 117 ILE HA H N N 118 ILE HB H N N 119 ILE HG12 H N N 120 ILE HG13 H N N 121 ILE HG21 H N N 122 ILE HG22 H N N 123 ILE HG23 H N N 124 ILE HD11 H N N 125 ILE HD12 H N N 126 ILE HD13 H N N 127 ILE HXT H N N 128 LEU N N N N 129 LEU CA C N S 130 LEU C C N N 131 LEU O O N N 132 LEU CB C N N 133 LEU CG C N N 134 LEU CD1 C N N 135 LEU CD2 C N N 136 LEU OXT O N N 137 LEU H H N N 138 LEU H2 H N N 139 LEU HA H N N 140 LEU HB2 H N N 141 LEU HB3 H N N 142 LEU HG H N N 143 LEU HD11 H N N 144 LEU HD12 H N N 145 LEU HD13 H N N 146 LEU HD21 H N N 147 LEU HD22 H N N 148 LEU HD23 H N N 149 LEU HXT H N N 150 LYS N N N N 151 LYS CA C N S 152 LYS C C N N 153 LYS O O N N 154 LYS CB C N N 155 LYS CG C N N 156 LYS CD C N N 157 LYS CE C N N 158 LYS NZ N N N 159 LYS OXT O N N 160 LYS H H N N 161 LYS H2 H N N 162 LYS HA H N N 163 LYS HB2 H N N 164 LYS HB3 H N N 165 LYS HG2 H N N 166 LYS HG3 H N N 167 LYS HD2 H N N 168 LYS HD3 H N N 169 LYS HE2 H N N 170 LYS HE3 H N N 171 LYS HZ1 H N N 172 LYS HZ2 H N N 173 LYS HZ3 H N N 174 LYS HXT H N N 175 MET N N N N 176 MET CA C N S 177 MET C C N N 178 MET O O N N 179 MET CB C N N 180 MET CG C N N 181 MET SD S N N 182 MET CE C N N 183 MET OXT O N N 184 MET H H N N 185 MET H2 H N N 186 MET HA H N N 187 MET HB2 H N N 188 MET HB3 H N N 189 MET HG2 H N N 190 MET HG3 H N N 191 MET HE1 H N N 192 MET HE2 H N N 193 MET HE3 H N N 194 MET HXT H N N 195 THR N N N N 196 THR CA C N S 197 THR C C N N 198 THR O O N N 199 THR CB C N R 200 THR OG1 O N N 201 THR CG2 C N N 202 THR OXT O N N 203 THR H H N N 204 THR H2 H N N 205 THR HA H N N 206 THR HB H N N 207 THR HG1 H N N 208 THR HG21 H N N 209 THR HG22 H N N 210 THR HG23 H N N 211 THR HXT H N N 212 TRP N N N N 213 TRP CA C N S 214 TRP C C N N 215 TRP O O N N 216 TRP CB C N N 217 TRP CG C Y N 218 TRP CD1 C Y N 219 TRP CD2 C Y N 220 TRP NE1 N Y N 221 TRP CE2 C Y N 222 TRP CE3 C Y N 223 TRP CZ2 C Y N 224 TRP CZ3 C Y N 225 TRP CH2 C Y N 226 TRP OXT O N N 227 TRP H H N N 228 TRP H2 H N N 229 TRP HA H N N 230 TRP HB2 H N N 231 TRP HB3 H N N 232 TRP HD1 H N N 233 TRP HE1 H N N 234 TRP HE3 H N N 235 TRP HZ2 H N N 236 TRP HZ3 H N N 237 TRP HH2 H N N 238 TRP HXT H N N 239 TYR N N N N 240 TYR CA C N S 241 TYR C C N N 242 TYR O O N N 243 TYR CB C N N 244 TYR CG C Y N 245 TYR CD1 C Y N 246 TYR CD2 C Y N 247 TYR CE1 C Y N 248 TYR CE2 C Y N 249 TYR CZ C Y N 250 TYR OH O N N 251 TYR OXT O N N 252 TYR H H N N 253 TYR H2 H N N 254 TYR HA H N N 255 TYR HB2 H N N 256 TYR HB3 H N N 257 TYR HD1 H N N 258 TYR HD2 H N N 259 TYR HE1 H N N 260 TYR HE2 H N N 261 TYR HH H N N 262 TYR HXT H N N 263 VAL N N N N 264 VAL CA C N S 265 VAL C C N N 266 VAL O O N N 267 VAL CB C N N 268 VAL CG1 C N N 269 VAL CG2 C N N 270 VAL OXT O N N 271 VAL H H N N 272 VAL H2 H N N 273 VAL HA H N N 274 VAL HB H N N 275 VAL HG11 H N N 276 VAL HG12 H N N 277 VAL HG13 H N N 278 VAL HG21 H N N 279 VAL HG22 H N N 280 VAL HG23 H N N 281 VAL HXT H N N 282 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASP N CA sing N N 27 ASP N H sing N N 28 ASP N H2 sing N N 29 ASP CA C sing N N 30 ASP CA CB sing N N 31 ASP CA HA sing N N 32 ASP C O doub N N 33 ASP C OXT sing N N 34 ASP CB CG sing N N 35 ASP CB HB2 sing N N 36 ASP CB HB3 sing N N 37 ASP CG OD1 doub N N 38 ASP CG OD2 sing N N 39 ASP OD2 HD2 sing N N 40 ASP OXT HXT sing N N 41 CYS N CA sing N N 42 CYS N H sing N N 43 CYS N H2 sing N N 44 CYS CA C sing N N 45 CYS CA CB sing N N 46 CYS CA HA sing N N 47 CYS C O doub N N 48 CYS C OXT sing N N 49 CYS CB SG sing N N 50 CYS CB HB2 sing N N 51 CYS CB HB3 sing N N 52 CYS SG HG sing N N 53 CYS OXT HXT sing N N 54 GLN N CA sing N N 55 GLN N H sing N N 56 GLN N H2 sing N N 57 GLN CA C sing N N 58 GLN CA CB sing N N 59 GLN CA HA sing N N 60 GLN C O doub N N 61 GLN C OXT sing N N 62 GLN CB CG sing N N 63 GLN CB HB2 sing N N 64 GLN CB HB3 sing N N 65 GLN CG CD sing N N 66 GLN CG HG2 sing N N 67 GLN CG HG3 sing N N 68 GLN CD OE1 doub N N 69 GLN CD NE2 sing N N 70 GLN NE2 HE21 sing N N 71 GLN NE2 HE22 sing N N 72 GLN OXT HXT sing N N 73 GLU N CA sing N N 74 GLU N H sing N N 75 GLU N H2 sing N N 76 GLU CA C sing N N 77 GLU CA CB sing N N 78 GLU CA HA sing N N 79 GLU C O doub N N 80 GLU C OXT sing N N 81 GLU CB CG sing N N 82 GLU CB HB2 sing N N 83 GLU CB HB3 sing N N 84 GLU CG CD sing N N 85 GLU CG HG2 sing N N 86 GLU CG HG3 sing N N 87 GLU CD OE1 doub N N 88 GLU CD OE2 sing N N 89 GLU OE2 HE2 sing N N 90 GLU OXT HXT sing N N 91 GLY N CA sing N N 92 GLY N H sing N N 93 GLY N H2 sing N N 94 GLY CA C sing N N 95 GLY CA HA2 sing N N 96 GLY CA HA3 sing N N 97 GLY C O doub N N 98 GLY C OXT sing N N 99 GLY OXT HXT sing N N 100 ILE N CA sing N N 101 ILE N H sing N N 102 ILE N H2 sing N N 103 ILE CA C sing N N 104 ILE CA CB sing N N 105 ILE CA HA sing N N 106 ILE C O doub N N 107 ILE C OXT sing N N 108 ILE CB CG1 sing N N 109 ILE CB CG2 sing N N 110 ILE CB HB sing N N 111 ILE CG1 CD1 sing N N 112 ILE CG1 HG12 sing N N 113 ILE CG1 HG13 sing N N 114 ILE CG2 HG21 sing N N 115 ILE CG2 HG22 sing N N 116 ILE CG2 HG23 sing N N 117 ILE CD1 HD11 sing N N 118 ILE CD1 HD12 sing N N 119 ILE CD1 HD13 sing N N 120 ILE OXT HXT sing N N 121 LEU N CA sing N N 122 LEU N H sing N N 123 LEU N H2 sing N N 124 LEU CA C sing N N 125 LEU CA CB sing N N 126 LEU CA HA sing N N 127 LEU C O doub N N 128 LEU C OXT sing N N 129 LEU CB CG sing N N 130 LEU CB HB2 sing N N 131 LEU CB HB3 sing N N 132 LEU CG CD1 sing N N 133 LEU CG CD2 sing N N 134 LEU CG HG sing N N 135 LEU CD1 HD11 sing N N 136 LEU CD1 HD12 sing N N 137 LEU CD1 HD13 sing N N 138 LEU CD2 HD21 sing N N 139 LEU CD2 HD22 sing N N 140 LEU CD2 HD23 sing N N 141 LEU OXT HXT sing N N 142 LYS N CA sing N N 143 LYS N H sing N N 144 LYS N H2 sing N N 145 LYS CA C sing N N 146 LYS CA CB sing N N 147 LYS CA HA sing N N 148 LYS C O doub N N 149 LYS C OXT sing N N 150 LYS CB CG sing N N 151 LYS CB HB2 sing N N 152 LYS CB HB3 sing N N 153 LYS CG CD sing N N 154 LYS CG HG2 sing N N 155 LYS CG HG3 sing N N 156 LYS CD CE sing N N 157 LYS CD HD2 sing N N 158 LYS CD HD3 sing N N 159 LYS CE NZ sing N N 160 LYS CE HE2 sing N N 161 LYS CE HE3 sing N N 162 LYS NZ HZ1 sing N N 163 LYS NZ HZ2 sing N N 164 LYS NZ HZ3 sing N N 165 LYS OXT HXT sing N N 166 MET N CA sing N N 167 MET N H sing N N 168 MET N H2 sing N N 169 MET CA C sing N N 170 MET CA CB sing N N 171 MET CA HA sing N N 172 MET C O doub N N 173 MET C OXT sing N N 174 MET CB CG sing N N 175 MET CB HB2 sing N N 176 MET CB HB3 sing N N 177 MET CG SD sing N N 178 MET CG HG2 sing N N 179 MET CG HG3 sing N N 180 MET SD CE sing N N 181 MET CE HE1 sing N N 182 MET CE HE2 sing N N 183 MET CE HE3 sing N N 184 MET OXT HXT sing N N 185 THR N CA sing N N 186 THR N H sing N N 187 THR N H2 sing N N 188 THR CA C sing N N 189 THR CA CB sing N N 190 THR CA HA sing N N 191 THR C O doub N N 192 THR C OXT sing N N 193 THR CB OG1 sing N N 194 THR CB CG2 sing N N 195 THR CB HB sing N N 196 THR OG1 HG1 sing N N 197 THR CG2 HG21 sing N N 198 THR CG2 HG22 sing N N 199 THR CG2 HG23 sing N N 200 THR OXT HXT sing N N 201 TRP N CA sing N N 202 TRP N H sing N N 203 TRP N H2 sing N N 204 TRP CA C sing N N 205 TRP CA CB sing N N 206 TRP CA HA sing N N 207 TRP C O doub N N 208 TRP C OXT sing N N 209 TRP CB CG sing N N 210 TRP CB HB2 sing N N 211 TRP CB HB3 sing N N 212 TRP CG CD1 doub Y N 213 TRP CG CD2 sing Y N 214 TRP CD1 NE1 sing Y N 215 TRP CD1 HD1 sing N N 216 TRP CD2 CE2 doub Y N 217 TRP CD2 CE3 sing Y N 218 TRP NE1 CE2 sing Y N 219 TRP NE1 HE1 sing N N 220 TRP CE2 CZ2 sing Y N 221 TRP CE3 CZ3 doub Y N 222 TRP CE3 HE3 sing N N 223 TRP CZ2 CH2 doub Y N 224 TRP CZ2 HZ2 sing N N 225 TRP CZ3 CH2 sing Y N 226 TRP CZ3 HZ3 sing N N 227 TRP CH2 HH2 sing N N 228 TRP OXT HXT sing N N 229 TYR N CA sing N N 230 TYR N H sing N N 231 TYR N H2 sing N N 232 TYR CA C sing N N 233 TYR CA CB sing N N 234 TYR CA HA sing N N 235 TYR C O doub N N 236 TYR C OXT sing N N 237 TYR CB CG sing N N 238 TYR CB HB2 sing N N 239 TYR CB HB3 sing N N 240 TYR CG CD1 doub Y N 241 TYR CG CD2 sing Y N 242 TYR CD1 CE1 sing Y N 243 TYR CD1 HD1 sing N N 244 TYR CD2 CE2 doub Y N 245 TYR CD2 HD2 sing N N 246 TYR CE1 CZ doub Y N 247 TYR CE1 HE1 sing N N 248 TYR CE2 CZ sing Y N 249 TYR CE2 HE2 sing N N 250 TYR CZ OH sing N N 251 TYR OH HH sing N N 252 TYR OXT HXT sing N N 253 VAL N CA sing N N 254 VAL N H sing N N 255 VAL N H2 sing N N 256 VAL CA C sing N N 257 VAL CA CB sing N N 258 VAL CA HA sing N N 259 VAL C O doub N N 260 VAL C OXT sing N N 261 VAL CB CG1 sing N N 262 VAL CB CG2 sing N N 263 VAL CB HB sing N N 264 VAL CG1 HG11 sing N N 265 VAL CG1 HG12 sing N N 266 VAL CG1 HG13 sing N N 267 VAL CG2 HG21 sing N N 268 VAL CG2 HG22 sing N N 269 VAL CG2 HG23 sing N N 270 VAL OXT HXT sing N N 271 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number 1R15GM141976 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_nmr_spectrometer.spectrometer_id _pdbx_nmr_spectrometer.model _pdbx_nmr_spectrometer.type _pdbx_nmr_spectrometer.manufacturer _pdbx_nmr_spectrometer.field_strength _pdbx_nmr_spectrometer.details 1 INOVA ? Varian 600 ? 2 AVANCE ? Bruker 800 ? # _atom_sites.entry_id 38TI _atom_sites.Cartn_transf_matrix[1][1] ? _atom_sites.Cartn_transf_matrix[1][2] ? _atom_sites.Cartn_transf_matrix[1][3] ? _atom_sites.Cartn_transf_matrix[2][1] ? _atom_sites.Cartn_transf_matrix[2][2] ? _atom_sites.Cartn_transf_matrix[2][3] ? _atom_sites.Cartn_transf_matrix[3][1] ? _atom_sites.Cartn_transf_matrix[3][2] ? _atom_sites.Cartn_transf_matrix[3][3] ? _atom_sites.Cartn_transf_vector[1] ? _atom_sites.Cartn_transf_vector[2] ? _atom_sites.Cartn_transf_vector[3] ? _atom_sites.Cartn_transform_axes ? _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 _atom_sites.solution_primary ? _atom_sites.solution_secondary ? _atom_sites.solution_hydrogens ? _atom_sites.special_details ? # loop_ _atom_type.symbol C H N O S # loop_ #